A transformer protein language diffusion model to create all-atom IDP ensembles and IDR disordered ensembles that maintains the folded domains.
The environment can be built via conda env create -f env.yml, and optionally pip install -e .. This repo also requires openfold utilities, please refer to https://openfold.readthedocs.io/en/latest/Installation.html for installation instructions. The dependencies largely overlap with ones required by openfold. If you have issues installing from yml file, it is recommended to follow the installation by openfold, and then activate the environment and install other dependencies conda install einops mdtraj -c conda-forge.
ESM2 utilities are refactored into this repo for network modules and exploring the effects of ESM embedding on IDP modeling. Alternatively, it can be installed from their github https://github.com/facebookresearch/esm.git, or via pip install pip install fair-esm.
Optional: pip install flash-attn==2.3 to speed up attention calculation.
It can also be built as a docker container using the included dockerfile. To build it, run the following command from the root of this repository:
docker build -t idpforge .To verify that your docker installation is able to properly communicate with your GPU, run
docker run --rm --gpus all nvidia/cuda:11.0-base nvidia-smiModels weights and an example training data and other inference input files can be downloaded from Figshare. Unzip and move them to the corresponding folder before running scripts.
We use pytorch-lightning for training and one can customize training via the documented flags under trainer in the config file.
conda activate idpforge
python train.py --model_config_path configs/train.ymlWe provide a commandline interface to sample single chain IDP/IDRs.
usage: sample_idp.py [-h] [--batch BATCH] [--nconf NCONF] [--cuda]
ckpt_path output_dir sample_cfg
positional arguments:
seq protein sequence
ckpt_path path to model weights
output_dir directory to output pdbs
sample_cfg path to a sampling configuration yaml file
optional arguments:
--batch BATCH batch size
--nconf NCONF number of conformers to sample
--cuda whether to use cuda or cpu
Example to generate 100 conformers for Sic1:
mkdir test
sequence="GSMTPSTPPRSRGTRYLAQPSGNTSSSALMQGQKTPQKPSQNLVPVTPSTTKSFKNAPLLAPPNSNMGMTSPFNGLTSPQRSPFPKSSVKRT"
python sample_idp.py $sequence weights/mdl.ckpt test configs/sample.yml --nconf 100 --cuda Inference time experimental guidance can be activated by the potential flag in the configs/sample.yml. An example PREs experimental data file is also provided in data/sic1_pre_exp.txt.
First, to prepare the folded template, run python init_ldr_template.py. We provide an example for sampling the low confidence region of AF entry P05231:
python mk_ldr_template.py data/AF-P05231-F1-model_v4.pdb 1-41 data/AF-P05231_ndr.npzThe provided model weights are not recommended for predicting multiple domains at the same time.
Then, to generate an IDRs with folded domains ensemble, run
mkdir P05231_build
python sample_ldr.py weights/mdl.ckpt data/AF-P05231_ndr.npz P05231_build configs/sample.yml --nconf 100 --cudaOne can set the attention_chunk to manage memory usage for long sequences (Inference on long disordered sequences may be limited by training sequence length).
We use UCBShift for chemical shift prediction and can be installed at https://github.com/THGLab/CSpred.git. If you wish to use X-EISD for evaluation or reweighing with experimental data, please refer to https://github.com/THGLab/X-EISDv2.
@article{zhang2025,
author = {Zhang, Oufan and Liu, Zi-Hao and Forman-Kay, Julie D. Head-Gordon, Teresa},
title = {Deep Learning of Proteins with Local and Global Regions of Disorder},
journal = {arXiv preprint},
year = {2025},
archivePrefix = {arXiv},
eprint = {2502.11326},
}