Skip to content

Latest commit

 

History

History
672 lines (520 loc) · 25.7 KB

File metadata and controls

672 lines (520 loc) · 25.7 KB

🧬 Bioinformatics ML Repository

End-to-End Machine Learning Suite for Antimicrobial Resistance & Drug Discovery

A comprehensive collection of production-ready ML projects tackling critical challenges in infectious disease and drug development. From resistance prediction to generative drug design and automated diagnostics.

Python ML Bio GitHub


📋 Projects

1. 🛡️ Ceftriaxone Resistance Predictor

Classification Model for Antibiotic Resistance Detection

  • Task: Binary classification (Susceptible vs Resistant)
  • Model: Random Forest Classifier
  • Accuracy: 94.9% | Sensitivity: 93.9% | Specificity: 95.9%
  • Data: 4,383 E. coli isolates from NCBI
  • App: streamlit run src/app.py

2. 💊 AI Peptide Dosing Calculator

Regression Model for Antimicrobial Peptide Potency Prediction

  • Task: MIC (Minimum Inhibitory Concentration) prediction
  • Model: Random Forest Regressor
  • R² Score: 0.9992 | RMSE: 0.024 log units
  • Data: 3,143 E. coli isolates with MIC values
  • App: streamlit run src/app_MIC.py

3. 🧬 Week 4: Peptide Sequence Generator

Generative AI for Antimicrobial Peptide Design

  • Task: Generate novel peptide sequences (generative modeling)
  • Model: 2-Layer LSTM (PyTorch) - Character-level RNN
  • Performance: Loss 0.8541 | Generates realistic AMP sequences
  • Data: 2,872 E. coli peptides (10-50 AA length)
  • Training: ~10 min CPU / ~2 min GPU | 50 epochs
  • Status: ✅ Fully trained, ready for inference
  • Use: Computational screening, rational design, drug discovery

4. 🧠 DeepG2P - Deep Resistance PredictorNEW

1D ResNet for Multi-label Antimicrobial Resistance Prediction from Mass Spectrometry

  • Task: Multi-label classification (10 antibiotics)
  • Model: ResNet-1D (2M parameters) - Deep CNN with residual blocks
  • Architecture: Conv1D → 4 ResBlock stages → Global AvgPool → FC → Sigmoid
  • Input: MALDI-TOF mass spectra (6000 m/z bins)
  • Loss: BCEWithLogitsLoss with pos_weight (handles class imbalance)
  • Optimizer: AdamW (lr=1e-4, weight_decay=1e-5)
  • Metrics: AUPRC, AUROC tracked via TensorBoard
  • Training: 20 epochs with automatic best model checkpointing
  • Features: Flexible model sizes (small/medium/large), feature extraction
  • Documentation: See src/README.md for detailed architecture

🏥 Biological Context

Antimicrobial Resistance (AMR)

Challenge: Antibiotic-resistant bacteria cause ~1.3M deaths annually (WHO). Traditional lab testing takes 24-48 hours, delaying treatment.

Solution: Use genomic markers to instantly predict resistance from DNA sequences.

Antimicrobial Peptides (AMPs)

Challenge: Designing potent peptides requires expensive lab screening. Potency varies wildly (MIC: 0.1 - 1000+ µM).

Solution: Use machine learning to predict peptide efficacy and generate new candidates from physicochemical properties and sequence patterns.

Peptide Generation

Challenge: Design space for peptides is massive (20^50 for 50-length sequences = 10^65 possibilities). Manual screening is infeasible.

Solution: Train generative AI to learn natural peptide patterns and create novel, biologically plausible sequences for experimental validation.

Deep Learning for Mass Spectrometry (NEW)

Challenge: MALDI-TOF mass spectrometry is fast (minutes) but requires expert interpretation. Multi-drug resistance requires testing 10+ antibiotics.

Solution: Train deep neural networks to directly predict resistance profiles from raw mass spectra, enabling instant multi-drug diagnostics.


� Repository Structure

ML-Training/
├── projects/
│   ├── cefixime-resistance-training/    # Antibiotic resistance classifier
│   │   ├── data/
│   │   │   ├── raw/                      # Original NCBI isolates
│   │   │   └── processed/                # Cleaned genotype data
│   │   ├── src/
│   │   │   ├── process.py                # Data preprocessing
│   │   │   └── train.py                  # Model training (RF classifier)
│   │   ├── models/
│   │   │   └── ceftriaxone_model.pkl    # Trained classifier
│   │   └── results/
│   │       ├── confusion_matrix.html     # Interactive CM
│   │       └── feature_importance.csv    # Top resistance genes
│   │
│   └── MIC Regression/                   # Peptide potency regressor
│       ├── data/
│       │   ├── raw/                      # Raw peptide sequences & MIC values
│       │   └── processed/                # Computed physicochemical features
│       ├── src/
│       │   ├── process.py                # Data preprocessing
│       │   └── train.py                  # Model training (RF regressor)
│       ├── models/
│       │   └── mic_predictor.pkl        # Trained regressor
│       └── results/
│           ├── predicted_vs_actual.png   # Predictions visualization
│           └── feature_importance.png    # Top peptide features
│   │
│   └── week4_peptide_generator/          # Generative LSTM
│       ├── data/
│       │   └── ecolitraining_set_80.csv  # 2,872 E. coli peptides
│       ├── models/
│       │   ├── peptide_lstm.pth          # Best model (loss: 0.854)
│       │   └── config.json               # Training hyperparameters
│       ├── src/
│       │   ├── vocab.py                  # PeptideVocab: AA tokenization
│       │   └── train_generator.py        # PyTorch LSTM training
│       └── README.md
│
├── src/                                   # 🆕 DeepG2P Model & Apps
│   ├── model.py                          # ResNet-1D architecture (DeepG2P, ResidualBlock)
│   ├── train.py                          # Training pipeline (BCEWithLogitsLoss, AdamW)
│   ├── app.py                            # Ceftriaxone classifier Streamlit app
│   ├── app_MIC.py                        # MIC regressor Streamlit app
│   ├── features.py                       # Biopython feature extraction
│   └── README.md                         # DeepG2P documentation
│
├── models/                                # 🆕 Saved model checkpoints
│   ├── best_model.pth                    # Best validation loss checkpoint
│   └── checkpoint_epoch_*.pth            # Periodic training checkpoints
│
├── results/                               # 🆕 Training outputs
│   ├── logs/                             # TensorBoard logs
│   └── training_config.json              # Hyperparameters & metadata
│
├── utils/
│   └── model_evaluation.py               # Shared evaluation metrics
│
├── requirements.txt                      # Python dependencies (PyTorch, sklearn, etc.)
└── README.md                             # This file

🚀 Quick Start

Prerequisites

  • Python 3.8+
  • Git

Installation

# Clone repository
git clone https://github.com/vihaankulkarni29/ML-Training
cd ML-Training

# Install dependencies
pip install -r requirements.txt

Run Applications

Ceftriaxone Resistance Predictor (Classifier):

streamlit run src/app.py

Access at http://localhost:8501

AI Peptide Dosing Calculator (Regressor):

streamlit run src/app_MIC.py

Access at http://localhost:8501

DeepG2P Model Training:

# Train with default parameters
python src/train.py

# Custom training
python src/train.py \
  --train-features data/processed/X_train.npy \
  --train-labels data/processed/y_train.npy \
  --val-features data/processed/X_val.npy \
  --val-labels data/processed/y_val.npy \
  --epochs 20 \
  --batch-size 32 \
  --model-size medium

# Monitor training
tensorboard --logdir results/logs

📊 Project 1: Ceftriaxone Resistance Predictor

Problem Statement

Antibiotic susceptibility testing via culture takes 24-48 hours. Patients with life-threatening infections can't wait. Goal: Predict Ceftriaxone resistance instantly from genomic markers.

Solution

  • Model: Random Forest Classifier (100 trees, balanced class weights)
  • Data: 4,383 E. coli isolates from NCBI MicroBIGG-E
  • Features: 352 detected resistance genes/mutations

Performance Metrics

Metric Value
Accuracy 94.9%
Sensitivity 93.9%
Specificity 95.9%
ROC-AUC 0.978
Test Set Size 876 isolates

Key Insights

The model independently discovered known resistance mechanisms:

  • blaCTX-M-15 (Extended-Spectrum Beta-Lactamase) - strongest predictor
  • blaCMY-2 (AmpC Cephalosporinase)
  • gyrA_S83L (Gyrase mutation - fluoroquinolone resistance)

Biological Mechanism

Beta-lactamase genes encode enzymes that destroy beta-lactam antibiotics (e.g., cephalosporins) before they can bind to bacterial cell walls.

Files

  • Training: projects/cefixime-resistance-training/src/train.py
  • Model: projects/cefixime-resistance-training/models/ceftriaxone_model.pkl
  • App: src/app.py

💊 Project 2: AI Peptide Dosing Calculator

Problem Statement

Antimicrobial peptide (AMP) design is expensive and slow. Wet-lab screening for potency (MIC) takes months. Goal: Predict MIC instantly from sequence, enabling computational design cycles.

Solution

  • Model: Random Forest Regressor (100 trees)
  • Data: 3,143 E. coli isolates with MIC values (NCBI)
  • Target: neg_log_mic_microM (-log10 of MIC in µM)

Performance Metrics

Metric Current (K-mers) Previous (Baseline)
R² Score 0.9992 0.4461
RMSE 0.024 log units 0.629 log units
Pearson r 0.9996 0.6742
p-value < 0.001 < 0.001
Test Set Size 629 peptides 629 peptides
Features 410 (7 + 399 k-mers) 7 (physicochemical only)

Interpretation

  • RMSE of 0.024 log units = ~1.06x fold-change (nearly perfect prediction!)
  • Model explains 99.9% of variance in test data (breakthrough performance)
  • Near-perfect correlation with actual values (r = 0.9996)

Feature Engineering

Physicochemical Properties (7 features via Biopython):

  1. Molecular Weight - correlates with toxicity vs efficacy
  2. Aromaticity - aromatic residues enhance membrane interaction
  3. Instability Index - peptide stability in vivo
  4. Isoelectric Point - charge affects cellular uptake
  5. GRAVY (hydrophobicity) - hydrophobic residues improve activity
  6. Length - longer peptides often more potent but less specific
  7. Positive Charge - (K + R count) - important for bacterial binding

K-mer (Dipeptide) Features (399 features via CountVectorizer):

  • Extracts all 2-character amino acid combinations (e.g., "KK", "WR", "EK")
  • Captures sequence order information (solves "bag of words" problem)
  • Preserves local context: distinguishes R-R-W-W from W-R-W-R
  • Min frequency threshold (min_df=5) filters rare k-mers
  • Breakthrough improvement: R² 0.45 → 0.9992 (+122% relative gain)

Potency Categories

  • < 2 µM: 💎 Excellent (highly potent)
  • 2-10 µM: ✅ Good (reasonable activity)
  • 10-50 µM: ⚠️ Weak (marginal)
  • 50 µM: ❌ Inactive (not viable)

Model Evolution: Solving the "Bag of Words" Problem

Initial Challenge (R² = 0.45)

The baseline model using only physicochemical properties hit a performance ceiling because it treated sequences as ingredients, not recipes.

The Problem:

  • Sequence R-R-W-W (positive charge → hydrophobic) might be highly potent
  • Sequence W-R-W-R (alternating pattern) could be ineffective
  • Issue: Both have identical weight, charge, GRAVY → model couldn't distinguish them

Physicochemical features are sequence-order agnostic - they summarize global composition but ignore local patterns critical for membrane interaction.

Solution: K-mer Features (Implemented)

Added dipeptide counting to capture local sequence context:

from sklearn.feature_extraction.text import CountVectorizer

vectorizer = CountVectorizer(
    analyzer='char',
    ngram_range=(2, 2),  # Dipeptides (AA, AK, KE, WW, etc.)
    min_df=5              # Ignore rare k-mers
)
kmer_features = vectorizer.fit_transform(sequences)
# Result: 399 k-mer features capturing sequence order

Breakthrough Results:

  • R² improved from 0.45 → 0.9992 (99.9% variance explained)
  • RMSE reduced from 0.63 → 0.024 log units (~27x improvement)
  • Model now distinguishes R-R-W-W from W-R-W-R based on local patterns

Why K-mers Work:

  • Capture pairwise amino acid interactions (e.g., "KK" = strong positive clustering)
  • Preserve positional information without overfitting (unlike full sequence embeddings)
  • Interpretable: Can analyze top k-mers for biological plausibility
  • Computationally efficient for inference

Biological Validation: Top k-mer features likely include:

  • "KK", "RR" - positive charge clustering (enhances bacterial binding)
  • "WW", "FF" - hydrophobic patches (membrane insertion)
  • "KE", "RD" - charged pairs (amphipathicity)

This aligns with known AMP design principles where local sequence motifs drive activity more than global properties.

Files

  • Feature extraction: src/features.py
  • Training: projects/MIC Regression/src/train.py
  • Model: projects/MIC Regression/models/mic_predictor.pkl
  • Processed data: projects/MIC Regression/data/processed/processed_features.csv
  • App: src/app_MIC.py

🧬 Project 3: Week 4 Peptide Sequence Generator ⭐ NEW

Problem Statement

Designing antimicrobial peptides requires screening millions of candidates. The design space is massive (20^50 ≈ 10^65 for 50-length sequences). Goal: Use generative AI to learn natural peptide patterns and create novel candidates for experimental validation.

Solution

  • Model: 2-Layer LSTM (PyTorch character-level RNN)
  • Data: 2,872 E. coli peptides (10-50 AA length)
  • Task: Learn to predict next amino acid in sequence → generate new peptides

Training Results

Metric Value Status
Initial Loss (Epoch 1) 2.81 Random
Target Achieved (Epoch 15) 1.59 ✅ Hit target
Final Loss (Epoch 50) 0.854 ✨ Excellent
Training Time (CPU) ~10 min Practical
Training Time (GPU) ~2 min Fast
Vocab Size 23 (20 AA + 3 special)
Model Parameters ~1.3M Manageable

Architecture

Input: Sequence of amino acid indices
    ↓
Embedding (vocab_size=23 → embedding_dim=128)
    ↓
LSTM Layer 1 (128 → 256 units) + Dropout(0.3)
    ↓
LSTM Layer 2 (256 → 256 units) + Dropout(0.3)
    ↓
Linear (256 → vocab_size=23)
    ↓
Output: Logits for next token

Sample Generated Sequences

Epoch 50 Generations (Temperature=0.8):

1. FLPAIVGAAAKFLPKIFCAITKKC     ← Hydrophobic core + basic tail
2. GIGKFLHSAKKFGKAFVGEIMNS      ← Alternating hydrophobic/charged
3. SKVGRHWRRFWHRAHRLLHR         ← Rich in W (aromatic) & R (cationic)
4. GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
5. LLGDFFRKSKEKIGKEFKRIVQRIKDFFRNLVPRTES

Why These Look Realistic:

  • Contain hydrophobic residues (L, V, I, F) for membrane interaction
  • Cationic clusters (K, R) for bacterial binding
  • Avoid D, E (acidic) which would reduce activity
  • Length distribution matches natural AMPs
  • No known toxins generated

Key Insights

  1. Model learned biological patterns without explicit rules
  2. Generative capability → enables computational screening
  3. Loss convergence shows genuine pattern learning (not memorization)
  4. Character-level modeling better than sequence models for this task

Biological Potential

Next Steps (Future Work):

  • MIC Prediction: Use Project 2 regressor on generated sequences
  • Toxicity Screening: Hemolysis prediction models
  • Structural Validation: AlphaFold2 for 3D verification
  • Lab Validation: Experimental MIC testing

Files

  • Vocabulary: projects/week4_peptide_generator/src/vocab.py
  • Training & Generation: projects/week4_peptide_generator/src/train_generator.py
  • Best Model: projects/week4_peptide_generator/models/peptide_lstm.pth
  • Checkpoints: projects/week4_peptide_generator/models/peptide_lstm_epoch_{10,20,30,40,50}.pth
  • Documentation: projects/week4_peptide_generator/README.md

Use Case: Multi-Stage Screening Pipeline

┌─────────────────────────────────────────────────────────────┐
│ Stage 1: GENERATION (Week 4 Peptide Generator)              │
│ Generate 1000 candidate sequences                            │
│ Temperature=0.8 for balanced novelty/realism                │
└─────────────────────────┬──────────────────────────────────┘
                          │
┌─────────────────────────▼──────────────────────────────────┐
│ Stage 2: POTENCY PREDICTION (Project 2: MIC Regressor)     │
│ Predict MIC for each candidate                              │
│ Filter: Keep only high-potency (MIC < 5 µM)                │
│ Result: ~50-100 promising candidates                        │
└─────────────────────────┬──────────────────────────────────┘
                          │
┌─────────────────────────▼──────────────────────────────────┐
│ Stage 3: EXPERIMENTAL VALIDATION                            │
│ Synthesize top 20 candidates                                │
│ Test MIC, toxicity, stability                               │
│ → 2-3 viable drug leads per iteration                       │
└─────────────────────────────────────────────────────────────┘

This computational-experimental hybrid dramatically reduces time & cost vs. random screening.


🔬 Scientific Validation Framework

All projects include built-in validation mechanisms to ensure scientific rigor and prevent common ML failures.

1️⃣ Sparse Data Bias Mitigation (Week 3: Outbreak Detective)

Problem: Clustering treating single-sample locations as valid clusters.

Solution: Filter locations with <5 samples before matrix construction.

python src/process_matrix.py --min-location-samples 5

Impact: Prevents geographic clustering artifacts, improves statistical reliability.

2️⃣ Plagiarism Detection (Week 4: Peptide Generator)

Problem: Generated peptides might be >90% identical to training data (memorization).

Solution: Check sequence homology using SequenceMatcher before screening.

Filtered 2 candidates for high homology (>90% identity)
✓ Novelty status: NOVEL

Impact: Ensures generated peptides are truly novel for experimental validation.

3️⃣ Extrapolation Detection (Week 2 & 4: MIC Prediction)

Problem: Regressor predicts values outside training range (hallucination).

Example: Training MIC range 0.5-256 µM, but model predicts 0.017 µM

Solution: Flag predictions outside training range with confidence indicators.

Flagged 2 predictions with LOW_CONFIDENCE* (outside training range 0.5-256 µM)
prediction_confidence: HIGH_CONFIDENCE or LOW_CONFIDENCE*

Impact: Prevents overconfident predictions on extrapolated values.

4️⃣ Image Quality Gating (Week 5: Auto AST)

Problem: Computer vision fails with poor lighting (too dark or overexposed).

Solution: Validate image intensity before analysis.

Image quality: mean_intensity = 125.4
✓ Image quality validated (within 50-200 range)

Impact: Prevents false positives/negatives from suboptimal imaging conditions.


🔬 Technical Stack

Data Science

  • Pandas: Data manipulation & analysis
  • NumPy: Numerical computations
  • Scikit-Learn: RandomForest classifiers & regressors
  • Biopython: Protein sequence analysis (Bio.SeqUtils.ProtParam)
  • SciPy: Statistical tests (Pearson correlation, etc.)

Visualization

  • Matplotlib: Static publication-ready plots
  • Plotly: Interactive HTML charts
  • Kaleido: PNG export from Plotly

Deployment

  • Streamlit: Interactive web apps (no frontend coding)
  • Joblib: Model persistence (.pkl files)
  • GitHub: Version control & deployment integration

🏥 Biological Background

Antimicrobial Resistance (AMR)

Global Impact:

  • ~1.3M deaths/year attributable to AMR (WHO, 2022)
  • Top 10 global health threat
  • Economic cost: $100B+ annually in healthcare

Genetic Basis (Ceftriaxone Example):

  1. Enzymatic Inactivation: blaCTX-M genes produce beta-lactamases that hydrolyze beta-lactam ring
  2. Target Modification: gyrA mutations alter DNA gyrase binding site
  3. Efflux Pumps: acrB overexpression exports antibiotics before they act

Antimicrobial Peptides (AMPs)

Natural Defense:

  • Found in all life forms (immune system, skin, GI tract)
  • Kill bacteria via direct membrane disruption
  • Less likely to develop resistance (multiple mechanisms)

Design Challenge:

  • Potency (MIC) varies 1000-fold (0.1 - 100+ µM)
  • Toxicity risk increases with potency
  • Design space is massive (20^n for n-length peptides)

ML Solution:

  • Use physicochemical properties to predict potency
  • Enable rational design instead of random screening
  • Reduce wet-lab costs & timelines

📚 Literature & Data Sources

Antimicrobial Resistance

Antimicrobial Peptides

Biopython Feature Extraction


⚠️ Disclaimers

Ceftriaxone Predictor

For research/educational use only. Not a clinical diagnostic device.

  • Always confirm predictions with lab culture + antibiotic susceptibility testing (EUCAST/CLSI)
  • Consult clinical microbiology before treatment decisions
  • Models trained on specific E. coli population; validate locally

MIC Calculator

For research/design purposes only. Not validated for clinical use.

  • Predicted MIC is a computational estimate; always validate experimentally
  • Model trained on specific data; performance may vary on novel sequences
  • Use as design guidance, not final arbiter of peptide efficacy

🎯 Roadmap

Q1 2025

  • Multi-organism support (Klebsiella, Pseudomonas)
  • SHAP explainability for individual predictions
  • Confidence intervals for MIC predictions

Q2 2025

  • REST API for integration with LIS systems
  • Additional antibiotics (fluoroquinolones, aminoglycosides)
  • Uncertainty quantification via Bayesian methods

Q3 2025

  • Mobile app (iOS/Android) for field deployment
  • Real-time database updates from NCBI
  • Community contribution framework

👤 Author

Vihaan Kulkarni — Bioinformatics & Machine Learning Engineer


📄 License

MIT License — Free for academic and research use.


Last Updated: December 17, 2025

Status: ✅ Active Development

Phase 6: Documentation

  1. Fill out README.md with:
    • Problem statement
    • Key insights (with screenshots)
    • Model metrics
    • Deployment link
  2. Use "Problem → Method → Insight → Impact" structure

📦 Standard Dependencies

Every project includes:

  • Data: pandas, numpy
  • Visualization: plotly, kaleido
  • Modeling: scikit-learn
  • Explainability: shap
  • Deployment: streamlit

Optional (uncomment in requirements.txt if needed):

  • Experiment Tracking: mlflow, wandb
  • Deep Learning: torch, tensorflow

💡 Pro Tips

  1. Run baseline first: Always compare against a simple model
  2. Plotly over Matplotlib: Interactive charts reveal more insights
  3. Document as you go: Fill README during the project, not after
  4. Save figures: Use fig.write_html() to preserve interactivity
  5. Version control: Commit after each major milestone

🎓 Learning Resources


📊 Portfolio Goals

  • ✅ 1 high-quality project per week
  • ✅ Every project deployed with Streamlit
  • ✅ README formatted for resume/GitHub
  • ✅ Interactive visualizations (no static PNGs)
  • ✅ Model explainability included

Built by Vihaan Kulkarni
Senior ML Engineer & Data Storyteller