Error decompressing sequences

[dcdanko]

I'm getting the following error while using MICA

Error processing queries: Could not decompress coarse sequence 16859848 (16, 43): Could not read compressed sequence: Could not scan coarse sequence residues of 16859848 from coarse-file: input does not match format

This comes from the following segment in coarse.go

n, err := fmt.Fscanf(coarsedb.FileFasta, ">%d\n%s\n", &corSeqId, &residues)

if err != nil {
        return nil, fmt.Errorf("Could not scan coarse sequence residues of %d from coarse-file: %s", id, err)
}

However the relevant lines in coarse.fasta appears to be fine:

>16859848
MKLTEKKKEEWEKLLRDTALIGPIDTIQEHTQGDLWEFGSQTRGNYFFSTEKFVFVGGLGGLTNFSVPYKNIKELKLCNIGGLIPIIPTGIKVTYTDENGKSVKKKCSVMKRKDWLAYLQEKSGIS

[dcdanko]

This issue is caused by 'fixing' the spaces in coarse.fasta (#5)

This fix breaks the index of coarse.fasta.

I do not have a fix for coarse.fasta.index yet