diff --git a/go.mod b/go.mod
index 4b878e99d..7cf03da95 100644
--- a/go.mod
+++ b/go.mod
@@ -13,7 +13,7 @@ require (
github.com/hashicorp/vault/sdk v0.12.0
github.com/pkg/errors v0.9.1
github.com/spf13/cobra v1.10.1
- github.com/spf13/pflag v1.0.9
+ github.com/spf13/pflag v1.0.10
golang.org/x/text v0.32.0
gomodules.xyz/logs v0.0.7
gomodules.xyz/password-generator v0.2.9
@@ -29,7 +29,7 @@ require (
k8s.io/kubectl v0.30.2
kmodules.xyz/client-go v0.34.2
kmodules.xyz/custom-resources v0.34.0
- kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b
+ kubevault.dev/apimachinery v0.24.0-rc.0
sigs.k8s.io/secrets-store-csi-driver v1.5.1
sigs.k8s.io/yaml v1.6.0
)
@@ -67,7 +67,7 @@ require (
github.com/Azure/go-ansiterm v0.0.0-20230124172434-306776ec8161 // indirect
github.com/AzureAD/microsoft-authentication-library-for-go v1.2.2 // indirect
github.com/MakeNowJust/heredoc v1.0.0 // indirect
- github.com/Masterminds/semver/v3 v3.3.1 // indirect
+ github.com/Masterminds/semver/v3 v3.4.0 // indirect
github.com/beorn7/perks v1.0.1 // indirect
github.com/blang/semver/v4 v4.0.0 // indirect
github.com/cenkalti/backoff/v3 v3.2.2 // indirect
@@ -84,7 +84,7 @@ require (
github.com/fsnotify/fsnotify v1.9.0 // indirect
github.com/fxamacker/cbor/v2 v2.9.0 // indirect
github.com/ghodss/yaml v1.0.0 // indirect
- github.com/go-jose/go-jose/v4 v4.0.5 // indirect
+ github.com/go-jose/go-jose/v4 v4.1.2 // indirect
github.com/go-logr/logr v1.4.3 // indirect
github.com/go-logr/stdr v1.2.2 // indirect
github.com/go-openapi/jsonpointer v0.22.1 // indirect
@@ -118,7 +118,7 @@ require (
github.com/inconshreveable/mousetrap v1.1.0 // indirect
github.com/jmespath/go-jmespath v0.4.1-0.20220621161143-b0104c826a24 // indirect
github.com/json-iterator/go v1.1.12 // indirect
- github.com/klauspost/cpuid/v2 v2.0.9 // indirect
+ github.com/klauspost/cpuid/v2 v2.2.5 // indirect
github.com/kylelemons/godebug v1.1.0 // indirect
github.com/liggitt/tabwriter v0.0.0-20181228230101-89fcab3d43de // indirect
github.com/mitchellh/go-homedir v1.1.0 // indirect
@@ -145,7 +145,7 @@ require (
github.com/rancher/wrangler/v3 v3.2.0-rc.3 // indirect
github.com/russross/blackfriday/v2 v2.1.0 // indirect
github.com/ryanuber/go-glob v1.0.0 // indirect
- github.com/sergi/go-diff v1.2.0 // indirect
+ github.com/sergi/go-diff v1.3.1 // indirect
github.com/sirupsen/logrus v1.9.3 // indirect
github.com/x448/float16 v0.8.4 // indirect
github.com/xlab/treeprint v1.2.0 // indirect
@@ -154,18 +154,18 @@ require (
github.com/zeebo/xxh3 v1.0.2 // indirect
go.opencensus.io v0.24.0 // indirect
go.opentelemetry.io/auto/sdk v1.1.0 // indirect
- go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0 // indirect
+ go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0 // indirect
go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0 // indirect
- go.opentelemetry.io/otel v1.36.0 // indirect
- go.opentelemetry.io/otel/metric v1.36.0 // indirect
- go.opentelemetry.io/otel/trace v1.36.0 // indirect
+ go.opentelemetry.io/otel v1.37.0 // indirect
+ go.opentelemetry.io/otel/metric v1.37.0 // indirect
+ go.opentelemetry.io/otel/trace v1.37.0 // indirect
golang.org/x/crypto v0.46.0 // indirect
golang.org/x/net v0.47.0 // indirect
golang.org/x/oauth2 v0.33.0 // indirect
golang.org/x/sync v0.19.0 // indirect
golang.org/x/sys v0.39.0 // indirect
golang.org/x/term v0.38.0 // indirect
- golang.org/x/time v0.13.0 // indirect
+ golang.org/x/time v0.14.0 // indirect
gomodules.xyz/clock v0.0.0-20200817085942-06523dba733f // indirect
gomodules.xyz/flags v0.1.3 // indirect
gomodules.xyz/jsonpatch/v2 v2.5.0 // indirect
@@ -173,9 +173,9 @@ require (
gomodules.xyz/sets v0.2.1 // indirect
gomodules.xyz/wait v0.2.0 // indirect
google.golang.org/genproto v0.0.0-20240730163845-b1a4ccb954bf // indirect
- google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb // indirect
- google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb // indirect
- google.golang.org/grpc v1.72.1 // indirect
+ google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c // indirect
+ google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda // indirect
+ google.golang.org/grpc v1.76.0 // indirect
gopkg.in/evanphx/json-patch.v4 v4.13.0 // indirect
gopkg.in/inf.v0 v0.9.1 // indirect
gopkg.in/yaml.v2 v2.4.0 // indirect
diff --git a/go.sum b/go.sum
index 22964f8cb..49e21f884 100644
--- a/go.sum
+++ b/go.sum
@@ -47,8 +47,8 @@ github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03
github.com/BurntSushi/xgb v0.0.0-20160522181843-27f122750802/go.mod h1:IVnqGOEym/WlBOVXweHU+Q+/VP0lqqI8lqeDx9IjBqo=
github.com/MakeNowJust/heredoc v1.0.0 h1:cXCdzVdstXyiTqTvfqk9SDHpKNjxuom+DOlyEeQ4pzQ=
github.com/MakeNowJust/heredoc v1.0.0/go.mod h1:mG5amYoWBHf8vpLOuehzbGGw0EHxpZZ6lCpQ4fNJ8LE=
-github.com/Masterminds/semver/v3 v3.3.1 h1:QtNSWtVZ3nBfk8mAOu/B6v7FMJ+NHTIgUPi7rj+4nv4=
-github.com/Masterminds/semver/v3 v3.3.1/go.mod h1:4V+yj/TJE1HU9XfppCwVMZq3I84lprf4nC11bSS5beM=
+github.com/Masterminds/semver/v3 v3.4.0 h1:Zog+i5UMtVoCU8oKka5P7i9q9HgrJeGzI9SA1Xbatp0=
+github.com/Masterminds/semver/v3 v3.4.0/go.mod h1:4V+yj/TJE1HU9XfppCwVMZq3I84lprf4nC11bSS5beM=
github.com/OneOfOne/xxhash v1.2.2/go.mod h1:HSdplMjZKSmBqAxg5vPj2TmRDmfkzw+cTzAElWljhcU=
github.com/alecthomas/template v0.0.0-20160405071501-a0175ee3bccc/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc=
github.com/alecthomas/units v0.0.0-20151022065526-2efee857e7cf/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0=
@@ -77,6 +77,8 @@ github.com/chai2010/gettext-go v1.0.2 h1:1Lwwip6Q2QGsAdl/ZKPCwTe9fe0CjlUbqj5bFNS
github.com/chai2010/gettext-go v1.0.2/go.mod h1:y+wnP2cHYaVj19NZhYKAwEMH2CI1gNHeQQ+5AjwawxA=
github.com/client9/misspell v0.3.4/go.mod h1:qj6jICC3Q7zFZvVWo7KLAzC3yx5G7kyvSDkc90ppPyw=
github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc=
+github.com/cncf/xds/go v0.0.0-20250501225837-2ac532fd4443 h1:aQ3y1lwWyqYPiWZThqv1aFbZMiM9vblcSArJRf2Irls=
+github.com/cncf/xds/go v0.0.0-20250501225837-2ac532fd4443/go.mod h1:W+zGtBO5Y1IgJhy4+A9GOqVhqLpfZi+vwmdNXUehLA8=
github.com/coreos/bbolt v1.3.2/go.mod h1:iRUV2dpdMOn7Bo10OQBFzIJO9kkE559Wcmn+qkEiiKk=
github.com/coreos/etcd v3.3.13+incompatible/go.mod h1:uF7uidLiAD3TWHmW31ZFd/JWoc32PjwdhPthX9715RE=
github.com/coreos/go-semver v0.3.0/go.mod h1:nnelYz7RCh+5ahJtPPxZlU+153eP4D4r3EedlOD2RNk=
@@ -100,7 +102,12 @@ github.com/emicklei/go-restful/v3 v3.13.0/go.mod h1:6n3XBCmQQb25CM2LCACGz8ukIrRr
github.com/envoyproxy/go-control-plane v0.9.0/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4=
github.com/envoyproxy/go-control-plane v0.9.1-0.20191026205805-5f8ba28d4473/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4=
github.com/envoyproxy/go-control-plane v0.9.4/go.mod h1:6rpuAdCZL397s3pYoYcLgu1mIlRU8Am5FuJP05cCM98=
+github.com/envoyproxy/go-control-plane v0.13.4 h1:zEqyPVyku6IvWCFwux4x9RxkLOMUL+1vC9xUFv5l2/M=
+github.com/envoyproxy/go-control-plane/envoy v1.32.4 h1:jb83lalDRZSpPWW2Z7Mck/8kXZ5CQAFYVjQcdVIr83A=
+github.com/envoyproxy/go-control-plane/envoy v1.32.4/go.mod h1:Gzjc5k8JcJswLjAx1Zm+wSYE20UrLtt7JZMWiWQXQEw=
github.com/envoyproxy/protoc-gen-validate v0.1.0/go.mod h1:iSmxcyjqTsJpI2R4NaDN7+kN2VEUnK/pcBlmesArF7c=
+github.com/envoyproxy/protoc-gen-validate v1.2.1 h1:DEo3O99U8j4hBFwbJfrz9VtgcDfUKS7KJ7spH3d86P8=
+github.com/envoyproxy/protoc-gen-validate v1.2.1/go.mod h1:d/C80l/jxXLdfEIhX1W2TmLfsJ31lvEjwamM4DxlWXU=
github.com/evanphx/json-patch v5.9.11+incompatible h1:ixHHqfcGvxhWkniF1tWxBHA0yb4Z+d1UQi45df52xW8=
github.com/evanphx/json-patch v5.9.11+incompatible/go.mod h1:50XU6AFN0ol/bzJsmQLiYLvXMP4fmwYFNcr97nuDLSk=
github.com/evanphx/json-patch/v5 v5.9.11 h1:/8HVnzMq13/3x9TPvjG08wUGqBTmZBsCWzjTM0wiaDU=
@@ -124,8 +131,8 @@ github.com/ghodss/yaml v1.0.0/go.mod h1:4dBDuWmgqj2HViK6kFavaiC9ZROes6MMH2rRYeME
github.com/go-errors/errors v1.4.2 h1:J6MZopCL4uSllY1OfXM374weqZFFItUbrImctkmUxIA=
github.com/go-errors/errors v1.4.2/go.mod h1:sIVyrIiJhuEF+Pj9Ebtd6P/rEYROXFi3BopGUQ5a5Og=
github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU=
-github.com/go-jose/go-jose/v4 v4.0.5 h1:M6T8+mKZl/+fNNuFHvGIzDz7BTLQPIounk/b9dw3AaE=
-github.com/go-jose/go-jose/v4 v4.0.5/go.mod h1:s3P1lRrkT8igV8D9OjyL4WRyHvjB6a4JSllnOrmmBOA=
+github.com/go-jose/go-jose/v4 v4.1.2 h1:TK/7NqRQZfgAh+Td8AlsrvtPoUyiHh0LqVvokh+1vHI=
+github.com/go-jose/go-jose/v4 v4.1.2/go.mod h1:22cg9HWM1pOlnRiY+9cQYJ9XHmya1bYW8OeDM6Ku6Oo=
github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as=
github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE=
github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk=
@@ -315,8 +322,8 @@ github.com/kisielk/errcheck v1.5.0/go.mod h1:pFxgyoBC7bSaBwPgfKdkLd5X25qrDl4LWUI
github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck=
github.com/klauspost/compress v1.18.1 h1:bcSGx7UbpBqMChDtsF28Lw6v/G94LPrrbMbdC3JH2co=
github.com/klauspost/compress v1.18.1/go.mod h1:ZQFFVG+MdnR0P+l6wpXgIL4NTtwiKIdBnrBd8Nrxr+0=
-github.com/klauspost/cpuid/v2 v2.0.9 h1:lgaqFMSdTdQYdZ04uHyN2d/eKdOMyi2YLSvlQIBFYa4=
-github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
+github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg=
+github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/kmodules/apiserver v0.34.4-0.20251227112449-07fa35efc6fc h1:R5bKc1c8Qu7z+7+O0xNWxIPjCYuaHUVZ+dSfeCZEd+c=
github.com/kmodules/apiserver v0.34.4-0.20251227112449-07fa35efc6fc/go.mod h1:QPnnahMO5C2m3lm6fPW3+JmyQbvHZQ8uudAu/493P2w=
github.com/kmodules/controller-runtime v0.22.5-0.20251227114913-f011264689cd h1:cpLV7Pr+pSo3kDYY4HsLZfbdF1WPQuPTP+Jo3hyoWzw=
@@ -395,6 +402,8 @@ github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINE
github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
+github.com/planetscale/vtprotobuf v0.6.1-0.20240319094008-0393e58bdf10 h1:GFCKgmp0tecUJ0sJuv4pzYCqS9+RGSn52M3FUwPs+uo=
+github.com/planetscale/vtprotobuf v0.6.1-0.20240319094008-0393e58bdf10/go.mod h1:t/avpk3KcrXxUnYOhZhMXJlSEyie6gQbtLq5NM3loB8=
github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U=
github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4=
@@ -436,8 +445,8 @@ github.com/ryanuber/columnize v0.0.0-20160712163229-9b3edd62028f/go.mod h1:sm1tb
github.com/ryanuber/go-glob v1.0.0 h1:iQh3xXAumdQ+4Ufa5b25cRpC5TYKlno6hsv6Cb3pkBk=
github.com/ryanuber/go-glob v1.0.0/go.mod h1:807d1WSdnB0XRJzKNil9Om6lcp/3a0v4qIHxIXzX/Yc=
github.com/sean-/seed v0.0.0-20170313163322-e2103e2c3529/go.mod h1:DxrIzT+xaE7yg65j358z/aeFdxmN0P9QXhEzd20vsDc=
-github.com/sergi/go-diff v1.2.0 h1:XU+rvMAioB0UC3q1MFrIQy4Vo5/4VsRDQQXHsEya6xQ=
-github.com/sergi/go-diff v1.2.0/go.mod h1:STckp+ISIX8hZLjrqAeVduY0gWCT9IjLuqbuNXdaHfM=
+github.com/sergi/go-diff v1.3.1 h1:xkr+Oxo4BOQKmkn/B9eMK0g5Kg/983T9DqqPHwYqD+8=
+github.com/sergi/go-diff v1.3.1/go.mod h1:aMJSSKb2lpPvRNec0+w3fl7LP9IOFzdc9Pa4NFbPK1I=
github.com/shurcooL/sanitized_anchor_name v1.0.0/go.mod h1:1NzhyTcUVG4SuEtjjoZeVRXNmyL/1OwPU0+IJeTBvfc=
github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo=
github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ=
@@ -455,8 +464,9 @@ github.com/spf13/cobra v1.10.1/go.mod h1:7SmJGaTHFVBY0jW4NXGluQoLvhqFQM+6XSKD+P4
github.com/spf13/jwalterweatherman v1.0.0/go.mod h1:cQK4TGJAtQXfYWX+Ddv3mKDzgVb68N+wFjFa4jdeBTo=
github.com/spf13/pflag v1.0.3/go.mod h1:DYY7MBk1bdzusC3SYhjObp+wFpr4gzcvqqNjLnInEg4=
github.com/spf13/pflag v1.0.5/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg=
-github.com/spf13/pflag v1.0.9 h1:9exaQaMOCwffKiiiYk6/BndUBv+iRViNW+4lEMi0PvY=
github.com/spf13/pflag v1.0.9/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg=
+github.com/spf13/pflag v1.0.10 h1:4EBh2KAYBwaONj6b2Ye1GiHfwjqyROoF4RwYO+vPwFk=
+github.com/spf13/pflag v1.0.10/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg=
github.com/spf13/viper v1.7.0/go.mod h1:8WkrPz2fc9jxqZNCJI/76HCieCp4Q8HaLFoCha5qpdg=
github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
@@ -499,20 +509,20 @@ go.opencensus.io v0.24.0 h1:y73uSU6J157QMP2kn2r30vwW1A2W2WFwSCGnAVxeaD0=
go.opencensus.io v0.24.0/go.mod h1:vNK8G9p7aAivkbmorf4v+7Hgx+Zs0yY+0fOtgBfjQKo=
go.opentelemetry.io/auto/sdk v1.1.0 h1:cH53jehLUN6UFLY71z+NDOiNJqDdPRaXzTel0sJySYA=
go.opentelemetry.io/auto/sdk v1.1.0/go.mod h1:3wSPjt5PWp2RhlCcmmOial7AvC4DQqZb7a7wCow3W8A=
-go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0 h1:x7wzEgXfnzJcHDwStJT+mxOz4etr2EcexjqhBvmoakw=
-go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0/go.mod h1:rg+RlpR5dKwaS95IyyZqj5Wd4E13lk/msnTS0Xl9lJM=
+go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0 h1:q4XOmH/0opmeuJtPsbFNivyl7bCt7yRBbeEm2sC/XtQ=
+go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0/go.mod h1:snMWehoOh2wsEwnvvwtDyFCxVeDAODenXHtn5vzrKjo=
go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0 h1:F7Jx+6hwnZ41NSFTO5q4LYDtJRXBf2PD0rNBkeB/lus=
go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0/go.mod h1:UHB22Z8QsdRDrnAtX4PntOl36ajSxcdUMt1sF7Y6E7Q=
-go.opentelemetry.io/otel v1.36.0 h1:UumtzIklRBY6cI/lllNZlALOF5nNIzJVb16APdvgTXg=
-go.opentelemetry.io/otel v1.36.0/go.mod h1:/TcFMXYjyRNh8khOAO9ybYkqaDBb/70aVwkNML4pP8E=
-go.opentelemetry.io/otel/metric v1.36.0 h1:MoWPKVhQvJ+eeXWHFBOPoBOi20jh6Iq2CcCREuTYufE=
-go.opentelemetry.io/otel/metric v1.36.0/go.mod h1:zC7Ks+yeyJt4xig9DEw9kuUFe5C3zLbVjV2PzT6qzbs=
-go.opentelemetry.io/otel/sdk v1.36.0 h1:b6SYIuLRs88ztox4EyrvRti80uXIFy+Sqzoh9kFULbs=
-go.opentelemetry.io/otel/sdk v1.36.0/go.mod h1:+lC+mTgD+MUWfjJubi2vvXWcVxyr9rmlshZni72pXeY=
-go.opentelemetry.io/otel/sdk/metric v1.36.0 h1:r0ntwwGosWGaa0CrSt8cuNuTcccMXERFwHX4dThiPis=
-go.opentelemetry.io/otel/sdk/metric v1.36.0/go.mod h1:qTNOhFDfKRwX0yXOqJYegL5WRaW376QbB7P4Pb0qva4=
-go.opentelemetry.io/otel/trace v1.36.0 h1:ahxWNuqZjpdiFAyrIoQ4GIiAIhxAunQR6MUoKrsNd4w=
-go.opentelemetry.io/otel/trace v1.36.0/go.mod h1:gQ+OnDZzrybY4k4seLzPAWNwVBBVlF2szhehOBB/tGA=
+go.opentelemetry.io/otel v1.37.0 h1:9zhNfelUvx0KBfu/gb+ZgeAfAgtWrfHJZcAqFC228wQ=
+go.opentelemetry.io/otel v1.37.0/go.mod h1:ehE/umFRLnuLa/vSccNq9oS1ErUlkkK71gMcN34UG8I=
+go.opentelemetry.io/otel/metric v1.37.0 h1:mvwbQS5m0tbmqML4NqK+e3aDiO02vsf/WgbsdpcPoZE=
+go.opentelemetry.io/otel/metric v1.37.0/go.mod h1:04wGrZurHYKOc+RKeye86GwKiTb9FKm1WHtO+4EVr2E=
+go.opentelemetry.io/otel/sdk v1.37.0 h1:ItB0QUqnjesGRvNcmAcU0LyvkVyGJ2xftD29bWdDvKI=
+go.opentelemetry.io/otel/sdk v1.37.0/go.mod h1:VredYzxUvuo2q3WRcDnKDjbdvmO0sCzOvVAiY+yUkAg=
+go.opentelemetry.io/otel/sdk/metric v1.37.0 h1:90lI228XrB9jCMuSdA0673aubgRobVZFhbjxHHspCPc=
+go.opentelemetry.io/otel/sdk/metric v1.37.0/go.mod h1:cNen4ZWfiD37l5NhS+Keb5RXVWZWpRE+9WyVCpbo5ps=
+go.opentelemetry.io/otel/trace v1.37.0 h1:HLdcFNbRQBE2imdSEgm/kwqmQj1Or1l/7bW6mxVK7z4=
+go.opentelemetry.io/otel/trace v1.37.0/go.mod h1:TlgrlQ+PtQO5XFerSPUYG0JSgGyryXewPGyayAWSBS0=
go.uber.org/atomic v1.4.0/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE=
go.uber.org/goleak v1.3.0 h1:2K3zAYmnTNqV73imy9J1T3WC+gmCePx2hEGkimedGto=
go.uber.org/goleak v1.3.0/go.mod h1:CoHD4mav9JJNrW/WLlf7HGZPjdw8EucARQHekz1X6bE=
@@ -605,6 +615,7 @@ golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7w
golang.org/x/sys v0.0.0-20210616094352-59db8d763f22/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.39.0 h1:CvCKL8MeisomCi6qNZ+wbb0DN9E5AATixKsvNtMoMFk=
golang.org/x/sys v0.39.0/go.mod h1:OgkHotnGiDImocRcuBABYBEXf8A9a87e/uXjp9XT3ks=
golang.org/x/term v0.38.0 h1:PQ5pkm/rLO6HnxFR7N2lJHOZX6Kez5Y1gDSJla6jo7Q=
@@ -617,8 +628,8 @@ golang.org/x/text v0.32.0 h1:ZD01bjUt1FQ9WJ0ClOL5vxgxOI/sVCNgX1YtKwcY0mU=
golang.org/x/text v0.32.0/go.mod h1:o/rUWzghvpD5TXrTIBuJU77MTaN0ljMWE47kxGJQ7jY=
golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
-golang.org/x/time v0.13.0 h1:eUlYslOIt32DgYD6utsuUeHs4d7AsEYLuIAdg7FlYgI=
-golang.org/x/time v0.13.0/go.mod h1:eL/Oa2bBBK0TkX57Fyni+NgnyQQN4LitPmob2Hjnqw4=
+golang.org/x/time v0.14.0 h1:MRx4UaLrDotUKUdCIqzPC48t1Y9hANFKIRpNx+Te8PI=
+golang.org/x/time v0.14.0/go.mod h1:eL/Oa2bBBK0TkX57Fyni+NgnyQQN4LitPmob2Hjnqw4=
golang.org/x/tools v0.0.0-20180221164845-07fd8470d635/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
golang.org/x/tools v0.0.0-20190114222345-bf090417da8b/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
@@ -675,6 +686,8 @@ gomodules.xyz/wait v0.2.0 h1:HnRIh+cvIrrKIFaXoYznCVVirv2/2xu3KzjSzsQmYAY=
gomodules.xyz/wait v0.2.0/go.mod h1:g/epKzZQuCqgvhzhaoG4cSBNGHqnOrhFR4Q7szDJ1JM=
gomodules.xyz/x v0.0.17 h1:Ik3wf0suCMiYPY0miFUh+q8BpjsUHc/7zvANbFViBQA=
gomodules.xyz/x v0.0.17/go.mod h1:7R5182LvgWj1ZGlnpbhfSLsxM3lFN7LBettztpX+A2I=
+gonum.org/v1/gonum v0.16.0 h1:5+ul4Swaf3ESvrOnidPp4GZbzf0mxVQpDCYUQE7OJfk=
+gonum.org/v1/gonum v0.16.0/go.mod h1:fef3am4MQ93R2HHpKnLk4/Tbh/s0+wqD5nfa6Pnwy4E=
google.golang.org/api v0.4.0/go.mod h1:8k5glujaEP+g9n7WNsDg8QP6cUVNI86fCNMcbazEtwE=
google.golang.org/api v0.7.0/go.mod h1:WtwebWUNSVBH/HAw79HIFXZNqEvBhG+Ra+ax0hx3E3M=
google.golang.org/api v0.8.0/go.mod h1:o4eAsZoiT+ibD93RtjEohWalFOjRDx6CVaqeizhEnKg=
@@ -698,10 +711,10 @@ google.golang.org/genproto v0.0.0-20191108220845-16a3f7862a1a/go.mod h1:n3cpQtvx
google.golang.org/genproto v0.0.0-20200526211855-cb27e3aa2013/go.mod h1:NbSheEEYHJ7i3ixzK3sjbqSGDJWnxyFXZblF3eUsNvo=
google.golang.org/genproto v0.0.0-20240730163845-b1a4ccb954bf h1:OqdXDEakZCVtDiZTjcxfwbHPCT11ycCEsTKesBVKvyY=
google.golang.org/genproto v0.0.0-20240730163845-b1a4ccb954bf/go.mod h1:mCr1K1c8kX+1iSBREvU3Juo11CB+QOEWxbRS01wWl5M=
-google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb h1:p31xT4yrYrSM/G4Sn2+TNUkVhFCbG9y8itM2S6Th950=
-google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:jbe3Bkdp+Dh2IrslsFCklNhweNTBgSYanP1UXhJDhKg=
-google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb h1:TLPQVbx1GJ8VKZxz52VAxl1EBgKXXbTiU9Fc5fZeLn4=
-google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:LuRYeWDFV6WOn90g357N17oMCaxpgCnbi/44qJvDn2I=
+google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c h1:AtEkQdl5b6zsybXcbz00j1LwNodDuH6hVifIaNqk7NQ=
+google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c/go.mod h1:ea2MjsO70ssTfCjiwHgI0ZFqcw45Ksuk2ckf9G468GA=
+google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda h1:i/Q+bfisr7gq6feoJnS/DlpdwEL4ihp41fvRiM3Ork0=
+google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda/go.mod h1:7i2o+ce6H/6BluujYR+kqX3GKH+dChPTQU19wjRPiGk=
google.golang.org/grpc v1.19.0/go.mod h1:mqu4LbDTu4XGKhr4mRzUsmM4RtVoemTSY81AxZiDr8c=
google.golang.org/grpc v1.20.1/go.mod h1:10oTOabMzJvdu6/UiuZezV6QK5dSlG84ov/aaiqXj38=
google.golang.org/grpc v1.21.1/go.mod h1:oYelfM1adQP15Ek0mdvEgi9Df8B9CZIaU1084ijfRaM=
@@ -709,8 +722,8 @@ google.golang.org/grpc v1.23.0/go.mod h1:Y5yQAOtifL1yxbo5wqy6BxZv8vAUGQwXBOALyac
google.golang.org/grpc v1.25.1/go.mod h1:c3i+UQWmh7LiEpx4sFZnkU36qjEYZ0imhYfXVyQciAY=
google.golang.org/grpc v1.27.0/go.mod h1:qbnxyOmOxrQa7FizSgH+ReBfzJrCY1pSN7KXBS8abTk=
google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv2fbc=
-google.golang.org/grpc v1.72.1 h1:HR03wO6eyZ7lknl75XlxABNVLLFc2PAb6mHlYh756mA=
-google.golang.org/grpc v1.72.1/go.mod h1:wH5Aktxcg25y1I3w7H69nHfXdOG3UiadoBtjh3izSDM=
+google.golang.org/grpc v1.76.0 h1:UnVkv1+uMLYXoIz6o7chp59WfQUYA2ex/BXQ9rHZu7A=
+google.golang.org/grpc v1.76.0/go.mod h1:Ju12QI8M6iQJtbcsV+awF5a4hfJMLi4X0JLo94ULZ6c=
google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8=
google.golang.org/protobuf v0.0.0-20200221191635-4d8936d0db64/go.mod h1:kwYJMbMJ01Woi6D6+Kah6886xMZcty6N08ah7+eCXa0=
google.golang.org/protobuf v0.0.0-20200228230310-ab0ca4ff8a60/go.mod h1:cfTl7dwQJ+fmap5saPgwCLgHXTUD7jkjRqWcaiX5VyM=
@@ -784,8 +797,8 @@ kmodules.xyz/monitoring-agent-api v0.34.0 h1:SNgKvC1j8oYWQcdClyV2T5GsOQoG40c3pK9
kmodules.xyz/monitoring-agent-api v0.34.0/go.mod h1:XFDfMHDZQeNEPdTDeDr4M0dT4UCWs+4IYzgHw7JDlms=
kmodules.xyz/offshoot-api v0.34.0 h1:HnOOp8FrCjTWjtNApRDo6Ahe79tOlLrJmyye4xxO4Kk=
kmodules.xyz/offshoot-api v0.34.0/go.mod h1:F+B59yYw4CZJ4uD4xu6C+mMLzIXUtuH7E+SbDICl9jE=
-kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b h1:47Zn1Ir7+NkjiQgfTGuuChRdPQvAb/IAmJXkB8+89a0=
-kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b/go.mod h1:1v8EABmDsiQW5ru3QVR8itrTbWyyDkd0oLoStryCrc4=
+kubevault.dev/apimachinery v0.24.0-rc.0 h1:BNGX/kO6rK1kG+U+E0VPmTbguym7fzrcUOeCs5brL4M=
+kubevault.dev/apimachinery v0.24.0-rc.0/go.mod h1:vyd2IxokWQV0FdE9t9C3T8EJplt4tVJtCXBDYZ0K8u8=
rsc.io/binaryregexp v0.2.0/go.mod h1:qTv7/COck+e2FymRvadv62gMdZztPaShugOCi3I+8D8=
sigs.k8s.io/json v0.0.0-20250730193827-2d320260d730 h1:IpInykpT6ceI+QxKBbEflcR5EXP7sU1kvOlxwZh5txg=
sigs.k8s.io/json v0.0.0-20250730193827-2d320260d730/go.mod h1:mdzfpAEoE6DHQEN0uh9ZbOCuHbLK5wOm7dK4ctXE9Tg=
diff --git a/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md b/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md
index f95a504fe..fabe5e43d 100644
--- a/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md
+++ b/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md
@@ -1,5 +1,31 @@
# Changelog
+## 3.4.0 (2025-06-27)
+
+### Added
+
+- #268: Added property to Constraints to include prereleases for Check and Validate
+
+### Changed
+
+- #263: Updated Go testing for 1.24, 1.23, and 1.22
+- #269: Updated the error message handling for message case and wrapping errors
+- #266: Restore the ability to have leading 0's when parsing with NewVersion.
+ Opt-out of this by setting CoerceNewVersion to false.
+
+### Fixed
+
+- #257: Fixed the CodeQL link (thanks @dmitris)
+- #262: Restored detailed errors when failed to parse with NewVersion. Opt-out
+ of this by setting DetailedNewVersionErrors to false for faster performance.
+- #267: Handle pre-releases for an "and" group if one constraint includes them
+
+## 3.3.1 (2024-11-19)
+
+### Fixed
+
+- #253: Fix for allowing some version that were invalid
+
## 3.3.0 (2024-08-27)
### Added
@@ -137,7 +163,7 @@ functions. These are described in the added and changed sections below.
- #78: Fix unchecked error in example code (thanks @ravron)
- #70: Fix the handling of pre-releases and the 0.0.0 release edge case
- #97: Fixed copyright file for proper display on GitHub
-- #107: Fix handling prerelease when sorting alphanum and num
+- #107: Fix handling prerelease when sorting alphanum and num
- #109: Fixed where Validate sometimes returns wrong message on error
## 1.4.2 (2018-04-10)
diff --git a/vendor/github.com/Masterminds/semver/v3/README.md b/vendor/github.com/Masterminds/semver/v3/README.md
index ed5693608..2f56c676a 100644
--- a/vendor/github.com/Masterminds/semver/v3/README.md
+++ b/vendor/github.com/Masterminds/semver/v3/README.md
@@ -50,6 +50,18 @@ other versions, convert the version back into a string, and get the original
string. Getting the original string is useful if the semantic version was coerced
into a valid form.
+There are package level variables that affect how `NewVersion` handles parsing.
+
+- `CoerceNewVersion` is `true` by default. When set to `true` it coerces non-compliant
+ versions into SemVer. For example, allowing a leading 0 in a major, minor, or patch
+ part. This enables the use of CalVer in versions even when not compliant with SemVer.
+ When set to `false` less coercion work is done.
+- `DetailedNewVersionErrors` provides more detailed errors. It only has an affect when
+ `CoerceNewVersion` is set to `false`. When `DetailedNewVersionErrors` is set to `true`
+ it can provide some more insight into why a version is invalid. Setting
+ `DetailedNewVersionErrors` to `false` is faster on performance but provides less
+ detailed error messages if a version fails to parse.
+
## Sorting Semantic Versions
A set of versions can be sorted using the `sort` package from the standard library.
@@ -160,6 +172,10 @@ means `>=1.2.3-BETA` will return `1.2.3-alpha`. What you might expect from case
sensitivity doesn't apply here. This is due to ASCII sort ordering which is what
the spec specifies.
+The `Constraints` instance returned from `semver.NewConstraint()` has a property
+`IncludePrerelease` that, when set to true, will return prerelease versions when calls
+to `Check()` and `Validate()` are made.
+
### Hyphen Range Comparisons
There are multiple methods to handle ranges and the first is hyphens ranges.
@@ -250,7 +266,7 @@ or [create a pull request](https://github.com/Masterminds/semver/pulls).
Security is an important consideration for this project. The project currently
uses the following tools to help discover security issues:
-* [CodeQL](https://github.com/Masterminds/semver)
+* [CodeQL](https://codeql.github.com)
* [gosec](https://github.com/securego/gosec)
* Daily Fuzz testing
diff --git a/vendor/github.com/Masterminds/semver/v3/constraints.go b/vendor/github.com/Masterminds/semver/v3/constraints.go
index 8461c7ed9..8b7a10f83 100644
--- a/vendor/github.com/Masterminds/semver/v3/constraints.go
+++ b/vendor/github.com/Masterminds/semver/v3/constraints.go
@@ -12,6 +12,13 @@ import (
// checked against.
type Constraints struct {
constraints [][]*constraint
+ containsPre []bool
+
+ // IncludePrerelease specifies if pre-releases should be included in
+ // the results. Note, if a constraint range has a prerelease than
+ // prereleases will be included for that AND group even if this is
+ // set to false.
+ IncludePrerelease bool
}
// NewConstraint returns a Constraints instance that a Version instance can
@@ -22,11 +29,10 @@ func NewConstraint(c string) (*Constraints, error) {
c = rewriteRange(c)
ors := strings.Split(c, "||")
- or := make([][]*constraint, len(ors))
+ lenors := len(ors)
+ or := make([][]*constraint, lenors)
+ hasPre := make([]bool, lenors)
for k, v := range ors {
-
- // TODO: Find a way to validate and fetch all the constraints in a simpler form
-
// Validate the segment
if !validConstraintRegex.MatchString(v) {
return nil, fmt.Errorf("improper constraint: %s", v)
@@ -43,12 +49,22 @@ func NewConstraint(c string) (*Constraints, error) {
return nil, err
}
+ // If one of the constraints has a prerelease record this.
+ // This information is used when checking all in an "and"
+ // group to ensure they all check for prereleases.
+ if pc.con.pre != "" {
+ hasPre[k] = true
+ }
+
result[i] = pc
}
or[k] = result
}
- o := &Constraints{constraints: or}
+ o := &Constraints{
+ constraints: or,
+ containsPre: hasPre,
+ }
return o, nil
}
@@ -57,10 +73,10 @@ func (cs Constraints) Check(v *Version) bool {
// TODO(mattfarina): For v4 of this library consolidate the Check and Validate
// functions as the underlying functions make that possible now.
// loop over the ORs and check the inner ANDs
- for _, o := range cs.constraints {
+ for i, o := range cs.constraints {
joy := true
for _, c := range o {
- if check, _ := c.check(v); !check {
+ if check, _ := c.check(v, (cs.IncludePrerelease || cs.containsPre[i])); !check {
joy = false
break
}
@@ -83,12 +99,12 @@ func (cs Constraints) Validate(v *Version) (bool, []error) {
// Capture the prerelease message only once. When it happens the first time
// this var is marked
var prerelesase bool
- for _, o := range cs.constraints {
+ for i, o := range cs.constraints {
joy := true
for _, c := range o {
// Before running the check handle the case there the version is
// a prerelease and the check is not searching for prereleases.
- if c.con.pre == "" && v.pre != "" {
+ if !(cs.IncludePrerelease || cs.containsPre[i]) && v.pre != "" {
if !prerelesase {
em := fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
e = append(e, em)
@@ -98,7 +114,7 @@ func (cs Constraints) Validate(v *Version) (bool, []error) {
} else {
- if _, err := c.check(v); err != nil {
+ if _, err := c.check(v, (cs.IncludePrerelease || cs.containsPre[i])); err != nil {
e = append(e, err)
joy = false
}
@@ -227,8 +243,8 @@ type constraint struct {
}
// Check if a version meets the constraint
-func (c *constraint) check(v *Version) (bool, error) {
- return constraintOps[c.origfunc](v, c)
+func (c *constraint) check(v *Version, includePre bool) (bool, error) {
+ return constraintOps[c.origfunc](v, c, includePre)
}
// String prints an individual constraint into a string
@@ -236,7 +252,7 @@ func (c *constraint) string() string {
return c.origfunc + c.orig
}
-type cfunc func(v *Version, c *constraint) (bool, error)
+type cfunc func(v *Version, c *constraint, includePre bool) (bool, error)
func parseConstraint(c string) (*constraint, error) {
if len(c) > 0 {
@@ -272,7 +288,7 @@ func parseConstraint(c string) (*constraint, error) {
// The constraintRegex should catch any regex parsing errors. So,
// we should never get here.
- return nil, errors.New("constraint Parser Error")
+ return nil, errors.New("constraint parser error")
}
cs.con = con
@@ -290,7 +306,7 @@ func parseConstraint(c string) (*constraint, error) {
// The constraintRegex should catch any regex parsing errors. So,
// we should never get here.
- return nil, errors.New("constraint Parser Error")
+ return nil, errors.New("constraint parser error")
}
cs := &constraint{
@@ -305,16 +321,14 @@ func parseConstraint(c string) (*constraint, error) {
}
// Constraint functions
-func constraintNotEqual(v *Version, c *constraint) (bool, error) {
- if c.dirty {
-
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
- return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
- }
+func constraintNotEqual(v *Version, c *constraint, includePre bool) (bool, error) {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
+ return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
+ }
+ if c.dirty {
if c.con.Major() != v.Major() {
return true, nil
}
@@ -345,12 +359,11 @@ func constraintNotEqual(v *Version, c *constraint) (bool, error) {
return true, nil
}
-func constraintGreaterThan(v *Version, c *constraint) (bool, error) {
+func constraintGreaterThan(v *Version, c *constraint, includePre bool) (bool, error) {
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
}
@@ -391,11 +404,10 @@ func constraintGreaterThan(v *Version, c *constraint) (bool, error) {
return false, fmt.Errorf("%s is less than or equal to %s", v, c.orig)
}
-func constraintLessThan(v *Version, c *constraint) (bool, error) {
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
+func constraintLessThan(v *Version, c *constraint, includePre bool) (bool, error) {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
}
@@ -406,12 +418,11 @@ func constraintLessThan(v *Version, c *constraint) (bool, error) {
return false, fmt.Errorf("%s is greater than or equal to %s", v, c.orig)
}
-func constraintGreaterThanEqual(v *Version, c *constraint) (bool, error) {
+func constraintGreaterThanEqual(v *Version, c *constraint, includePre bool) (bool, error) {
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
}
@@ -422,11 +433,10 @@ func constraintGreaterThanEqual(v *Version, c *constraint) (bool, error) {
return false, fmt.Errorf("%s is less than %s", v, c.orig)
}
-func constraintLessThanEqual(v *Version, c *constraint) (bool, error) {
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
+func constraintLessThanEqual(v *Version, c *constraint, includePre bool) (bool, error) {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
}
@@ -455,11 +465,10 @@ func constraintLessThanEqual(v *Version, c *constraint) (bool, error) {
// ~1.2, ~1.2.x, ~>1.2, ~>1.2.x --> >=1.2.0, <1.3.0
// ~1.2.3, ~>1.2.3 --> >=1.2.3, <1.3.0
// ~1.2.0, ~>1.2.0 --> >=1.2.0, <1.3.0
-func constraintTilde(v *Version, c *constraint) (bool, error) {
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
+func constraintTilde(v *Version, c *constraint, includePre bool) (bool, error) {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
}
@@ -487,16 +496,15 @@ func constraintTilde(v *Version, c *constraint) (bool, error) {
// When there is a .x (dirty) status it automatically opts in to ~. Otherwise
// it's a straight =
-func constraintTildeOrEqual(v *Version, c *constraint) (bool, error) {
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
+func constraintTildeOrEqual(v *Version, c *constraint, includePre bool) (bool, error) {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
}
if c.dirty {
- return constraintTilde(v, c)
+ return constraintTilde(v, c, includePre)
}
eq := v.Equal(c.con)
@@ -516,11 +524,10 @@ func constraintTildeOrEqual(v *Version, c *constraint) (bool, error) {
// ^0.0.3 --> >=0.0.3 <0.0.4
// ^0.0 --> >=0.0.0 <0.1.0
// ^0 --> >=0.0.0 <1.0.0
-func constraintCaret(v *Version, c *constraint) (bool, error) {
- // If there is a pre-release on the version but the constraint isn't looking
- // for them assume that pre-releases are not compatible. See issue 21 for
- // more details.
- if v.Prerelease() != "" && c.con.Prerelease() == "" {
+func constraintCaret(v *Version, c *constraint, includePre bool) (bool, error) {
+ // The existence of prereleases is checked at the group level and passed in.
+ // Exit early if the version has a prerelease but those are to be ignored.
+ if v.Prerelease() != "" && !includePre {
return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v)
}
diff --git a/vendor/github.com/Masterminds/semver/v3/version.go b/vendor/github.com/Masterminds/semver/v3/version.go
index 304edc342..7a3ba7388 100644
--- a/vendor/github.com/Masterminds/semver/v3/version.go
+++ b/vendor/github.com/Masterminds/semver/v3/version.go
@@ -14,28 +14,40 @@ import (
// The compiled version of the regex created at init() is cached here so it
// only needs to be created once.
var versionRegex *regexp.Regexp
+var looseVersionRegex *regexp.Regexp
+
+// CoerceNewVersion sets if leading 0's are allowd in the version part. Leading 0's are
+// not allowed in a valid semantic version. When set to true, NewVersion will coerce
+// leading 0's into a valid version.
+var CoerceNewVersion = true
+
+// DetailedNewVersionErrors specifies if detailed errors are returned from the NewVersion
+// function. This is used when CoerceNewVersion is set to false. If set to false
+// ErrInvalidSemVer is returned for an invalid version. This does not apply to
+// StrictNewVersion. Setting this function to false returns errors more quickly.
+var DetailedNewVersionErrors = true
var (
// ErrInvalidSemVer is returned a version is found to be invalid when
// being parsed.
- ErrInvalidSemVer = errors.New("Invalid Semantic Version")
+ ErrInvalidSemVer = errors.New("invalid semantic version")
// ErrEmptyString is returned when an empty string is passed in for parsing.
- ErrEmptyString = errors.New("Version string empty")
+ ErrEmptyString = errors.New("version string empty")
// ErrInvalidCharacters is returned when invalid characters are found as
// part of a version
- ErrInvalidCharacters = errors.New("Invalid characters in version")
+ ErrInvalidCharacters = errors.New("invalid characters in version")
// ErrSegmentStartsZero is returned when a version segment starts with 0.
// This is invalid in SemVer.
- ErrSegmentStartsZero = errors.New("Version segment starts with 0")
+ ErrSegmentStartsZero = errors.New("version segment starts with 0")
// ErrInvalidMetadata is returned when the metadata is an invalid format
- ErrInvalidMetadata = errors.New("Invalid Metadata string")
+ ErrInvalidMetadata = errors.New("invalid metadata string")
// ErrInvalidPrerelease is returned when the pre-release is an invalid format
- ErrInvalidPrerelease = errors.New("Invalid Prerelease string")
+ ErrInvalidPrerelease = errors.New("invalid prerelease string")
)
// semVerRegex is the regular expression used to parse a semantic version.
@@ -45,6 +57,12 @@ const semVerRegex string = `v?(0|[1-9]\d*)(?:\.(0|[1-9]\d*))?(?:\.(0|[1-9]\d*))?
`(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?` +
`(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?`
+// looseSemVerRegex is a regular expression that lets invalid semver expressions through
+// with enough detail that certain errors can be checked for.
+const looseSemVerRegex string = `v?([0-9]+)(\.[0-9]+)?(\.[0-9]+)?` +
+ `(-([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` +
+ `(\+([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?`
+
// Version represents a single semantic version.
type Version struct {
major, minor, patch uint64
@@ -55,6 +73,7 @@ type Version struct {
func init() {
versionRegex = regexp.MustCompile("^" + semVerRegex + "$")
+ looseVersionRegex = regexp.MustCompile("^" + looseSemVerRegex + "$")
}
const (
@@ -142,8 +161,27 @@ func StrictNewVersion(v string) (*Version, error) {
// attempts to convert it to SemVer. If you want to validate it was a strict
// semantic version at parse time see StrictNewVersion().
func NewVersion(v string) (*Version, error) {
+ if CoerceNewVersion {
+ return coerceNewVersion(v)
+ }
m := versionRegex.FindStringSubmatch(v)
if m == nil {
+
+ // Disabling detailed errors is first so that it is in the fast path.
+ if !DetailedNewVersionErrors {
+ return nil, ErrInvalidSemVer
+ }
+
+ // Check for specific errors with the semver string and return a more detailed
+ // error.
+ m = looseVersionRegex.FindStringSubmatch(v)
+ if m == nil {
+ return nil, ErrInvalidSemVer
+ }
+ err := validateVersion(m)
+ if err != nil {
+ return nil, err
+ }
return nil, ErrInvalidSemVer
}
@@ -156,13 +194,13 @@ func NewVersion(v string) (*Version, error) {
var err error
sv.major, err = strconv.ParseUint(m[1], 10, 64)
if err != nil {
- return nil, fmt.Errorf("Error parsing version segment: %s", err)
+ return nil, fmt.Errorf("error parsing version segment: %w", err)
}
if m[2] != "" {
sv.minor, err = strconv.ParseUint(m[2], 10, 64)
if err != nil {
- return nil, fmt.Errorf("Error parsing version segment: %s", err)
+ return nil, fmt.Errorf("error parsing version segment: %w", err)
}
} else {
sv.minor = 0
@@ -171,7 +209,61 @@ func NewVersion(v string) (*Version, error) {
if m[3] != "" {
sv.patch, err = strconv.ParseUint(m[3], 10, 64)
if err != nil {
- return nil, fmt.Errorf("Error parsing version segment: %s", err)
+ return nil, fmt.Errorf("error parsing version segment: %w", err)
+ }
+ } else {
+ sv.patch = 0
+ }
+
+ // Perform some basic due diligence on the extra parts to ensure they are
+ // valid.
+
+ if sv.pre != "" {
+ if err = validatePrerelease(sv.pre); err != nil {
+ return nil, err
+ }
+ }
+
+ if sv.metadata != "" {
+ if err = validateMetadata(sv.metadata); err != nil {
+ return nil, err
+ }
+ }
+
+ return sv, nil
+}
+
+func coerceNewVersion(v string) (*Version, error) {
+ m := looseVersionRegex.FindStringSubmatch(v)
+ if m == nil {
+ return nil, ErrInvalidSemVer
+ }
+
+ sv := &Version{
+ metadata: m[8],
+ pre: m[5],
+ original: v,
+ }
+
+ var err error
+ sv.major, err = strconv.ParseUint(m[1], 10, 64)
+ if err != nil {
+ return nil, fmt.Errorf("error parsing version segment: %w", err)
+ }
+
+ if m[2] != "" {
+ sv.minor, err = strconv.ParseUint(strings.TrimPrefix(m[2], "."), 10, 64)
+ if err != nil {
+ return nil, fmt.Errorf("error parsing version segment: %w", err)
+ }
+ } else {
+ sv.minor = 0
+ }
+
+ if m[3] != "" {
+ sv.patch, err = strconv.ParseUint(strings.TrimPrefix(m[3], "."), 10, 64)
+ if err != nil {
+ return nil, fmt.Errorf("error parsing version segment: %w", err)
}
} else {
sv.patch = 0
@@ -615,7 +707,7 @@ func validatePrerelease(p string) error {
eparts := strings.Split(p, ".")
for _, p := range eparts {
if p == "" {
- return ErrInvalidMetadata
+ return ErrInvalidPrerelease
} else if containsOnly(p, num) {
if len(p) > 1 && p[0] == '0' {
return ErrSegmentStartsZero
@@ -643,3 +735,54 @@ func validateMetadata(m string) error {
}
return nil
}
+
+// validateVersion checks for common validation issues but may not catch all errors
+func validateVersion(m []string) error {
+ var err error
+ var v string
+ if m[1] != "" {
+ if len(m[1]) > 1 && m[1][0] == '0' {
+ return ErrSegmentStartsZero
+ }
+ _, err = strconv.ParseUint(m[1], 10, 64)
+ if err != nil {
+ return fmt.Errorf("error parsing version segment: %w", err)
+ }
+ }
+
+ if m[2] != "" {
+ v = strings.TrimPrefix(m[2], ".")
+ if len(v) > 1 && v[0] == '0' {
+ return ErrSegmentStartsZero
+ }
+ _, err = strconv.ParseUint(v, 10, 64)
+ if err != nil {
+ return fmt.Errorf("error parsing version segment: %w", err)
+ }
+ }
+
+ if m[3] != "" {
+ v = strings.TrimPrefix(m[3], ".")
+ if len(v) > 1 && v[0] == '0' {
+ return ErrSegmentStartsZero
+ }
+ _, err = strconv.ParseUint(v, 10, 64)
+ if err != nil {
+ return fmt.Errorf("error parsing version segment: %w", err)
+ }
+ }
+
+ if m[5] != "" {
+ if err = validatePrerelease(m[5]); err != nil {
+ return err
+ }
+ }
+
+ if m[8] != "" {
+ if err = validateMetadata(m[8]); err != nil {
+ return err
+ }
+ }
+
+ return nil
+}
diff --git a/vendor/github.com/go-jose/go-jose/v4/CHANGELOG.md b/vendor/github.com/go-jose/go-jose/v4/CHANGELOG.md
deleted file mode 100644
index 6f717dbd8..000000000
--- a/vendor/github.com/go-jose/go-jose/v4/CHANGELOG.md
+++ /dev/null
@@ -1,96 +0,0 @@
-# v4.0.4
-
-## Fixed
-
- - Reverted "Allow unmarshalling JSONWebKeySets with unsupported key types" as a
- breaking change. See #136 / #137.
-
-# v4.0.3
-
-## Changed
-
- - Allow unmarshalling JSONWebKeySets with unsupported key types (#130)
- - Document that OpaqueKeyEncrypter can't be implemented (for now) (#129)
- - Dependency updates
-
-# v4.0.2
-
-## Changed
-
- - Improved documentation of Verify() to note that JSONWebKeySet is a supported
- argument type (#104)
- - Defined exported error values for missing x5c header and unsupported elliptic
- curves error cases (#117)
-
-# v4.0.1
-
-## Fixed
-
- - An attacker could send a JWE containing compressed data that used large
- amounts of memory and CPU when decompressed by `Decrypt` or `DecryptMulti`.
- Those functions now return an error if the decompressed data would exceed
- 250kB or 10x the compressed size (whichever is larger). Thanks to
- Enze Wang@Alioth and Jianjun Chen@Zhongguancun Lab (@zer0yu and @chenjj)
- for reporting.
-
-# v4.0.0
-
-This release makes some breaking changes in order to more thoroughly
-address the vulnerabilities discussed in [Three New Attacks Against JSON Web
-Tokens][1], "Sign/encrypt confusion", "Billion hash attack", and "Polyglot
-token".
-
-## Changed
-
- - Limit JWT encryption types (exclude password or public key types) (#78)
- - Enforce minimum length for HMAC keys (#85)
- - jwt: match any audience in a list, rather than requiring all audiences (#81)
- - jwt: accept only Compact Serialization (#75)
- - jws: Add expected algorithms for signatures (#74)
- - Require specifying expected algorithms for ParseEncrypted,
- ParseSigned, ParseDetached, jwt.ParseEncrypted, jwt.ParseSigned,
- jwt.ParseSignedAndEncrypted (#69, #74)
- - Usually there is a small, known set of appropriate algorithms for a program
- to use and it's a mistake to allow unexpected algorithms. For instance the
- "billion hash attack" relies in part on programs accepting the PBES2
- encryption algorithm and doing the necessary work even if they weren't
- specifically configured to allow PBES2.
- - Revert "Strip padding off base64 strings" (#82)
- - The specs require base64url encoding without padding.
- - Minimum supported Go version is now 1.21
-
-## Added
-
- - ParseSignedCompact, ParseSignedJSON, ParseEncryptedCompact, ParseEncryptedJSON.
- - These allow parsing a specific serialization, as opposed to ParseSigned and
- ParseEncrypted, which try to automatically detect which serialization was
- provided. It's common to require a specific serialization for a specific
- protocol - for instance JWT requires Compact serialization.
-
-[1]: https://i.blackhat.com/BH-US-23/Presentations/US-23-Tervoort-Three-New-Attacks-Against-JSON-Web-Tokens.pdf
-
-# v3.0.2
-
-## Fixed
-
- - DecryptMulti: handle decompression error (#19)
-
-## Changed
-
- - jwe/CompactSerialize: improve performance (#67)
- - Increase the default number of PBKDF2 iterations to 600k (#48)
- - Return the proper algorithm for ECDSA keys (#45)
-
-## Added
-
- - Add Thumbprint support for opaque signers (#38)
-
-# v3.0.1
-
-## Fixed
-
- - Security issue: an attacker specifying a large "p2c" value can cause
- JSONWebEncryption.Decrypt and JSONWebEncryption.DecryptMulti to consume large
- amounts of CPU, causing a DoS. Thanks to Matt Schwager (@mschwager) for the
- disclosure and to Tom Tervoort for originally publishing the category of attack.
- https://i.blackhat.com/BH-US-23/Presentations/US-23-Tervoort-Three-New-Attacks-Against-JSON-Web-Tokens.pdf
diff --git a/vendor/github.com/go-jose/go-jose/v4/README.md b/vendor/github.com/go-jose/go-jose/v4/README.md
index 02b574954..ca5f1d790 100644
--- a/vendor/github.com/go-jose/go-jose/v4/README.md
+++ b/vendor/github.com/go-jose/go-jose/v4/README.md
@@ -3,7 +3,6 @@
[](https://pkg.go.dev/github.com/go-jose/go-jose/v4)
[](https://pkg.go.dev/github.com/go-jose/go-jose/v4/jwt)
[](https://raw.githubusercontent.com/go-jose/go-jose/master/LICENSE)
-[](https://github.com/go-jose/go-jose/actions)
Package jose aims to provide an implementation of the Javascript Object Signing
and Encryption set of standards. This includes support for JSON Web Encryption,
@@ -29,17 +28,20 @@ libraries in other languages.
### Versions
-[Version 4](https://github.com/go-jose/go-jose)
-([branch](https://github.com/go-jose/go-jose/tree/main),
-[doc](https://pkg.go.dev/github.com/go-jose/go-jose/v4), [releases](https://github.com/go-jose/go-jose/releases)) is the current stable version:
+The forthcoming Version 5 will be released with several breaking API changes,
+and will require Golang's `encoding/json/v2`, which is currently requires
+Go 1.25 built with GOEXPERIMENT=jsonv2.
+
+Version 4 is the current stable version:
import "github.com/go-jose/go-jose/v4"
-The old [square/go-jose](https://github.com/square/go-jose) repo contains the prior v1 and v2 versions, which
-are still useable but not actively developed anymore.
+It supports at least the current and previous Golang release. Currently it
+requires Golang 1.23.
+
+Version 3 is only receiving critical security updates. Migration to Version 4 is recommended.
-Version 3, in this repo, is still receiving security fixes but not functionality
-updates.
+Versions 1 and 2 are obsolete, but can be found in the old repository, [square/go-jose](https://github.com/square/go-jose).
### Supported algorithms
@@ -47,36 +49,36 @@ See below for a table of supported algorithms. Algorithm identifiers match
the names in the [JSON Web Algorithms](https://dx.doi.org/10.17487/RFC7518)
standard where possible. The Godoc reference has a list of constants.
- Key encryption | Algorithm identifier(s)
- :------------------------- | :------------------------------
- RSA-PKCS#1v1.5 | RSA1_5
- RSA-OAEP | RSA-OAEP, RSA-OAEP-256
- AES key wrap | A128KW, A192KW, A256KW
- AES-GCM key wrap | A128GCMKW, A192GCMKW, A256GCMKW
- ECDH-ES + AES key wrap | ECDH-ES+A128KW, ECDH-ES+A192KW, ECDH-ES+A256KW
- ECDH-ES (direct) | ECDH-ES1
- Direct encryption | dir1
+| Key encryption | Algorithm identifier(s) |
+|:-----------------------|:-----------------------------------------------|
+| RSA-PKCS#1v1.5 | RSA1_5 |
+| RSA-OAEP | RSA-OAEP, RSA-OAEP-256 |
+| AES key wrap | A128KW, A192KW, A256KW |
+| AES-GCM key wrap | A128GCMKW, A192GCMKW, A256GCMKW |
+| ECDH-ES + AES key wrap | ECDH-ES+A128KW, ECDH-ES+A192KW, ECDH-ES+A256KW |
+| ECDH-ES (direct) | ECDH-ES1 |
+| Direct encryption | dir1 |
1. Not supported in multi-recipient mode
- Signing / MAC | Algorithm identifier(s)
- :------------------------- | :------------------------------
- RSASSA-PKCS#1v1.5 | RS256, RS384, RS512
- RSASSA-PSS | PS256, PS384, PS512
- HMAC | HS256, HS384, HS512
- ECDSA | ES256, ES384, ES512
- Ed25519 | EdDSA2
+| Signing / MAC | Algorithm identifier(s) |
+|:------------------|:------------------------|
+| RSASSA-PKCS#1v1.5 | RS256, RS384, RS512 |
+| RSASSA-PSS | PS256, PS384, PS512 |
+| HMAC | HS256, HS384, HS512 |
+| ECDSA | ES256, ES384, ES512 |
+| Ed25519 | EdDSA2 |
2. Only available in version 2 of the package
- Content encryption | Algorithm identifier(s)
- :------------------------- | :------------------------------
- AES-CBC+HMAC | A128CBC-HS256, A192CBC-HS384, A256CBC-HS512
- AES-GCM | A128GCM, A192GCM, A256GCM
+| Content encryption | Algorithm identifier(s) |
+|:-------------------|:--------------------------------------------|
+| AES-CBC+HMAC | A128CBC-HS256, A192CBC-HS384, A256CBC-HS512 |
+| AES-GCM | A128GCM, A192GCM, A256GCM |
- Compression | Algorithm identifiers(s)
- :------------------------- | -------------------------------
- DEFLATE (RFC 1951) | DEF
+| Compression | Algorithm identifiers(s) |
+|:-------------------|--------------------------|
+| DEFLATE (RFC 1951) | DEF |
### Supported key types
@@ -85,12 +87,12 @@ library, and can be passed to corresponding functions such as `NewEncrypter` or
`NewSigner`. Each of these keys can also be wrapped in a JWK if desired, which
allows attaching a key id.
- Algorithm(s) | Corresponding types
- :------------------------- | -------------------------------
- RSA | *[rsa.PublicKey](https://pkg.go.dev/crypto/rsa/#PublicKey), *[rsa.PrivateKey](https://pkg.go.dev/crypto/rsa/#PrivateKey)
- ECDH, ECDSA | *[ecdsa.PublicKey](https://pkg.go.dev/crypto/ecdsa/#PublicKey), *[ecdsa.PrivateKey](https://pkg.go.dev/crypto/ecdsa/#PrivateKey)
- EdDSA1 | [ed25519.PublicKey](https://pkg.go.dev/crypto/ed25519#PublicKey), [ed25519.PrivateKey](https://pkg.go.dev/crypto/ed25519#PrivateKey)
- AES, HMAC | []byte
+| Algorithm(s) | Corresponding types |
+|:------------------|--------------------------------------------------------------------------------------------------------------------------------------|
+| RSA | *[rsa.PublicKey](https://pkg.go.dev/crypto/rsa/#PublicKey), *[rsa.PrivateKey](https://pkg.go.dev/crypto/rsa/#PrivateKey) |
+| ECDH, ECDSA | *[ecdsa.PublicKey](https://pkg.go.dev/crypto/ecdsa/#PublicKey), *[ecdsa.PrivateKey](https://pkg.go.dev/crypto/ecdsa/#PrivateKey) |
+| EdDSA1 | [ed25519.PublicKey](https://pkg.go.dev/crypto/ed25519#PublicKey), [ed25519.PrivateKey](https://pkg.go.dev/crypto/ed25519#PrivateKey) |
+| AES, HMAC | []byte |
1. Only available in version 2 or later of the package
diff --git a/vendor/github.com/go-jose/go-jose/v4/crypter.go b/vendor/github.com/go-jose/go-jose/v4/crypter.go
index d81b03b44..ab02a28e2 100644
--- a/vendor/github.com/go-jose/go-jose/v4/crypter.go
+++ b/vendor/github.com/go-jose/go-jose/v4/crypter.go
@@ -286,6 +286,10 @@ func makeJWERecipient(alg KeyAlgorithm, encryptionKey interface{}) (recipientKey
return newSymmetricRecipient(alg, encryptionKey)
case string:
return newSymmetricRecipient(alg, []byte(encryptionKey))
+ case JSONWebKey:
+ recipient, err := makeJWERecipient(alg, encryptionKey.Key)
+ recipient.keyID = encryptionKey.KeyID
+ return recipient, err
case *JSONWebKey:
recipient, err := makeJWERecipient(alg, encryptionKey.Key)
recipient.keyID = encryptionKey.KeyID
diff --git a/vendor/github.com/go-jose/go-jose/v4/jwe.go b/vendor/github.com/go-jose/go-jose/v4/jwe.go
index 9f1322dcc..6102f9100 100644
--- a/vendor/github.com/go-jose/go-jose/v4/jwe.go
+++ b/vendor/github.com/go-jose/go-jose/v4/jwe.go
@@ -274,7 +274,7 @@ func validateAlgEnc(headers rawHeader, keyAlgorithms []KeyAlgorithm, contentEncr
if alg != "" && !containsKeyAlgorithm(keyAlgorithms, alg) {
return fmt.Errorf("unexpected key algorithm %q; expected %q", alg, keyAlgorithms)
}
- if alg != "" && !containsContentEncryption(contentEncryption, enc) {
+ if enc != "" && !containsContentEncryption(contentEncryption, enc) {
return fmt.Errorf("unexpected content encryption algorithm %q; expected %q", enc, contentEncryption)
}
return nil
@@ -288,11 +288,20 @@ func ParseEncryptedCompact(
keyAlgorithms []KeyAlgorithm,
contentEncryption []ContentEncryption,
) (*JSONWebEncryption, error) {
- // Five parts is four separators
- if strings.Count(input, ".") != 4 {
- return nil, fmt.Errorf("go-jose/go-jose: compact JWE format must have five parts")
+ var parts [5]string
+ var ok bool
+
+ for i := range 4 {
+ parts[i], input, ok = strings.Cut(input, ".")
+ if !ok {
+ return nil, errors.New("go-jose/go-jose: compact JWE format must have five parts")
+ }
+ }
+ // Validate that the last part does not contain more dots
+ if strings.ContainsRune(input, '.') {
+ return nil, errors.New("go-jose/go-jose: compact JWE format must have five parts")
}
- parts := strings.SplitN(input, ".", 5)
+ parts[4] = input
rawProtected, err := base64.RawURLEncoding.DecodeString(parts[0])
if err != nil {
diff --git a/vendor/github.com/go-jose/go-jose/v4/jwk.go b/vendor/github.com/go-jose/go-jose/v4/jwk.go
index 9e57e93ba..164d6a161 100644
--- a/vendor/github.com/go-jose/go-jose/v4/jwk.go
+++ b/vendor/github.com/go-jose/go-jose/v4/jwk.go
@@ -175,6 +175,8 @@ func (k JSONWebKey) MarshalJSON() ([]byte, error) {
}
// UnmarshalJSON reads a key from its JSON representation.
+//
+// Returns ErrUnsupportedKeyType for unrecognized or unsupported "kty" header values.
func (k *JSONWebKey) UnmarshalJSON(data []byte) (err error) {
var raw rawJSONWebKey
err = json.Unmarshal(data, &raw)
@@ -228,7 +230,7 @@ func (k *JSONWebKey) UnmarshalJSON(data []byte) (err error) {
}
key, err = raw.symmetricKey()
case "OKP":
- if raw.Crv == "Ed25519" && raw.X != nil {
+ if raw.Crv == "Ed25519" {
if raw.D != nil {
key, err = raw.edPrivateKey()
if err == nil {
@@ -238,17 +240,27 @@ func (k *JSONWebKey) UnmarshalJSON(data []byte) (err error) {
key, err = raw.edPublicKey()
keyPub = key
}
- } else {
- return fmt.Errorf("go-jose/go-jose: unknown curve %s'", raw.Crv)
}
- default:
- return fmt.Errorf("go-jose/go-jose: unknown json web key type '%s'", raw.Kty)
+ case "":
+ // kty MUST be present
+ err = fmt.Errorf("go-jose/go-jose: missing json web key type")
}
if err != nil {
return
}
+ if key == nil {
+ // RFC 7517:
+ // 5. JWK Set Format
+ // ...
+ // Implementations SHOULD ignore JWKs within a JWK Set that use "kty"
+ // (key type) values that are not understood by them, that are missing
+ // required members, or for which values are out of the supported
+ // ranges.
+ return ErrUnsupportedKeyType
+ }
+
if certPub != nil && keyPub != nil {
if !reflect.DeepEqual(certPub, keyPub) {
return errors.New("go-jose/go-jose: invalid JWK, public keys in key and x5c fields do not match")
@@ -581,10 +593,10 @@ func fromEcPublicKey(pub *ecdsa.PublicKey) (*rawJSONWebKey, error) {
func (key rawJSONWebKey) edPrivateKey() (ed25519.PrivateKey, error) {
var missing []string
- switch {
- case key.D == nil:
+ if key.D == nil {
missing = append(missing, "D")
- case key.X == nil:
+ }
+ if key.X == nil {
missing = append(missing, "X")
}
@@ -611,19 +623,21 @@ func (key rawJSONWebKey) edPublicKey() (ed25519.PublicKey, error) {
func (key rawJSONWebKey) rsaPrivateKey() (*rsa.PrivateKey, error) {
var missing []string
- switch {
- case key.N == nil:
+ if key.N == nil {
missing = append(missing, "N")
- case key.E == nil:
+ }
+ if key.E == nil {
missing = append(missing, "E")
- case key.D == nil:
+ }
+ if key.D == nil {
missing = append(missing, "D")
- case key.P == nil:
+ }
+ if key.P == nil {
missing = append(missing, "P")
- case key.Q == nil:
+ }
+ if key.Q == nil {
missing = append(missing, "Q")
}
-
if len(missing) > 0 {
return nil, fmt.Errorf("go-jose/go-jose: invalid RSA private key, missing %s value(s)", strings.Join(missing, ", "))
}
@@ -698,8 +712,19 @@ func (key rawJSONWebKey) ecPrivateKey() (*ecdsa.PrivateKey, error) {
return nil, fmt.Errorf("go-jose/go-jose: unsupported elliptic curve '%s'", key.Crv)
}
- if key.X == nil || key.Y == nil || key.D == nil {
- return nil, fmt.Errorf("go-jose/go-jose: invalid EC private key, missing x/y/d values")
+ var missing []string
+ if key.X == nil {
+ missing = append(missing, "X")
+ }
+ if key.Y == nil {
+ missing = append(missing, "Y")
+ }
+ if key.D == nil {
+ missing = append(missing, "D")
+ }
+
+ if len(missing) > 0 {
+ return nil, fmt.Errorf("go-jose/go-jose: invalid EC private key, missing %s value(s)", strings.Join(missing, ", "))
}
// The length of this octet string MUST be the full size of a coordinate for
diff --git a/vendor/github.com/go-jose/go-jose/v4/jws.go b/vendor/github.com/go-jose/go-jose/v4/jws.go
index d09d8ba50..c40bd3ec1 100644
--- a/vendor/github.com/go-jose/go-jose/v4/jws.go
+++ b/vendor/github.com/go-jose/go-jose/v4/jws.go
@@ -75,7 +75,14 @@ type Signature struct {
original *rawSignatureInfo
}
-// ParseSigned parses a signed message in JWS Compact or JWS JSON Serialization.
+// ParseSigned parses a signed message in JWS Compact or JWS JSON Serialization. Validation fails if
+// the JWS is signed with an algorithm that isn't in the provided list of signature algorithms.
+// Applications should decide for themselves which signature algorithms are acceptable. If you're
+// not sure which signature algorithms your application might receive, consult the documentation of
+// the program which provides them or the protocol that you are implementing. You can also try
+// getting an example JWS and decoding it with a tool like https://jwt.io to see what its "alg"
+// header parameter indicates. The signature on the JWS does not get validated during parsing. Call
+// Verify() after parsing to validate the signature and obtain the payload.
//
// https://datatracker.ietf.org/doc/html/rfc7515#section-7
func ParseSigned(
@@ -90,7 +97,14 @@ func ParseSigned(
return parseSignedCompact(signature, nil, signatureAlgorithms)
}
-// ParseSignedCompact parses a message in JWS Compact Serialization.
+// ParseSignedCompact parses a message in JWS Compact Serialization. Validation fails if the JWS is
+// signed with an algorithm that isn't in the provided list of signature algorithms. Applications
+// should decide for themselves which signature algorithms are acceptable.If you're not sure which
+// signature algorithms your application might receive, consult the documentation of the program
+// which provides them or the protocol that you are implementing. You can also try getting an
+// example JWS and decoding it with a tool like https://jwt.io to see what its "alg" header
+// parameter indicates. The signature on the JWS does not get validated during parsing. Call
+// Verify() after parsing to validate the signature and obtain the payload.
//
// https://datatracker.ietf.org/doc/html/rfc7515#section-7.1
func ParseSignedCompact(
@@ -101,6 +115,15 @@ func ParseSignedCompact(
}
// ParseDetached parses a signed message in compact serialization format with detached payload.
+// Validation fails if the JWS is signed with an algorithm that isn't in the provided list of
+// signature algorithms. Applications should decide for themselves which signature algorithms are
+// acceptable. If you're not sure which signature algorithms your application might receive, consult
+// the documentation of the program which provides them or the protocol that you are implementing.
+// You can also try getting an example JWS and decoding it with a tool like https://jwt.io to see
+// what its "alg" header parameter indicates. The signature on the JWS does not get validated during
+// parsing. Call Verify() after parsing to validate the signature and obtain the payload.
+//
+// https://datatracker.ietf.org/doc/html/rfc7515#appendix-F
func ParseDetached(
signature string,
payload []byte,
@@ -181,6 +204,25 @@ func containsSignatureAlgorithm(haystack []SignatureAlgorithm, needle SignatureA
return false
}
+// ErrUnexpectedSignatureAlgorithm is returned when the signature algorithm in
+// the JWS header does not match one of the expected algorithms.
+type ErrUnexpectedSignatureAlgorithm struct {
+ // Got is the signature algorithm found in the JWS header.
+ Got SignatureAlgorithm
+ expected []SignatureAlgorithm
+}
+
+func (e *ErrUnexpectedSignatureAlgorithm) Error() string {
+ return fmt.Sprintf("unexpected signature algorithm %q; expected %q", e.Got, e.expected)
+}
+
+func newErrUnexpectedSignatureAlgorithm(got SignatureAlgorithm, expected []SignatureAlgorithm) error {
+ return &ErrUnexpectedSignatureAlgorithm{
+ Got: got,
+ expected: expected,
+ }
+}
+
// sanitized produces a cleaned-up JWS object from the raw JSON.
func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgorithm) (*JSONWebSignature, error) {
if len(signatureAlgorithms) == 0 {
@@ -236,8 +278,7 @@ func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgo
alg := SignatureAlgorithm(signature.Header.Algorithm)
if !containsSignatureAlgorithm(signatureAlgorithms, alg) {
- return nil, fmt.Errorf("go-jose/go-jose: unexpected signature algorithm %q; expected %q",
- alg, signatureAlgorithms)
+ return nil, newErrUnexpectedSignatureAlgorithm(alg, signatureAlgorithms)
}
if signature.header != nil {
@@ -285,8 +326,7 @@ func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgo
alg := SignatureAlgorithm(obj.Signatures[i].Header.Algorithm)
if !containsSignatureAlgorithm(signatureAlgorithms, alg) {
- return nil, fmt.Errorf("go-jose/go-jose: unexpected signature algorithm %q; expected %q",
- alg, signatureAlgorithms)
+ return nil, newErrUnexpectedSignatureAlgorithm(alg, signatureAlgorithms)
}
if obj.Signatures[i].header != nil {
@@ -321,35 +361,43 @@ func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgo
return obj, nil
}
+const tokenDelim = "."
+
// parseSignedCompact parses a message in compact format.
func parseSignedCompact(
input string,
payload []byte,
signatureAlgorithms []SignatureAlgorithm,
) (*JSONWebSignature, error) {
- // Three parts is two separators
- if strings.Count(input, ".") != 2 {
+ protected, s, ok := strings.Cut(input, tokenDelim)
+ if !ok { // no period found
+ return nil, fmt.Errorf("go-jose/go-jose: compact JWS format must have three parts")
+ }
+ claims, sig, ok := strings.Cut(s, tokenDelim)
+ if !ok { // only one period found
+ return nil, fmt.Errorf("go-jose/go-jose: compact JWS format must have three parts")
+ }
+ if strings.ContainsRune(sig, '.') { // too many periods found
return nil, fmt.Errorf("go-jose/go-jose: compact JWS format must have three parts")
}
- parts := strings.SplitN(input, ".", 3)
- if parts[1] != "" && payload != nil {
+ if claims != "" && payload != nil {
return nil, fmt.Errorf("go-jose/go-jose: payload is not detached")
}
- rawProtected, err := base64.RawURLEncoding.DecodeString(parts[0])
+ rawProtected, err := base64.RawURLEncoding.DecodeString(protected)
if err != nil {
return nil, err
}
if payload == nil {
- payload, err = base64.RawURLEncoding.DecodeString(parts[1])
+ payload, err = base64.RawURLEncoding.DecodeString(claims)
if err != nil {
return nil, err
}
}
- signature, err := base64.RawURLEncoding.DecodeString(parts[2])
+ signature, err := base64.RawURLEncoding.DecodeString(sig)
if err != nil {
return nil, err
}
diff --git a/vendor/github.com/go-jose/go-jose/v4/shared.go b/vendor/github.com/go-jose/go-jose/v4/shared.go
index 1ec339612..56a81b258 100644
--- a/vendor/github.com/go-jose/go-jose/v4/shared.go
+++ b/vendor/github.com/go-jose/go-jose/v4/shared.go
@@ -22,7 +22,6 @@ import (
"encoding/base64"
"errors"
"fmt"
-
"github.com/go-jose/go-jose/v4/json"
)
diff --git a/vendor/github.com/go-jose/go-jose/v4/symmetric.go b/vendor/github.com/go-jose/go-jose/v4/symmetric.go
index a69103b08..6176e0607 100644
--- a/vendor/github.com/go-jose/go-jose/v4/symmetric.go
+++ b/vendor/github.com/go-jose/go-jose/v4/symmetric.go
@@ -30,8 +30,6 @@ import (
"hash"
"io"
- "golang.org/x/crypto/pbkdf2"
-
josecipher "github.com/go-jose/go-jose/v4/cipher"
)
@@ -330,7 +328,10 @@ func (ctx *symmetricKeyCipher) encryptKey(cek []byte, alg KeyAlgorithm) (recipie
// derive key
keyLen, h := getPbkdf2Params(alg)
- key := pbkdf2.Key(ctx.key, salt, ctx.p2c, keyLen, h)
+ key, err := pbkdf2Key(h, string(ctx.key), salt, ctx.p2c, keyLen)
+ if err != nil {
+ return recipientInfo{}, nil
+ }
// use AES cipher with derived key
block, err := aes.NewCipher(key)
@@ -432,7 +433,10 @@ func (ctx *symmetricKeyCipher) decryptKey(headers rawHeader, recipient *recipien
// derive key
keyLen, h := getPbkdf2Params(alg)
- key := pbkdf2.Key(ctx.key, salt, p2c, keyLen, h)
+ key, err := pbkdf2Key(h, string(ctx.key), salt, p2c, keyLen)
+ if err != nil {
+ return nil, err
+ }
// use AES cipher with derived key
block, err := aes.NewCipher(key)
diff --git a/vendor/github.com/go-jose/go-jose/v4/symmetric_go124.go b/vendor/github.com/go-jose/go-jose/v4/symmetric_go124.go
new file mode 100644
index 000000000..6c5a4e7f2
--- /dev/null
+++ b/vendor/github.com/go-jose/go-jose/v4/symmetric_go124.go
@@ -0,0 +1,28 @@
+//go:build go1.24
+
+/*-
+ * Copyright 2014 Square Inc.
+ *
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ * http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+package jose
+
+import (
+ "crypto/pbkdf2"
+ "hash"
+)
+
+func pbkdf2Key(h func() hash.Hash, password string, salt []byte, iter, keyLen int) ([]byte, error) {
+ return pbkdf2.Key(h, password, salt, iter, keyLen)
+}
diff --git a/vendor/github.com/go-jose/go-jose/v4/symmetric_legacy.go b/vendor/github.com/go-jose/go-jose/v4/symmetric_legacy.go
new file mode 100644
index 000000000..bdfc3d766
--- /dev/null
+++ b/vendor/github.com/go-jose/go-jose/v4/symmetric_legacy.go
@@ -0,0 +1,29 @@
+//go:build !go1.24
+
+/*-
+ * Copyright 2014 Square Inc.
+ *
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ * http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+package jose
+
+import (
+ "hash"
+
+ "golang.org/x/crypto/pbkdf2"
+)
+
+func pbkdf2Key(h func() hash.Hash, password string, salt []byte, iter, keyLen int) ([]byte, error) {
+ return pbkdf2.Key([]byte(password), salt, iter, keyLen, h), nil
+}
diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md
index 465f4b77c..accd7abaf 100644
--- a/vendor/github.com/klauspost/cpuid/v2/README.md
+++ b/vendor/github.com/klauspost/cpuid/v2/README.md
@@ -16,10 +16,23 @@ Package home: https://github.com/klauspost/cpuid
## installing
-`go get -u github.com/klauspost/cpuid/v2` using modules.
-
+`go get -u github.com/klauspost/cpuid/v2` using modules.
Drop `v2` for others.
+Installing binary:
+
+`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
+
+Or download binaries from release page: https://github.com/klauspost/cpuid/releases
+
+### Homebrew
+
+For macOS/Linux users, you can install via [brew](https://brew.sh/)
+
+```sh
+$ brew install cpuid
+```
+
## example
```Go
@@ -39,10 +52,10 @@ func main() {
fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
fmt.Println("LogicalCores:", CPU.LogicalCores)
fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
- fmt.Println("Features:", fmt.Sprintf(strings.Join(CPU.FeatureSet(), ",")))
+ fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
fmt.Println("Cacheline bytes:", CPU.CacheLine)
fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
- fmt.Println("L1 Instruction Cache:", CPU.Cache.L1D, "bytes")
+ fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
fmt.Println("Frequency", CPU.Hz, "hz")
@@ -77,10 +90,14 @@ We have Streaming SIMD 2 Extensions
The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
+To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
+This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
+
Note that for some cpu/os combinations some features will not be detected.
`amd64` has rather good support and should work reliably on all platforms.
-Note that hypervisors may not pass through all CPU features.
+Note that hypervisors may not pass through all CPU features through to the guest OS,
+so even if your host supports a feature it may not be visible on guests.
## arm64 feature detection
@@ -132,6 +149,345 @@ func main() {
}
```
+## commandline
+
+Download as binary from: https://github.com/klauspost/cpuid/releases
+
+Install from source:
+
+`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
+
+### Example
+
+```
+λ cpuid
+Name: AMD Ryzen 9 3950X 16-Core Processor
+Vendor String: AuthenticAMD
+Vendor ID: AMD
+PhysicalCores: 16
+Threads Per Core: 2
+Logical Cores: 32
+CPU Family 23 Model: 113
+Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
+Microarchitecture level: 3
+Cacheline bytes: 64
+L1 Instruction Cache: 32768 bytes
+L1 Data Cache: 32768 bytes
+L2 Cache: 524288 bytes
+L3 Cache: 16777216 bytes
+
+```
+### JSON Output:
+
+```
+λ cpuid --json
+{
+ "BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
+ "VendorID": 2,
+ "VendorString": "AuthenticAMD",
+ "PhysicalCores": 16,
+ "ThreadsPerCore": 2,
+ "LogicalCores": 32,
+ "Family": 23,
+ "Model": 113,
+ "CacheLine": 64,
+ "Hz": 0,
+ "BoostFreq": 0,
+ "Cache": {
+ "L1I": 32768,
+ "L1D": 32768,
+ "L2": 524288,
+ "L3": 16777216
+ },
+ "SGX": {
+ "Available": false,
+ "LaunchControl": false,
+ "SGX1Supported": false,
+ "SGX2Supported": false,
+ "MaxEnclaveSizeNot64": 0,
+ "MaxEnclaveSize64": 0,
+ "EPCSections": null
+ },
+ "Features": [
+ "ADX",
+ "AESNI",
+ "AVX",
+ "AVX2",
+ "BMI1",
+ "BMI2",
+ "CLMUL",
+ "CLZERO",
+ "CMOV",
+ "CMPXCHG8",
+ "CPBOOST",
+ "CX16",
+ "F16C",
+ "FMA3",
+ "FXSR",
+ "FXSROPT",
+ "HTT",
+ "HYPERVISOR",
+ "LAHF",
+ "LZCNT",
+ "MCAOVERFLOW",
+ "MMX",
+ "MMXEXT",
+ "MOVBE",
+ "NX",
+ "OSXSAVE",
+ "POPCNT",
+ "RDRAND",
+ "RDSEED",
+ "RDTSCP",
+ "SCE",
+ "SHA",
+ "SSE",
+ "SSE2",
+ "SSE3",
+ "SSE4",
+ "SSE42",
+ "SSE4A",
+ "SSSE3",
+ "SUCCOR",
+ "X87",
+ "XSAVE"
+ ],
+ "X64Level": 3
+}
+```
+
+### Check CPU microarch level
+
+```
+λ cpuid --check-level=3
+2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
+2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
+Exit Code 0
+
+λ cpuid --check-level=4
+2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
+2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
+Exit Code 1
+```
+
+
+## Available flags
+
+### x86 & amd64
+
+| Feature Flag | Description |
+|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
+| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
+| AESNI | Advanced Encryption Standard New Instructions |
+| AMD3DNOW | AMD 3DNOW |
+| AMD3DNOWEXT | AMD 3DNowExt |
+| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
+| AMXINT8 | Tile computational operations on 8-bit integers |
+| AMXFP16 | Tile computational operations on FP16 numbers |
+| AMXTILE | Tile architecture |
+| AVX | AVX functions |
+| AVX2 | AVX2 functions |
+| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
+| AVX512BITALG | AVX-512 Bit Algorithms |
+| AVX512BW | AVX-512 Byte and Word Instructions |
+| AVX512CD | AVX-512 Conflict Detection Instructions |
+| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
+| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
+| AVX512F | AVX-512 Foundation |
+| AVX512FP16 | AVX-512 FP16 Instructions |
+| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
+| AVX512PF | AVX-512 Prefetch Instructions |
+| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
+| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
+| AVX512VL | AVX-512 Vector Length Extensions |
+| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
+| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
+| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
+| AVXIFMA | AVX-IFMA instructions |
+| AVXNECONVERT | AVX-NE-CONVERT instructions |
+| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
+| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
+| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
+| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
+| BMI1 | Bit Manipulation Instruction Set 1 |
+| BMI2 | Bit Manipulation Instruction Set 2 |
+| CETIBT | Intel CET Indirect Branch Tracking |
+| CETSS | Intel CET Shadow Stack |
+| CLDEMOTE | Cache Line Demote |
+| CLMUL | Carry-less Multiplication |
+| CLZERO | CLZERO instruction supported |
+| CMOV | i686 CMOV |
+| CMPCCXADD | CMPCCXADD instructions |
+| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
+| CMPXCHG8 | CMPXCHG8 instruction |
+| CPBOOST | Core Performance Boost |
+| CPPC | AMD: Collaborative Processor Performance Control |
+| CX16 | CMPXCHG16B Instruction |
+| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
+| ENQCMD | Enqueue Command |
+| ERMS | Enhanced REP MOVSB/STOSB |
+| F16C | Half-precision floating-point conversion |
+| FLUSH_L1D | Flush L1D cache |
+| FMA3 | Intel FMA 3. Does not imply AVX. |
+| FMA4 | Bulldozer FMA4 functions |
+| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
+| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
+| FSRM | Fast Short Rep Mov |
+| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
+| FXSROPT | FXSAVE/FXRSTOR optimizations |
+| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
+| HLE | Hardware Lock Elision |
+| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
+| HTT | Hyperthreading (enabled) |
+| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
+| HYBRID_CPU | This part has CPUs of more than one type. |
+| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
+| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
+| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
+| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
+| IBRS | AMD: Indirect Branch Restricted Speculation |
+| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
+| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
+| IBS | Instruction Based Sampling (AMD) |
+| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
+| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
+| IBSFFV | Instruction Based Sampling Feature (AMD) |
+| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
+| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
+| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
+| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
+| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
+| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
+| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
+| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
+| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
+| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
+| IDPRED_CTRL | IPRED_DIS |
+| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
+| INVLPGB | NVLPGB and TLBSYNC instruction supported |
+| LAHF | LAHF/SAHF in long mode |
+| LAM | If set, CPU supports Linear Address Masking |
+| LBRVIRT | LBR virtualization |
+| LZCNT | LZCNT instruction |
+| MCAOVERFLOW | MCA overflow recovery support. |
+| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
+| MCOMMIT | MCOMMIT instruction supported |
+| MD_CLEAR | VERW clears CPU buffers |
+| MMX | standard MMX |
+| MMXEXT | SSE integer functions or AMD MMX ext |
+| MOVBE | MOVBE instruction (big-endian) |
+| MOVDIR64B | Move 64 Bytes as Direct Store |
+| MOVDIRI | Move Doubleword as Direct Store |
+| MOVSB_ZL | Fast Zero-Length MOVSB |
+| MPX | Intel MPX (Memory Protection Extensions) |
+| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
+| MSRIRC | Instruction Retired Counter MSR available |
+| MSRLIST | Read/Write List of Model Specific Registers |
+| MSR_PAGEFLUSH | Page Flush MSR available |
+| NRIPS | Indicates support for NRIP save on VMEXIT |
+| NX | NX (No-Execute) bit |
+| OSXSAVE | XSAVE enabled by OS |
+| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
+| POPCNT | POPCNT instruction |
+| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
+| PREFETCHI | PREFETCHIT0/1 instructions |
+| PSFD | Predictive Store Forward Disable |
+| RDPRU | RDPRU instruction supported |
+| RDRAND | RDRAND instruction is available |
+| RDSEED | RDSEED instruction is available |
+| RDTSCP | RDTSCP Instruction |
+| RRSBA_CTRL | Restricted RSB Alternate |
+| RTM | Restricted Transactional Memory |
+| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
+| SERIALIZE | Serialize Instruction Execution |
+| SEV | AMD Secure Encrypted Virtualization supported |
+| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
+| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
+| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
+| SEV_ES | AMD SEV Encrypted State supported |
+| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
+| SEV_SNP | AMD SEV Secure Nested Paging supported |
+| SGX | Software Guard Extensions |
+| SGXLC | Software Guard Extensions Launch Control |
+| SHA | Intel SHA Extensions |
+| SME | AMD Secure Memory Encryption supported |
+| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
+| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
+| SRBDS_CTRL | SRBDS mitigation MSR available |
+| SSE | SSE functions |
+| SSE2 | P4 SSE functions |
+| SSE3 | Prescott SSE3 functions |
+| SSE4 | Penryn SSE4.1 functions |
+| SSE42 | Nehalem SSE4.2 functions |
+| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
+| SSSE3 | Conroe SSSE3 functions |
+| STIBP | Single Thread Indirect Branch Predictors |
+| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
+| STOSB_SHORT | Fast short STOSB |
+| SUCCOR | Software uncorrectable error containment and recovery capability. |
+| SVM | AMD Secure Virtual Machine |
+| SVMDA | Indicates support for the SVM decode assists. |
+| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
+| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
+| SVMNP | AMD SVM nested paging |
+| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
+| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
+| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
+| SYSEE | SYSENTER and SYSEXIT instructions |
+| TBM | AMD Trailing Bit Manipulation |
+| TDX_GUEST | Intel Trust Domain Extensions Guest |
+| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
+| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
+| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
+| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
+| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
+| VAES | Vector AES. AVX(512) versions requires additional checks. |
+| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
+| VMPL | AMD VM Permission Levels supported |
+| VMSA_REGPROT | AMD VMSA Register Protection supported |
+| VMX | Virtual Machine Extensions |
+| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
+| VTE | AMD Virtual Transparent Encryption supported |
+| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
+| WBNOINVD | Write Back and Do Not Invalidate Cache |
+| WRMSRNS | Non-Serializing Write to Model Specific Register |
+| X87 | FPU |
+| XGETBV1 | Supports XGETBV with ECX = 1 |
+| XOP | Bulldozer XOP functions |
+| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
+| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
+| XSAVEOPT | XSAVEOPT available |
+| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
+
+# ARM features:
+
+| Feature Flag | Description |
+|--------------|------------------------------------------------------------------|
+| AESARM | AES instructions |
+| ARMCPUID | Some CPU ID registers readable at user-level |
+| ASIMD | Advanced SIMD |
+| ASIMDDP | SIMD Dot Product |
+| ASIMDHP | Advanced SIMD half-precision floating point |
+| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
+| ATOMICS | Large System Extensions (LSE) |
+| CRC32 | CRC32/CRC32C instructions |
+| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
+| EVTSTRM | Generic timer |
+| FCMA | Floatin point complex number addition and multiplication |
+| FP | Single-precision and double-precision floating point |
+| FPHP | Half-precision floating point |
+| GPA | Generic Pointer Authentication |
+| JSCVT | Javascript-style double->int convert (FJCVTZS) |
+| LRCPC | Weaker release consistency (LDAPR, etc) |
+| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
+| SHA1 | SHA-1 instructions (SHA1C, etc) |
+| SHA2 | SHA-2 instructions (SHA256H, etc) |
+| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
+| SHA512 | SHA512 instructions |
+| SM3 | SM3 instructions |
+| SM4 | SM4 instructions |
+| SVE | Scalable Vector Extension |
+
# license
This code is published under an MIT license. See LICENSE file for more information.
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
index 1d88736b6..d015c744e 100644
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go
+++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
@@ -14,6 +14,7 @@ import (
"flag"
"fmt"
"math"
+ "math/bits"
"os"
"runtime"
"strings"
@@ -72,6 +73,7 @@ const (
AMD3DNOW // AMD 3DNOW
AMD3DNOWEXT // AMD 3DNowExt
AMXBF16 // Tile computational operations on BFLOAT16 numbers
+ AMXFP16 // Tile computational operations on FP16 numbers
AMXINT8 // Tile computational operations on 8-bit integers
AMXTILE // Tile architecture
AVX // AVX functions
@@ -92,26 +94,51 @@ const (
AVX512VNNI // AVX-512 Vector Neural Network Instructions
AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
- AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one.
+ AVXIFMA // AVX-IFMA instructions
+ AVXNECONVERT // AVX-NE-CONVERT instructions
+ AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
+ AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
+ AVXVNNIINT8 // AVX-VNNI-INT8 instructions
+ BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
BMI1 // Bit Manipulation Instruction Set 1
BMI2 // Bit Manipulation Instruction Set 2
+ CETIBT // Intel CET Indirect Branch Tracking
+ CETSS // Intel CET Shadow Stack
CLDEMOTE // Cache Line Demote
CLMUL // Carry-less Multiplication
CLZERO // CLZERO instruction supported
CMOV // i686 CMOV
+ CMPCCXADD // CMPCCXADD instructions
+ CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
+ CMPXCHG8 // CMPXCHG8 instruction
CPBOOST // Core Performance Boost
+ CPPC // AMD: Collaborative Processor Performance Control
CX16 // CMPXCHG16B Instruction
+ EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
ENQCMD // Enqueue Command
ERMS // Enhanced REP MOVSB/STOSB
F16C // Half-precision floating-point conversion
+ FLUSH_L1D // Flush L1D cache
FMA3 // Intel FMA 3. Does not imply AVX.
FMA4 // Bulldozer FMA4 functions
- GFNI // Galois Field New Instructions
+ FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
+ FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
+ FSRM // Fast Short Rep Mov
+ FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
+ FXSROPT // FXSAVE/FXRSTOR optimizations
+ GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
HLE // Hardware Lock Elision
+ HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
HTT // Hyperthreading (enabled)
HWA // Hardware assert supported. Indicates support for MSRC001_10
+ HYBRID_CPU // This part has CPUs of more than one type.
HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
+ IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
+ IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
+ IBRS // AMD: Indirect Branch Restricted Speculation
+ IBRS_PREFERRED // AMD: IBRS is preferred over software solution
+ IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
IBS // Instruction Based Sampling (AMD)
IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
@@ -121,29 +148,63 @@ const (
IBSOPSAM // Instruction Based Sampling Feature (AMD)
IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
+ IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
+ IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
+ IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
+ IBS_PREVENTHOST // Disallowing IBS use by the host supported
+ IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
+ IDPRED_CTRL // IPRED_DIS
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
INVLPGB // NVLPGB and TLBSYNC instruction supported
+ LAHF // LAHF/SAHF in long mode
+ LAM // If set, CPU supports Linear Address Masking
+ LBRVIRT // LBR virtualization
LZCNT // LZCNT instruction
MCAOVERFLOW // MCA overflow recovery support.
+ MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
MCOMMIT // MCOMMIT instruction supported
+ MD_CLEAR // VERW clears CPU buffers
MMX // standard MMX
MMXEXT // SSE integer functions or AMD MMX ext
+ MOVBE // MOVBE instruction (big-endian)
MOVDIR64B // Move 64 Bytes as Direct Store
MOVDIRI // Move Doubleword as Direct Store
+ MOVSB_ZL // Fast Zero-Length MOVSB
+ MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
MPX // Intel MPX (Memory Protection Extensions)
MSRIRC // Instruction Retired Counter MSR available
+ MSRLIST // Read/Write List of Model Specific Registers
+ MSR_PAGEFLUSH // Page Flush MSR available
+ NRIPS // Indicates support for NRIP save on VMEXIT
NX // NX (No-Execute) bit
+ OSXSAVE // XSAVE enabled by OS
+ PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
POPCNT // POPCNT instruction
+ PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
+ PREFETCHI // PREFETCHIT0/1 instructions
+ PSFD // Predictive Store Forward Disable
RDPRU // RDPRU instruction supported
RDRAND // RDRAND instruction is available
RDSEED // RDSEED instruction is available
RDTSCP // RDTSCP Instruction
+ RRSBA_CTRL // Restricted RSB Alternate
RTM // Restricted Transactional Memory
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
SERIALIZE // Serialize Instruction Execution
+ SEV // AMD Secure Encrypted Virtualization supported
+ SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
+ SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
+ SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
+ SEV_ES // AMD SEV Encrypted State supported
+ SEV_RESTRICTED // AMD SEV Restricted Injection supported
+ SEV_SNP // AMD SEV Secure Nested Paging supported
SGX // Software Guard Extensions
SGXLC // Software Guard Extensions Launch Control
SHA // Intel SHA Extensions
+ SME // AMD Secure Memory Encryption supported
+ SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
+ SPEC_CTRL_SSBD // Speculative Store Bypass Disable
+ SRBDS_CTRL // SRBDS mitigation MSR available
SSE // SSE functions
SSE2 // P4 SSE functions
SSE3 // Prescott SSE3 functions
@@ -152,15 +213,42 @@ const (
SSE4A // AMD Barcelona microarchitecture SSE4a instructions
SSSE3 // Conroe SSSE3 functions
STIBP // Single Thread Indirect Branch Predictors
+ STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
+ STOSB_SHORT // Fast short STOSB
SUCCOR // Software uncorrectable error containment and recovery capability.
+ SVM // AMD Secure Virtual Machine
+ SVMDA // Indicates support for the SVM decode assists.
+ SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
+ SVML // AMD SVM lock. Indicates support for SVM-Lock.
+ SVMNP // AMD SVM nested paging
+ SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
+ SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
+ SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
+ SYSEE // SYSENTER and SYSEXIT instructions
TBM // AMD Trailing Bit Manipulation
+ TDX_GUEST // Intel Trust Domain Extensions Guest
+ TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
+ TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
+ TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
+ TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
TSXLDTRK // Intel TSX Suspend Load Address Tracking
- VAES // Vector AES
+ VAES // Vector AES. AVX(512) versions requires additional checks.
+ VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
+ VMPL // AMD VM Permission Levels supported
+ VMSA_REGPROT // AMD VMSA Register Protection supported
VMX // Virtual Machine Extensions
- VPCLMULQDQ // Carry-Less Multiplication Quadword
+ VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
+ VTE // AMD Virtual Transparent Encryption supported
WAITPKG // TPAUSE, UMONITOR, UMWAIT
WBNOINVD // Write Back and Do Not Invalidate Cache
+ WRMSRNS // Non-Serializing Write to Model Specific Register
+ X87 // FPU
+ XGETBV1 // Supports XGETBV with ECX = 1
XOP // Bulldozer XOP functions
+ XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
+ XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
+ XSAVEOPT // XSAVEOPT available
+ XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
// ARM features:
AESARM // AES instructions
@@ -187,7 +275,6 @@ const (
SM3 // SM3 instructions
SM4 // SM4 instructions
SVE // Scalable Vector Extension
-
// Keep it last. It automatically defines the size of []flagSet
lastID
@@ -205,6 +292,7 @@ type CPUInfo struct {
LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
Family int // CPU family number
Model int // CPU model number
+ Stepping int // CPU stepping info
CacheLine int // Cache line size in bytes. Will be 0 if undetectable.
Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
BoostFreq int64 // Max clock speed, if known, 0 otherwise
@@ -307,10 +395,66 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool {
// Has allows for checking a single feature.
// Should be inlined by the compiler.
-func (c CPUInfo) Has(id FeatureID) bool {
+func (c *CPUInfo) Has(id FeatureID) bool {
return c.featureSet.inSet(id)
}
+// AnyOf returns whether the CPU supports one or more of the requested features.
+func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
+ for _, id := range ids {
+ if c.featureSet.inSet(id) {
+ return true
+ }
+ }
+ return false
+}
+
+// Features contains several features combined for a fast check using
+// CpuInfo.HasAll
+type Features *flagSet
+
+// CombineFeatures allows to combine several features for a close to constant time lookup.
+func CombineFeatures(ids ...FeatureID) Features {
+ var v flagSet
+ for _, id := range ids {
+ v.set(id)
+ }
+ return &v
+}
+
+func (c *CPUInfo) HasAll(f Features) bool {
+ return c.featureSet.hasSetP(f)
+}
+
+// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
+var oneOfLevel = CombineFeatures(SYSEE, SYSCALL)
+var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2)
+var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
+var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
+var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
+
+// X64Level returns the microarchitecture level detected on the CPU.
+// If features are lacking or non x64 mode, 0 is returned.
+// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
+func (c CPUInfo) X64Level() int {
+ if !c.featureSet.hasOneOf(oneOfLevel) {
+ return 0
+ }
+ if c.featureSet.hasSetP(level4Features) {
+ return 4
+ }
+ if c.featureSet.hasSetP(level3Features) {
+ return 3
+ }
+ if c.featureSet.hasSetP(level2Features) {
+ return 2
+ }
+ if c.featureSet.hasSetP(level1Features) {
+ return 1
+ }
+ return 0
+}
+
// Disable will disable one or several features.
func (c *CPUInfo) Disable(ids ...FeatureID) bool {
for _, id := range ids {
@@ -333,11 +477,10 @@ func (c CPUInfo) IsVendor(v Vendor) bool {
return c.VendorID == v
}
+// FeatureSet returns all available features as strings.
func (c CPUInfo) FeatureSet() []string {
- s := make([]string, 0)
- for _, f := range c.featureSet.Strings() {
- s = append(s, f)
- }
+ s := make([]string, 0, c.featureSet.nEnabled())
+ s = append(s, c.featureSet.Strings()...)
return s
}
@@ -470,7 +613,7 @@ const flagMask = flagBits - 1
// flagSet contains detected cpu features and characteristics in an array of flags
type flagSet [(lastID + flagMask) / flagBits]flags
-func (s flagSet) inSet(feat FeatureID) bool {
+func (s *flagSet) inSet(feat FeatureID) bool {
return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0
}
@@ -499,6 +642,52 @@ func (s *flagSet) or(other flagSet) {
}
}
+// hasSet returns whether all features are present.
+func (s *flagSet) hasSet(other flagSet) bool {
+ for i, v := range other[:] {
+ if s[i]&v != v {
+ return false
+ }
+ }
+ return true
+}
+
+// hasSet returns whether all features are present.
+func (s *flagSet) hasSetP(other *flagSet) bool {
+ for i, v := range other[:] {
+ if s[i]&v != v {
+ return false
+ }
+ }
+ return true
+}
+
+// hasOneOf returns whether one or more features are present.
+func (s *flagSet) hasOneOf(other *flagSet) bool {
+ for i, v := range other[:] {
+ if s[i]&v != 0 {
+ return true
+ }
+ }
+ return false
+}
+
+// nEnabled will return the number of enabled flags.
+func (s *flagSet) nEnabled() (n int) {
+ for _, v := range s[:] {
+ n += bits.OnesCount64(uint64(v))
+ }
+ return n
+}
+
+func flagSetWith(feat ...FeatureID) flagSet {
+ var res flagSet
+ for _, f := range feat {
+ res.set(f)
+ }
+ return res
+}
+
// ParseFeature will parse the string and return the ID of the matching feature.
// Will return UNKNOWN if not found.
func ParseFeature(s string) FeatureID {
@@ -579,7 +768,7 @@ func threadsPerCore() int {
if vend == AMD {
// Workaround for AMD returning 0, assume 2 if >= Zen 2
// It will be more correct than not.
- fam, _ := familyModel()
+ fam, _, _ := familyModel()
_, _, _, d := cpuid(1)
if (d&(1<<28)) != 0 && fam >= 23 {
return 2
@@ -617,14 +806,27 @@ func logicalCores() int {
}
}
-func familyModel() (int, int) {
+func familyModel() (family, model, stepping int) {
if maxFunctionID() < 0x1 {
- return 0, 0
+ return 0, 0, 0
}
eax, _, _, _ := cpuid(1)
- family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff)
- model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0)
- return int(family), int(model)
+ // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0].
+ family = int((eax >> 8) & 0xf)
+ extFam := family == 0x6 // Intel is 0x6, needs extended model.
+ if family == 0xf {
+ // Add ExtFamily
+ family += int((eax >> 20) & 0xff)
+ extFam = true
+ }
+ // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0].
+ model = int((eax >> 4) & 0xf)
+ if extFam {
+ // Add ExtModel
+ model += int((eax >> 12) & 0xf0)
+ }
+ stepping = int(eax & 0xf)
+ return family, model, stepping
}
func physicalCores() int {
@@ -708,6 +910,7 @@ func (c *CPUInfo) cacheSize() {
if maxFunctionID() < 4 {
return
}
+ c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0
for i := uint32(0); ; i++ {
eax, ebx, ecx, _ := cpuidex(4, i)
cacheType := eax & 15
@@ -758,9 +961,14 @@ func (c *CPUInfo) cacheSize() {
c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024)
// CPUID Fn8000_001D_EAX_x[N:0] Cache Properties
- if maxExtendedFunction() < 0x8000001D {
+ if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) {
return
}
+
+ // Xen Hypervisor is buggy and returns the same entry no matter ECX value.
+ // Hack: When we encounter the same entry 100 times we break.
+ nSame := 0
+ var last uint32
for i := uint32(0); i < math.MaxUint32; i++ {
eax, ebx, ecx, _ := cpuidex(0x8000001D, i)
@@ -776,6 +984,16 @@ func (c *CPUInfo) cacheSize() {
return
}
+ // Check for the same value repeated.
+ comb := eax ^ ebx ^ ecx
+ if comb == last {
+ nSame++
+ if nSame == 100 {
+ return
+ }
+ }
+ last = comb
+
switch level {
case 1:
switch typ {
@@ -800,8 +1018,6 @@ func (c *CPUInfo) cacheSize() {
}
}
}
-
- return
}
type SGXEPCSection struct {
@@ -862,21 +1078,26 @@ func support() flagSet {
if mfi < 0x1 {
return fs
}
- family, model := familyModel()
+ family, model, _ := familyModel()
_, _, c, d := cpuid(1)
+ fs.setIf((d&(1<<0)) != 0, X87)
+ fs.setIf((d&(1<<8)) != 0, CMPXCHG8)
+ fs.setIf((d&(1<<11)) != 0, SYSEE)
fs.setIf((d&(1<<15)) != 0, CMOV)
fs.setIf((d&(1<<23)) != 0, MMX)
- fs.setIf((d&(1<<25)) != 0, MMXEXT)
+ fs.setIf((d&(1<<24)) != 0, FXSR)
+ fs.setIf((d&(1<<25)) != 0, FXSROPT)
fs.setIf((d&(1<<25)) != 0, SSE)
fs.setIf((d&(1<<26)) != 0, SSE2)
fs.setIf((c&1) != 0, SSE3)
fs.setIf((c&(1<<5)) != 0, VMX)
- fs.setIf((c&0x00000200) != 0, SSSE3)
- fs.setIf((c&0x00080000) != 0, SSE4)
- fs.setIf((c&0x00100000) != 0, SSE42)
+ fs.setIf((c&(1<<9)) != 0, SSSE3)
+ fs.setIf((c&(1<<19)) != 0, SSE4)
+ fs.setIf((c&(1<<20)) != 0, SSE42)
fs.setIf((c&(1<<25)) != 0, AESNI)
fs.setIf((c&(1<<1)) != 0, CLMUL)
+ fs.setIf(c&(1<<22) != 0, MOVBE)
fs.setIf(c&(1<<23) != 0, POPCNT)
fs.setIf(c&(1<<30) != 0, RDRAND)
@@ -892,6 +1113,8 @@ func support() flagSet {
if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 {
fs.setIf(threadsPerCore() > 1, HTT)
}
+ fs.setIf(c&1<<26 != 0, XSAVE)
+ fs.setIf(c&1<<27 != 0, OSXSAVE)
// Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits
const avxCheck = 1<<26 | 1<<27 | 1<<28
if c&avxCheck == avxCheck {
@@ -917,7 +1140,6 @@ func support() flagSet {
// Check AVX2, AVX2 requires OS support, but BMI1/2 don't.
if mfi >= 7 {
_, ebx, ecx, edx := cpuidex(7, 0)
- eax1, _, _, _ := cpuidex(7, 1)
if fs.inSet(AVX) && (ebx&0x00000020) != 0 {
fs.set(AVX2)
}
@@ -934,19 +1156,52 @@ func support() flagSet {
fs.setIf(ebx&(1<<18) != 0, RDSEED)
fs.setIf(ebx&(1<<19) != 0, ADX)
fs.setIf(ebx&(1<<29) != 0, SHA)
+
// CPUID.(EAX=7, ECX=0).ECX
fs.setIf(ecx&(1<<5) != 0, WAITPKG)
+ fs.setIf(ecx&(1<<7) != 0, CETSS)
+ fs.setIf(ecx&(1<<8) != 0, GFNI)
+ fs.setIf(ecx&(1<<9) != 0, VAES)
+ fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
+ fs.setIf(ecx&(1<<13) != 0, TME)
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
fs.setIf(ecx&(1<<30) != 0, SGXLC)
+
// CPUID.(EAX=7, ECX=0).EDX
+ fs.setIf(edx&(1<<4) != 0, FSRM)
+ fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL)
+ fs.setIf(edx&(1<<10) != 0, MD_CLEAR)
fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT)
fs.setIf(edx&(1<<14) != 0, SERIALIZE)
+ fs.setIf(edx&(1<<15) != 0, HYBRID_CPU)
fs.setIf(edx&(1<<16) != 0, TSXLDTRK)
+ fs.setIf(edx&(1<<18) != 0, PCONFIG)
+ fs.setIf(edx&(1<<20) != 0, CETIBT)
fs.setIf(edx&(1<<26) != 0, IBPB)
fs.setIf(edx&(1<<27) != 0, STIBP)
+ fs.setIf(edx&(1<<28) != 0, FLUSH_L1D)
+ fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP)
+ fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
+ fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
+
+ // CPUID.(EAX=7, ECX=1).EAX
+ eax1, _, _, edx1 := cpuidex(7, 1)
+ fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
+ fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
+ fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
+ fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
+ fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
+ fs.setIf(eax1&(1<<22) != 0, HRESET)
+ fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
+ fs.setIf(eax1&(1<<26) != 0, LAM)
+
+ // CPUID.(EAX=7, ECX=1).EDX
+ fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
+ fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
+ fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
@@ -972,9 +1227,6 @@ func support() flagSet {
// ecx
fs.setIf(ecx&(1<<1) != 0, AVX512VBMI)
fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2)
- fs.setIf(ecx&(1<<8) != 0, GFNI)
- fs.setIf(ecx&(1<<9) != 0, VAES)
- fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
fs.setIf(ecx&(1<<11) != 0, AVX512VNNI)
fs.setIf(ecx&(1<<12) != 0, AVX512BITALG)
fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ)
@@ -986,30 +1238,73 @@ func support() flagSet {
fs.setIf(edx&(1<<25) != 0, AMXINT8)
// eax1 = CPUID.(EAX=7, ECX=1).EAX
fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
+ fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
+ fs.setIf(eax1&(1<<21) != 0, AMXFP16)
+ fs.setIf(eax1&(1<<27) != 0, MSRLIST)
}
}
+
+ // CPUID.(EAX=7, ECX=2)
+ _, _, _, edx = cpuidex(7, 2)
+ fs.setIf(edx&(1<<0) != 0, PSFD)
+ fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
+ fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
+ fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
+ fs.setIf(edx&(1<<5) != 0, MCDT_NO)
+
}
+ // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
+ // EAX
+ // Bit 00: XSAVEOPT is available.
+ // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set.
+ // Bit 02: Supports XGETBV with ECX = 1 if set.
+ // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set.
+ // Bits 31 - 04: Reserved.
+ // EBX
+ // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS.
+ // ECX
+ // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1.
+ // EDX?
+ // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved.
+ if mfi >= 0xd {
+ if fs.inSet(XSAVE) {
+ eax, _, _, _ := cpuidex(0xd, 1)
+ fs.setIf(eax&(1<<0) != 0, XSAVEOPT)
+ fs.setIf(eax&(1<<1) != 0, XSAVEC)
+ fs.setIf(eax&(1<<2) != 0, XGETBV1)
+ fs.setIf(eax&(1<<3) != 0, XSAVES)
+ }
+ }
if maxExtendedFunction() >= 0x80000001 {
_, _, c, d := cpuid(0x80000001)
if (c & (1 << 5)) != 0 {
fs.set(LZCNT)
fs.set(POPCNT)
}
- fs.setIf((c&(1<<10)) != 0, IBS)
- fs.setIf((d&(1<<31)) != 0, AMD3DNOW)
- fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT)
- fs.setIf((d&(1<<23)) != 0, MMX)
- fs.setIf((d&(1<<22)) != 0, MMXEXT)
+ // ECX
+ fs.setIf((c&(1<<0)) != 0, LAHF)
+ fs.setIf((c&(1<<2)) != 0, SVM)
fs.setIf((c&(1<<6)) != 0, SSE4A)
+ fs.setIf((c&(1<<10)) != 0, IBS)
+ fs.setIf((c&(1<<22)) != 0, TOPEXT)
+
+ // EDX
+ fs.setIf(d&(1<<11) != 0, SYSCALL)
fs.setIf(d&(1<<20) != 0, NX)
+ fs.setIf(d&(1<<22) != 0, MMXEXT)
+ fs.setIf(d&(1<<23) != 0, MMX)
+ fs.setIf(d&(1<<24) != 0, FXSR)
+ fs.setIf(d&(1<<25) != 0, FXSROPT)
fs.setIf(d&(1<<27) != 0, RDTSCP)
+ fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT)
+ fs.setIf(d&(1<<31) != 0, AMD3DNOW)
/* XOP and FMA4 use the AVX instruction coding scheme, so they can't be
* used unless the OS has AVX support. */
if fs.inSet(AVX) {
- fs.setIf((c&0x00000800) != 0, XOP)
- fs.setIf((c&0x00010000) != 0, FMA4)
+ fs.setIf((c&(1<<11)) != 0, XOP)
+ fs.setIf((c&(1<<16)) != 0, FMA4)
}
}
@@ -1023,15 +1318,48 @@ func support() flagSet {
if maxExtendedFunction() >= 0x80000008 {
_, b, _, _ := cpuid(0x80000008)
+ fs.setIf(b&(1<<28) != 0, PSFD)
+ fs.setIf(b&(1<<27) != 0, CPPC)
+ fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD)
+ fs.setIf(b&(1<<23) != 0, PPIN)
+ fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED)
+ fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS)
+ fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP)
+ fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED)
+ fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON)
+ fs.setIf(b&(1<<15) != 0, STIBP)
+ fs.setIf(b&(1<<14) != 0, IBRS)
+ fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
+ fs.setIf(b&(1<<12) != 0, IBPB)
fs.setIf((b&(1<<9)) != 0, WBNOINVD)
fs.setIf((b&(1<<8)) != 0, MCOMMIT)
- fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
fs.setIf((b&(1<<4)) != 0, RDPRU)
fs.setIf((b&(1<<3)) != 0, INVLPGB)
fs.setIf((b&(1<<1)) != 0, MSRIRC)
fs.setIf((b&(1<<0)) != 0, CLZERO)
}
+ if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A {
+ _, _, _, edx := cpuid(0x8000000A)
+ fs.setIf((edx>>0)&1 == 1, SVMNP)
+ fs.setIf((edx>>1)&1 == 1, LBRVIRT)
+ fs.setIf((edx>>2)&1 == 1, SVML)
+ fs.setIf((edx>>3)&1 == 1, NRIPS)
+ fs.setIf((edx>>4)&1 == 1, TSCRATEMSR)
+ fs.setIf((edx>>5)&1 == 1, VMCBCLEAN)
+ fs.setIf((edx>>6)&1 == 1, SVMFBASID)
+ fs.setIf((edx>>7)&1 == 1, SVMDA)
+ fs.setIf((edx>>10)&1 == 1, SVMPF)
+ fs.setIf((edx>>12)&1 == 1, SVMPFT)
+ }
+
+ if maxExtendedFunction() >= 0x8000001a {
+ eax, _, _, _ := cpuid(0x8000001a)
+ fs.setIf((eax>>0)&1 == 1, FP128)
+ fs.setIf((eax>>1)&1 == 1, MOVU)
+ fs.setIf((eax>>2)&1 == 1, FP256)
+ }
+
if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
eax, _, _, _ := cpuid(0x8000001b)
fs.setIf((eax>>0)&1 == 1, IBSFFV)
@@ -1042,6 +1370,35 @@ func support() flagSet {
fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT)
fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT)
fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
+ fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE)
+ fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX)
+ fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1.
+ fs.setIf((eax>>11)&1 == 1, IBS_ZEN4)
+ }
+
+ if maxExtendedFunction() >= 0x8000001f && vend == AMD {
+ a, _, _, _ := cpuid(0x8000001f)
+ fs.setIf((a>>0)&1 == 1, SME)
+ fs.setIf((a>>1)&1 == 1, SEV)
+ fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH)
+ fs.setIf((a>>3)&1 == 1, SEV_ES)
+ fs.setIf((a>>4)&1 == 1, SEV_SNP)
+ fs.setIf((a>>5)&1 == 1, VMPL)
+ fs.setIf((a>>10)&1 == 1, SME_COHERENT)
+ fs.setIf((a>>11)&1 == 1, SEV_64BIT)
+ fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED)
+ fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE)
+ fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP)
+ fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST)
+ fs.setIf((a>>16)&1 == 1, VTE)
+ fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
+ }
+
+ if mfi >= 0x21 {
+ // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
+ _, ebx, ecx, edx := cpuid(0x21)
+ identity := string(valAsString(ebx, edx, ecx))
+ fs.setIf(identity == "IntelTDX ", TDX_GUEST)
}
return fs
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
index 9bf9f77f3..9a53504a0 100644
--- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
+++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go
@@ -1,6 +1,7 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-//+build arm64,!gccgo,!noasm,!appengine
+//go:build arm64 && !gccgo && !noasm && !appengine
+// +build arm64,!gccgo,!noasm,!appengine
package cpuid
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go
index e9c8606ab..9636c2bc1 100644
--- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go
+++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go
@@ -1,6 +1,7 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-//+build !amd64,!386,!arm64 gccgo noasm appengine
+//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
+// +build !amd64,!386,!arm64 gccgo noasm appengine
package cpuid
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
index 367c35c88..c946824ec 100644
--- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
+++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
@@ -1,6 +1,7 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
-//+build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
+//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
+// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
package cpuid
@@ -23,7 +24,7 @@ func addInfo(c *CPUInfo, safe bool) {
c.maxExFunc = maxExtendedFunction()
c.BrandName = brandName()
c.CacheLine = cacheLine()
- c.Family, c.Model = familyModel()
+ c.Family, c.Model, c.Stepping = familyModel()
c.featureSet = support()
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
c.ThreadsPerCore = threadsPerCore()
diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
index b1fe42e46..024c706af 100644
--- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
+++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
@@ -13,126 +13,213 @@ func _() {
_ = x[AMD3DNOW-3]
_ = x[AMD3DNOWEXT-4]
_ = x[AMXBF16-5]
- _ = x[AMXINT8-6]
- _ = x[AMXTILE-7]
- _ = x[AVX-8]
- _ = x[AVX2-9]
- _ = x[AVX512BF16-10]
- _ = x[AVX512BITALG-11]
- _ = x[AVX512BW-12]
- _ = x[AVX512CD-13]
- _ = x[AVX512DQ-14]
- _ = x[AVX512ER-15]
- _ = x[AVX512F-16]
- _ = x[AVX512FP16-17]
- _ = x[AVX512IFMA-18]
- _ = x[AVX512PF-19]
- _ = x[AVX512VBMI-20]
- _ = x[AVX512VBMI2-21]
- _ = x[AVX512VL-22]
- _ = x[AVX512VNNI-23]
- _ = x[AVX512VP2INTERSECT-24]
- _ = x[AVX512VPOPCNTDQ-25]
- _ = x[AVXSLOW-26]
- _ = x[BMI1-27]
- _ = x[BMI2-28]
- _ = x[CLDEMOTE-29]
- _ = x[CLMUL-30]
- _ = x[CLZERO-31]
- _ = x[CMOV-32]
- _ = x[CPBOOST-33]
- _ = x[CX16-34]
- _ = x[ENQCMD-35]
- _ = x[ERMS-36]
- _ = x[F16C-37]
- _ = x[FMA3-38]
- _ = x[FMA4-39]
- _ = x[GFNI-40]
- _ = x[HLE-41]
- _ = x[HTT-42]
- _ = x[HWA-43]
- _ = x[HYPERVISOR-44]
- _ = x[IBPB-45]
- _ = x[IBS-46]
- _ = x[IBSBRNTRGT-47]
- _ = x[IBSFETCHSAM-48]
- _ = x[IBSFFV-49]
- _ = x[IBSOPCNT-50]
- _ = x[IBSOPCNTEXT-51]
- _ = x[IBSOPSAM-52]
- _ = x[IBSRDWROPCNT-53]
- _ = x[IBSRIPINVALIDCHK-54]
- _ = x[INT_WBINVD-55]
- _ = x[INVLPGB-56]
- _ = x[LZCNT-57]
- _ = x[MCAOVERFLOW-58]
- _ = x[MCOMMIT-59]
- _ = x[MMX-60]
- _ = x[MMXEXT-61]
- _ = x[MOVDIR64B-62]
- _ = x[MOVDIRI-63]
- _ = x[MPX-64]
- _ = x[MSRIRC-65]
- _ = x[NX-66]
- _ = x[POPCNT-67]
- _ = x[RDPRU-68]
- _ = x[RDRAND-69]
- _ = x[RDSEED-70]
- _ = x[RDTSCP-71]
- _ = x[RTM-72]
- _ = x[RTM_ALWAYS_ABORT-73]
- _ = x[SERIALIZE-74]
- _ = x[SGX-75]
- _ = x[SGXLC-76]
- _ = x[SHA-77]
- _ = x[SSE-78]
- _ = x[SSE2-79]
- _ = x[SSE3-80]
- _ = x[SSE4-81]
- _ = x[SSE42-82]
- _ = x[SSE4A-83]
- _ = x[SSSE3-84]
- _ = x[STIBP-85]
- _ = x[SUCCOR-86]
- _ = x[TBM-87]
- _ = x[TSXLDTRK-88]
- _ = x[VAES-89]
- _ = x[VMX-90]
- _ = x[VPCLMULQDQ-91]
- _ = x[WAITPKG-92]
- _ = x[WBNOINVD-93]
- _ = x[XOP-94]
- _ = x[AESARM-95]
- _ = x[ARMCPUID-96]
- _ = x[ASIMD-97]
- _ = x[ASIMDDP-98]
- _ = x[ASIMDHP-99]
- _ = x[ASIMDRDM-100]
- _ = x[ATOMICS-101]
- _ = x[CRC32-102]
- _ = x[DCPOP-103]
- _ = x[EVTSTRM-104]
- _ = x[FCMA-105]
- _ = x[FP-106]
- _ = x[FPHP-107]
- _ = x[GPA-108]
- _ = x[JSCVT-109]
- _ = x[LRCPC-110]
- _ = x[PMULL-111]
- _ = x[SHA1-112]
- _ = x[SHA2-113]
- _ = x[SHA3-114]
- _ = x[SHA512-115]
- _ = x[SM3-116]
- _ = x[SM4-117]
- _ = x[SVE-118]
- _ = x[lastID-119]
+ _ = x[AMXFP16-6]
+ _ = x[AMXINT8-7]
+ _ = x[AMXTILE-8]
+ _ = x[AVX-9]
+ _ = x[AVX2-10]
+ _ = x[AVX512BF16-11]
+ _ = x[AVX512BITALG-12]
+ _ = x[AVX512BW-13]
+ _ = x[AVX512CD-14]
+ _ = x[AVX512DQ-15]
+ _ = x[AVX512ER-16]
+ _ = x[AVX512F-17]
+ _ = x[AVX512FP16-18]
+ _ = x[AVX512IFMA-19]
+ _ = x[AVX512PF-20]
+ _ = x[AVX512VBMI-21]
+ _ = x[AVX512VBMI2-22]
+ _ = x[AVX512VL-23]
+ _ = x[AVX512VNNI-24]
+ _ = x[AVX512VP2INTERSECT-25]
+ _ = x[AVX512VPOPCNTDQ-26]
+ _ = x[AVXIFMA-27]
+ _ = x[AVXNECONVERT-28]
+ _ = x[AVXSLOW-29]
+ _ = x[AVXVNNI-30]
+ _ = x[AVXVNNIINT8-31]
+ _ = x[BHI_CTRL-32]
+ _ = x[BMI1-33]
+ _ = x[BMI2-34]
+ _ = x[CETIBT-35]
+ _ = x[CETSS-36]
+ _ = x[CLDEMOTE-37]
+ _ = x[CLMUL-38]
+ _ = x[CLZERO-39]
+ _ = x[CMOV-40]
+ _ = x[CMPCCXADD-41]
+ _ = x[CMPSB_SCADBS_SHORT-42]
+ _ = x[CMPXCHG8-43]
+ _ = x[CPBOOST-44]
+ _ = x[CPPC-45]
+ _ = x[CX16-46]
+ _ = x[EFER_LMSLE_UNS-47]
+ _ = x[ENQCMD-48]
+ _ = x[ERMS-49]
+ _ = x[F16C-50]
+ _ = x[FLUSH_L1D-51]
+ _ = x[FMA3-52]
+ _ = x[FMA4-53]
+ _ = x[FP128-54]
+ _ = x[FP256-55]
+ _ = x[FSRM-56]
+ _ = x[FXSR-57]
+ _ = x[FXSROPT-58]
+ _ = x[GFNI-59]
+ _ = x[HLE-60]
+ _ = x[HRESET-61]
+ _ = x[HTT-62]
+ _ = x[HWA-63]
+ _ = x[HYBRID_CPU-64]
+ _ = x[HYPERVISOR-65]
+ _ = x[IA32_ARCH_CAP-66]
+ _ = x[IA32_CORE_CAP-67]
+ _ = x[IBPB-68]
+ _ = x[IBRS-69]
+ _ = x[IBRS_PREFERRED-70]
+ _ = x[IBRS_PROVIDES_SMP-71]
+ _ = x[IBS-72]
+ _ = x[IBSBRNTRGT-73]
+ _ = x[IBSFETCHSAM-74]
+ _ = x[IBSFFV-75]
+ _ = x[IBSOPCNT-76]
+ _ = x[IBSOPCNTEXT-77]
+ _ = x[IBSOPSAM-78]
+ _ = x[IBSRDWROPCNT-79]
+ _ = x[IBSRIPINVALIDCHK-80]
+ _ = x[IBS_FETCH_CTLX-81]
+ _ = x[IBS_OPDATA4-82]
+ _ = x[IBS_OPFUSE-83]
+ _ = x[IBS_PREVENTHOST-84]
+ _ = x[IBS_ZEN4-85]
+ _ = x[IDPRED_CTRL-86]
+ _ = x[INT_WBINVD-87]
+ _ = x[INVLPGB-88]
+ _ = x[LAHF-89]
+ _ = x[LAM-90]
+ _ = x[LBRVIRT-91]
+ _ = x[LZCNT-92]
+ _ = x[MCAOVERFLOW-93]
+ _ = x[MCDT_NO-94]
+ _ = x[MCOMMIT-95]
+ _ = x[MD_CLEAR-96]
+ _ = x[MMX-97]
+ _ = x[MMXEXT-98]
+ _ = x[MOVBE-99]
+ _ = x[MOVDIR64B-100]
+ _ = x[MOVDIRI-101]
+ _ = x[MOVSB_ZL-102]
+ _ = x[MOVU-103]
+ _ = x[MPX-104]
+ _ = x[MSRIRC-105]
+ _ = x[MSRLIST-106]
+ _ = x[MSR_PAGEFLUSH-107]
+ _ = x[NRIPS-108]
+ _ = x[NX-109]
+ _ = x[OSXSAVE-110]
+ _ = x[PCONFIG-111]
+ _ = x[POPCNT-112]
+ _ = x[PPIN-113]
+ _ = x[PREFETCHI-114]
+ _ = x[PSFD-115]
+ _ = x[RDPRU-116]
+ _ = x[RDRAND-117]
+ _ = x[RDSEED-118]
+ _ = x[RDTSCP-119]
+ _ = x[RRSBA_CTRL-120]
+ _ = x[RTM-121]
+ _ = x[RTM_ALWAYS_ABORT-122]
+ _ = x[SERIALIZE-123]
+ _ = x[SEV-124]
+ _ = x[SEV_64BIT-125]
+ _ = x[SEV_ALTERNATIVE-126]
+ _ = x[SEV_DEBUGSWAP-127]
+ _ = x[SEV_ES-128]
+ _ = x[SEV_RESTRICTED-129]
+ _ = x[SEV_SNP-130]
+ _ = x[SGX-131]
+ _ = x[SGXLC-132]
+ _ = x[SHA-133]
+ _ = x[SME-134]
+ _ = x[SME_COHERENT-135]
+ _ = x[SPEC_CTRL_SSBD-136]
+ _ = x[SRBDS_CTRL-137]
+ _ = x[SSE-138]
+ _ = x[SSE2-139]
+ _ = x[SSE3-140]
+ _ = x[SSE4-141]
+ _ = x[SSE42-142]
+ _ = x[SSE4A-143]
+ _ = x[SSSE3-144]
+ _ = x[STIBP-145]
+ _ = x[STIBP_ALWAYSON-146]
+ _ = x[STOSB_SHORT-147]
+ _ = x[SUCCOR-148]
+ _ = x[SVM-149]
+ _ = x[SVMDA-150]
+ _ = x[SVMFBASID-151]
+ _ = x[SVML-152]
+ _ = x[SVMNP-153]
+ _ = x[SVMPF-154]
+ _ = x[SVMPFT-155]
+ _ = x[SYSCALL-156]
+ _ = x[SYSEE-157]
+ _ = x[TBM-158]
+ _ = x[TDX_GUEST-159]
+ _ = x[TLB_FLUSH_NESTED-160]
+ _ = x[TME-161]
+ _ = x[TOPEXT-162]
+ _ = x[TSCRATEMSR-163]
+ _ = x[TSXLDTRK-164]
+ _ = x[VAES-165]
+ _ = x[VMCBCLEAN-166]
+ _ = x[VMPL-167]
+ _ = x[VMSA_REGPROT-168]
+ _ = x[VMX-169]
+ _ = x[VPCLMULQDQ-170]
+ _ = x[VTE-171]
+ _ = x[WAITPKG-172]
+ _ = x[WBNOINVD-173]
+ _ = x[WRMSRNS-174]
+ _ = x[X87-175]
+ _ = x[XGETBV1-176]
+ _ = x[XOP-177]
+ _ = x[XSAVE-178]
+ _ = x[XSAVEC-179]
+ _ = x[XSAVEOPT-180]
+ _ = x[XSAVES-181]
+ _ = x[AESARM-182]
+ _ = x[ARMCPUID-183]
+ _ = x[ASIMD-184]
+ _ = x[ASIMDDP-185]
+ _ = x[ASIMDHP-186]
+ _ = x[ASIMDRDM-187]
+ _ = x[ATOMICS-188]
+ _ = x[CRC32-189]
+ _ = x[DCPOP-190]
+ _ = x[EVTSTRM-191]
+ _ = x[FCMA-192]
+ _ = x[FP-193]
+ _ = x[FPHP-194]
+ _ = x[GPA-195]
+ _ = x[JSCVT-196]
+ _ = x[LRCPC-197]
+ _ = x[PMULL-198]
+ _ = x[SHA1-199]
+ _ = x[SHA2-200]
+ _ = x[SHA3-201]
+ _ = x[SHA512-202]
+ _ = x[SM3-203]
+ _ = x[SM4-204]
+ _ = x[SVE-205]
+ _ = x[lastID-206]
_ = x[firstID-0]
}
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CLDEMOTECLMULCLZEROCMOVCPBOOSTCX16ENQCMDERMSF16CFMA3FMA4GFNIHLEHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKINT_WBINVDINVLPGBLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVDIR64BMOVDIRIMPXMSRIRCNXPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSUCCORTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDXOPAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
+const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 234, 238, 246, 251, 257, 261, 268, 272, 278, 282, 286, 290, 294, 298, 301, 304, 307, 317, 321, 324, 334, 345, 351, 359, 370, 378, 390, 406, 416, 423, 428, 439, 446, 449, 455, 464, 471, 474, 480, 482, 488, 493, 499, 505, 511, 514, 530, 539, 542, 547, 550, 553, 557, 561, 565, 570, 575, 580, 585, 591, 594, 602, 606, 609, 619, 626, 634, 637, 643, 651, 656, 663, 670, 678, 685, 690, 695, 702, 706, 708, 712, 715, 720, 725, 730, 734, 738, 742, 748, 751, 754, 757, 763}
+var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
index 8d2cb0368..84b1acd21 100644
--- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
+++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go
@@ -2,18 +2,120 @@
package cpuid
-import "runtime"
+import (
+ "runtime"
+ "strings"
+
+ "golang.org/x/sys/unix"
+)
func detectOS(c *CPUInfo) bool {
+ if runtime.GOOS != "ios" {
+ tryToFillCPUInfoFomSysctl(c)
+ }
// There are no hw.optional sysctl values for the below features on Mac OS 11.0
// to detect their supported state dynamically. Assume the CPU features that
// Apple Silicon M1 supports to be available as a minimal set of features
// to all Go programs running on darwin/arm64.
// TODO: Add more if we know them.
c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
- c.PhysicalCores = runtime.NumCPU()
- // For now assuming 1 thread per core...
- c.ThreadsPerCore = 1
- c.LogicalCores = c.PhysicalCores
+
return true
}
+
+func sysctlGetBool(name string) bool {
+ value, err := unix.SysctlUint32(name)
+ if err != nil {
+ return false
+ }
+ return value != 0
+}
+
+func sysctlGetString(name string) string {
+ value, err := unix.Sysctl(name)
+ if err != nil {
+ return ""
+ }
+ return value
+}
+
+func sysctlGetInt(unknown int, names ...string) int {
+ for _, name := range names {
+ value, err := unix.SysctlUint32(name)
+ if err != nil {
+ continue
+ }
+ if value != 0 {
+ return int(value)
+ }
+ }
+ return unknown
+}
+
+func sysctlGetInt64(unknown int, names ...string) int {
+ for _, name := range names {
+ value64, err := unix.SysctlUint64(name)
+ if err != nil {
+ continue
+ }
+ if int(value64) != unknown {
+ return int(value64)
+ }
+ }
+ return unknown
+}
+
+func setFeature(c *CPUInfo, name string, feature FeatureID) {
+ c.featureSet.setIf(sysctlGetBool(name), feature)
+}
+func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
+ c.BrandName = sysctlGetString("machdep.cpu.brand_string")
+
+ if len(c.BrandName) != 0 {
+ c.VendorString = strings.Fields(c.BrandName)[0]
+ }
+
+ c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
+ c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
+ sysctlGetInt(1, "hw.physicalcpu")
+ c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
+ c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
+ c.Model = sysctlGetInt(0, "machdep.cpu.model")
+ c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
+ c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
+ c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
+ c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
+ c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
+
+ // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile
+ setFeature(c, "hw.optional.arm.FEAT_AES", AESARM)
+ setFeature(c, "hw.optional.AdvSIMD", ASIMD)
+ setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP)
+ setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM)
+ setFeature(c, "hw.optional.FEAT_CRC32", CRC32)
+ setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
+ // setFeature(c, "", EVTSTRM)
+ setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
+ setFeature(c, "hw.optional.arm.FEAT_FP", FP)
+ setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
+ setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
+ setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
+ setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
+ setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
+ setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1)
+ setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
+ setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
+ setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
+ // setFeature(c, "", SM3)
+ // setFeature(c, "", SM4)
+ setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
+
+ // from empirical observation
+ setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP)
+ setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS)
+ setFeature(c, "hw.optional.floatingpoint", FP)
+ setFeature(c, "hw.optional.armv8_2_sha3", SHA3)
+ setFeature(c, "hw.optional.armv8_2_sha512", SHA512)
+ setFeature(c, "hw.optional.armv8_3_compnum", FCMA)
+ setFeature(c, "hw.optional.armv8_crc32", CRC32)
+}
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go
index 1a951e6ca..8733ba343 100644
--- a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go
+++ b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go
@@ -1,8 +1,7 @@
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
-// +build arm64
-// +build !linux
-// +build !darwin
+//go:build arm64 && !linux && !darwin
+// +build arm64,!linux,!darwin
package cpuid
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go
index 4d0b8b465..f8f201b5f 100644
--- a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go
+++ b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go
@@ -1,6 +1,7 @@
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
-//+build nounsafe
+//go:build nounsafe
+// +build nounsafe
package cpuid
diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go
index 329800286..92af622eb 100644
--- a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go
+++ b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go
@@ -1,6 +1,7 @@
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
-//+build !nounsafe
+//go:build !nounsafe
+// +build !nounsafe
package cpuid
diff --git a/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go b/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go
index 2a9f2dc3b..4f7b42488 100644
--- a/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go
+++ b/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go
@@ -1313,17 +1313,17 @@ func (dmp *DiffMatchPatch) diffLinesToStrings(text1, text2 string) (string, stri
// '\x00' is a valid character, but various debuggers don't like it. So we'll insert a junk entry to avoid generating a null character.
lineArray := []string{""} // e.g. lineArray[4] == 'Hello\n'
+ lineHash := make(map[string]int)
//Each string has the index of lineArray which it points to
- strIndexArray1 := dmp.diffLinesToStringsMunge(text1, &lineArray)
- strIndexArray2 := dmp.diffLinesToStringsMunge(text2, &lineArray)
+ strIndexArray1 := dmp.diffLinesToStringsMunge(text1, &lineArray, lineHash)
+ strIndexArray2 := dmp.diffLinesToStringsMunge(text2, &lineArray, lineHash)
return intArrayToString(strIndexArray1), intArrayToString(strIndexArray2), lineArray
}
// diffLinesToStringsMunge splits a text into an array of strings, and reduces the texts to a []string.
-func (dmp *DiffMatchPatch) diffLinesToStringsMunge(text string, lineArray *[]string) []uint32 {
+func (dmp *DiffMatchPatch) diffLinesToStringsMunge(text string, lineArray *[]string, lineHash map[string]int) []uint32 {
// Walk the text, pulling out a substring for each line. text.split('\n') would would temporarily double our memory footprint. Modifying text would create many large strings to garbage collect.
- lineHash := map[string]int{} // e.g. lineHash['Hello\n'] == 4
lineStart := 0
lineEnd := -1
strs := []uint32{}
diff --git a/vendor/github.com/spf13/pflag/flag.go b/vendor/github.com/spf13/pflag/flag.go
index eeed1e92b..2fd3c5759 100644
--- a/vendor/github.com/spf13/pflag/flag.go
+++ b/vendor/github.com/spf13/pflag/flag.go
@@ -143,8 +143,9 @@ type ParseErrorsAllowlist struct {
UnknownFlags bool
}
-// DEPRECATED: please use ParseErrorsAllowlist instead
-// This type will be removed in a future release
+// ParseErrorsWhitelist defines the parsing errors that can be ignored.
+//
+// Deprecated: use [ParseErrorsAllowlist] instead. This type will be removed in a future release.
type ParseErrorsWhitelist = ParseErrorsAllowlist
// NormalizedName is a flag name that has been normalized according to rules
@@ -165,8 +166,9 @@ type FlagSet struct {
// ParseErrorsAllowlist is used to configure an allowlist of errors
ParseErrorsAllowlist ParseErrorsAllowlist
- // DEPRECATED: please use ParseErrorsAllowlist instead
- // This field will be removed in a future release
+ // ParseErrorsAllowlist is used to configure an allowlist of errors.
+ //
+ // Deprecated: use [FlagSet.ParseErrorsAllowlist] instead. This field will be removed in a future release.
ParseErrorsWhitelist ParseErrorsAllowlist
name string
@@ -1185,7 +1187,7 @@ func (f *FlagSet) Parse(arguments []string) error {
case ContinueOnError:
return err
case ExitOnError:
- if errors.Is(err, ErrHelp) {
+ if err == ErrHelp {
os.Exit(0)
}
fmt.Fprintln(f.Output(), err)
@@ -1214,7 +1216,7 @@ func (f *FlagSet) ParseAll(arguments []string, fn func(flag *Flag, value string)
case ContinueOnError:
return err
case ExitOnError:
- if errors.Is(err, ErrHelp) {
+ if err == ErrHelp {
os.Exit(0)
}
fmt.Fprintln(f.Output(), err)
diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go
index 9e87fb4bb..296407f38 100644
--- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go
+++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go
@@ -9,18 +9,12 @@ import (
"go.opentelemetry.io/otel"
"go.opentelemetry.io/otel/attribute"
"go.opentelemetry.io/otel/metric"
- "go.opentelemetry.io/otel/metric/noop"
"go.opentelemetry.io/otel/propagation"
- semconv "go.opentelemetry.io/otel/semconv/v1.17.0"
"go.opentelemetry.io/otel/trace"
)
-const (
- // ScopeName is the instrumentation scope name.
- ScopeName = "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc"
- // GRPCStatusCodeKey is convention for numeric status code of a gRPC request.
- GRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code")
-)
+// ScopeName is the instrumentation scope name.
+const ScopeName = "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc"
// InterceptorFilter is a predicate used to determine whether a given request in
// interceptor info should be instrumented. A InterceptorFilter must return true if
@@ -47,15 +41,6 @@ type config struct {
ReceivedEvent bool
SentEvent bool
-
- tracer trace.Tracer
- meter metric.Meter
-
- rpcDuration metric.Float64Histogram
- rpcInBytes metric.Int64Histogram
- rpcOutBytes metric.Int64Histogram
- rpcInMessages metric.Int64Histogram
- rpcOutMessages metric.Int64Histogram
}
// Option applies an option value for a config.
@@ -64,7 +49,7 @@ type Option interface {
}
// newConfig returns a config configured with all the passed Options.
-func newConfig(opts []Option, role string) *config {
+func newConfig(opts []Option) *config {
c := &config{
Propagators: otel.GetTextMapPropagator(),
TracerProvider: otel.GetTracerProvider(),
@@ -73,87 +58,6 @@ func newConfig(opts []Option, role string) *config {
for _, o := range opts {
o.apply(c)
}
-
- c.tracer = c.TracerProvider.Tracer(
- ScopeName,
- trace.WithInstrumentationVersion(SemVersion()),
- )
-
- c.meter = c.MeterProvider.Meter(
- ScopeName,
- metric.WithInstrumentationVersion(Version()),
- metric.WithSchemaURL(semconv.SchemaURL),
- )
-
- var err error
- c.rpcDuration, err = c.meter.Float64Histogram("rpc."+role+".duration",
- metric.WithDescription("Measures the duration of inbound RPC."),
- metric.WithUnit("ms"))
- if err != nil {
- otel.Handle(err)
- if c.rpcDuration == nil {
- c.rpcDuration = noop.Float64Histogram{}
- }
- }
-
- rpcRequestSize, err := c.meter.Int64Histogram("rpc."+role+".request.size",
- metric.WithDescription("Measures size of RPC request messages (uncompressed)."),
- metric.WithUnit("By"))
- if err != nil {
- otel.Handle(err)
- if rpcRequestSize == nil {
- rpcRequestSize = noop.Int64Histogram{}
- }
- }
-
- rpcResponseSize, err := c.meter.Int64Histogram("rpc."+role+".response.size",
- metric.WithDescription("Measures size of RPC response messages (uncompressed)."),
- metric.WithUnit("By"))
- if err != nil {
- otel.Handle(err)
- if rpcResponseSize == nil {
- rpcResponseSize = noop.Int64Histogram{}
- }
- }
-
- rpcRequestsPerRPC, err := c.meter.Int64Histogram("rpc."+role+".requests_per_rpc",
- metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."),
- metric.WithUnit("{count}"))
- if err != nil {
- otel.Handle(err)
- if rpcRequestsPerRPC == nil {
- rpcRequestsPerRPC = noop.Int64Histogram{}
- }
- }
-
- rpcResponsesPerRPC, err := c.meter.Int64Histogram("rpc."+role+".responses_per_rpc",
- metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."),
- metric.WithUnit("{count}"))
- if err != nil {
- otel.Handle(err)
- if rpcResponsesPerRPC == nil {
- rpcResponsesPerRPC = noop.Int64Histogram{}
- }
- }
-
- switch role {
- case "client":
- c.rpcInBytes = rpcResponseSize
- c.rpcInMessages = rpcResponsesPerRPC
- c.rpcOutBytes = rpcRequestSize
- c.rpcOutMessages = rpcRequestsPerRPC
- case "server":
- c.rpcInBytes = rpcRequestSize
- c.rpcInMessages = rpcRequestsPerRPC
- c.rpcOutBytes = rpcResponseSize
- c.rpcOutMessages = rpcResponsesPerRPC
- default:
- c.rpcInBytes = noop.Int64Histogram{}
- c.rpcInMessages = noop.Int64Histogram{}
- c.rpcOutBytes = noop.Int64Histogram{}
- c.rpcOutMessages = noop.Int64Histogram{}
- }
-
return c
}
diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go
index 7d5ed0580..f63513d45 100644
--- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go
+++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go
@@ -11,7 +11,6 @@ import (
"io"
"net"
"strconv"
- "time"
"google.golang.org/grpc"
grpc_codes "google.golang.org/grpc/codes"
@@ -23,8 +22,7 @@ import (
"go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal"
"go.opentelemetry.io/otel/attribute"
"go.opentelemetry.io/otel/codes"
- "go.opentelemetry.io/otel/metric"
- semconv "go.opentelemetry.io/otel/semconv/v1.17.0"
+ semconv "go.opentelemetry.io/otel/semconv/v1.30.0"
"go.opentelemetry.io/otel/trace"
)
@@ -39,82 +37,15 @@ func (m messageType) Event(ctx context.Context, id int, _ interface{}) {
}
span.AddEvent("message", trace.WithAttributes(
attribute.KeyValue(m),
- RPCMessageIDKey.Int(id),
+ semconv.RPCMessageIDKey.Int(id),
))
}
var (
- messageSent = messageType(RPCMessageTypeSent)
- messageReceived = messageType(RPCMessageTypeReceived)
+ messageSent = messageType(semconv.RPCMessageTypeSent)
+ messageReceived = messageType(semconv.RPCMessageTypeReceived)
)
-// UnaryClientInterceptor returns a grpc.UnaryClientInterceptor suitable
-// for use in a grpc.NewClient call.
-//
-// Deprecated: Use [NewClientHandler] instead.
-func UnaryClientInterceptor(opts ...Option) grpc.UnaryClientInterceptor {
- cfg := newConfig(opts, "client")
- tracer := cfg.TracerProvider.Tracer(
- ScopeName,
- trace.WithInstrumentationVersion(Version()),
- )
-
- return func(
- ctx context.Context,
- method string,
- req, reply interface{},
- cc *grpc.ClientConn,
- invoker grpc.UnaryInvoker,
- callOpts ...grpc.CallOption,
- ) error {
- i := &InterceptorInfo{
- Method: method,
- Type: UnaryClient,
- }
- if cfg.InterceptorFilter != nil && !cfg.InterceptorFilter(i) {
- return invoker(ctx, method, req, reply, cc, callOpts...)
- }
-
- name, attr, _ := telemetryAttributes(method, cc.Target())
-
- startOpts := append([]trace.SpanStartOption{
- trace.WithSpanKind(trace.SpanKindClient),
- trace.WithAttributes(attr...),
- },
- cfg.SpanStartOptions...,
- )
-
- ctx, span := tracer.Start(
- ctx,
- name,
- startOpts...,
- )
- defer span.End()
-
- ctx = inject(ctx, cfg.Propagators)
-
- if cfg.SentEvent {
- messageSent.Event(ctx, 1, req)
- }
-
- err := invoker(ctx, method, req, reply, cc, callOpts...)
-
- if cfg.ReceivedEvent {
- messageReceived.Event(ctx, 1, reply)
- }
-
- if err != nil {
- s, _ := status.FromError(err)
- span.SetStatus(codes.Error, s.Message())
- span.SetAttributes(statusCodeAttr(s.Code()))
- } else {
- span.SetAttributes(statusCodeAttr(grpc_codes.OK))
- }
-
- return err
- }
-}
-
// clientStream wraps around the embedded grpc.ClientStream, and intercepts the RecvMsg and
// SendMsg method call.
type clientStream struct {
@@ -213,7 +144,7 @@ func (w *clientStream) endSpan(err error) {
//
// Deprecated: Use [NewClientHandler] instead.
func StreamClientInterceptor(opts ...Option) grpc.StreamClientInterceptor {
- cfg := newConfig(opts, "client")
+ cfg := newConfig(opts)
tracer := cfg.TracerProvider.Tracer(
ScopeName,
trace.WithInstrumentationVersion(Version()),
@@ -235,7 +166,7 @@ func StreamClientInterceptor(opts ...Option) grpc.StreamClientInterceptor {
return streamer(ctx, desc, cc, method, callOpts...)
}
- name, attr, _ := telemetryAttributes(method, cc.Target())
+ name, attr := telemetryAttributes(method, cc.Target())
startOpts := append([]trace.SpanStartOption{
trace.WithSpanKind(trace.SpanKindClient),
@@ -265,81 +196,6 @@ func StreamClientInterceptor(opts ...Option) grpc.StreamClientInterceptor {
}
}
-// UnaryServerInterceptor returns a grpc.UnaryServerInterceptor suitable
-// for use in a grpc.NewServer call.
-//
-// Deprecated: Use [NewServerHandler] instead.
-func UnaryServerInterceptor(opts ...Option) grpc.UnaryServerInterceptor {
- cfg := newConfig(opts, "server")
- tracer := cfg.TracerProvider.Tracer(
- ScopeName,
- trace.WithInstrumentationVersion(Version()),
- )
-
- return func(
- ctx context.Context,
- req interface{},
- info *grpc.UnaryServerInfo,
- handler grpc.UnaryHandler,
- ) (interface{}, error) {
- i := &InterceptorInfo{
- UnaryServerInfo: info,
- Type: UnaryServer,
- }
- if cfg.InterceptorFilter != nil && !cfg.InterceptorFilter(i) {
- return handler(ctx, req)
- }
-
- ctx = extract(ctx, cfg.Propagators)
- name, attr, metricAttrs := telemetryAttributes(info.FullMethod, peerFromCtx(ctx))
-
- startOpts := append([]trace.SpanStartOption{
- trace.WithSpanKind(trace.SpanKindServer),
- trace.WithAttributes(attr...),
- },
- cfg.SpanStartOptions...,
- )
-
- ctx, span := tracer.Start(
- trace.ContextWithRemoteSpanContext(ctx, trace.SpanContextFromContext(ctx)),
- name,
- startOpts...,
- )
- defer span.End()
-
- if cfg.ReceivedEvent {
- messageReceived.Event(ctx, 1, req)
- }
-
- before := time.Now()
-
- resp, err := handler(ctx, req)
-
- s, _ := status.FromError(err)
- if err != nil {
- statusCode, msg := serverStatus(s)
- span.SetStatus(statusCode, msg)
- if cfg.SentEvent {
- messageSent.Event(ctx, 1, s.Proto())
- }
- } else {
- if cfg.SentEvent {
- messageSent.Event(ctx, 1, resp)
- }
- }
- grpcStatusCodeAttr := statusCodeAttr(s.Code())
- span.SetAttributes(grpcStatusCodeAttr)
-
- // Use floating point division here for higher precision (instead of Millisecond method).
- elapsedTime := float64(time.Since(before)) / float64(time.Millisecond)
-
- metricAttrs = append(metricAttrs, grpcStatusCodeAttr)
- cfg.rpcDuration.Record(ctx, elapsedTime, metric.WithAttributeSet(attribute.NewSet(metricAttrs...)))
-
- return resp, err
- }
-}
-
// serverStream wraps around the embedded grpc.ServerStream, and intercepts the RecvMsg and
// SendMsg method call.
type serverStream struct {
@@ -395,7 +251,7 @@ func wrapServerStream(ctx context.Context, ss grpc.ServerStream, cfg *config) *s
//
// Deprecated: Use [NewServerHandler] instead.
func StreamServerInterceptor(opts ...Option) grpc.StreamServerInterceptor {
- cfg := newConfig(opts, "server")
+ cfg := newConfig(opts)
tracer := cfg.TracerProvider.Tracer(
ScopeName,
trace.WithInstrumentationVersion(Version()),
@@ -417,7 +273,7 @@ func StreamServerInterceptor(opts ...Option) grpc.StreamServerInterceptor {
}
ctx = extract(ctx, cfg.Propagators)
- name, attr, _ := telemetryAttributes(info.FullMethod, peerFromCtx(ctx))
+ name, attr := telemetryAttributes(info.FullMethod, peerFromCtx(ctx))
startOpts := append([]trace.SpanStartOption{
trace.WithSpanKind(trace.SpanKindServer),
@@ -449,47 +305,32 @@ func StreamServerInterceptor(opts ...Option) grpc.StreamServerInterceptor {
// telemetryAttributes returns a span name and span and metric attributes from
// the gRPC method and peer address.
-func telemetryAttributes(fullMethod, peerAddress string) (string, []attribute.KeyValue, []attribute.KeyValue) {
+func telemetryAttributes(fullMethod, sererAddr string) (string, []attribute.KeyValue) {
name, methodAttrs := internal.ParseFullMethod(fullMethod)
- peerAttrs := peerAttr(peerAddress)
+ srvAttrs := serverAddrAttrs(sererAddr)
- attrs := make([]attribute.KeyValue, 0, 1+len(methodAttrs)+len(peerAttrs))
- attrs = append(attrs, RPCSystemGRPC)
+ attrs := make([]attribute.KeyValue, 0, 1+len(methodAttrs)+len(srvAttrs))
+ attrs = append(attrs, semconv.RPCSystemGRPC)
attrs = append(attrs, methodAttrs...)
- metricAttrs := attrs[:1+len(methodAttrs)]
- attrs = append(attrs, peerAttrs...)
- return name, attrs, metricAttrs
+ attrs = append(attrs, srvAttrs...)
+ return name, attrs
}
-// peerAttr returns attributes about the peer address.
-func peerAttr(addr string) []attribute.KeyValue {
- host, p, err := net.SplitHostPort(addr)
+// serverAddrAttrs returns the server address attributes for the hostport.
+func serverAddrAttrs(hostport string) []attribute.KeyValue {
+ h, pStr, err := net.SplitHostPort(hostport)
if err != nil {
- return nil
+ // The server.address attribute is required.
+ return []attribute.KeyValue{semconv.ServerAddress(hostport)}
}
-
- if host == "" {
- host = "127.0.0.1"
- }
- port, err := strconv.Atoi(p)
+ p, err := strconv.Atoi(pStr)
if err != nil {
- return nil
+ return []attribute.KeyValue{semconv.ServerAddress(h)}
}
-
- var attr []attribute.KeyValue
- if ip := net.ParseIP(host); ip != nil {
- attr = []attribute.KeyValue{
- semconv.NetSockPeerAddr(host),
- semconv.NetSockPeerPort(port),
- }
- } else {
- attr = []attribute.KeyValue{
- semconv.NetPeerName(host),
- semconv.NetPeerPort(port),
- }
+ return []attribute.KeyValue{
+ semconv.ServerAddress(h),
+ semconv.ServerPort(p),
}
-
- return attr
}
// peerFromCtx returns a peer address from a context, if one exists.
@@ -503,7 +344,7 @@ func peerFromCtx(ctx context.Context) string {
// statusCodeAttr returns status code attribute based on given gRPC code.
func statusCodeAttr(c grpc_codes.Code) attribute.KeyValue {
- return GRPCStatusCodeKey.Int64(int64(c))
+ return semconv.RPCGRPCStatusCodeKey.Int64(int64(c))
}
// serverStatus returns a span status code and message for a given gRPC
diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go
index bef07b7a3..1fa73c2f9 100644
--- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go
+++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go
@@ -1,13 +1,14 @@
// Copyright The OpenTelemetry Authors
// SPDX-License-Identifier: Apache-2.0
+// Package internal provides internal functionality for the otelgrpc package.
package internal // import "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal"
import (
"strings"
"go.opentelemetry.io/otel/attribute"
- semconv "go.opentelemetry.io/otel/semconv/v1.17.0"
+ semconv "go.opentelemetry.io/otel/semconv/v1.30.0"
)
// ParseFullMethod returns a span name following the OpenTelemetry semantic
diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go
index 3aa37915d..6e67f0216 100644
--- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go
+++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go
@@ -45,7 +45,7 @@ func (s *metadataSupplier) Keys() []string {
// requests.
// Deprecated: Unnecessary public func.
func Inject(ctx context.Context, md *metadata.MD, opts ...Option) {
- c := newConfig(opts, "")
+ c := newConfig(opts)
c.Propagators.Inject(ctx, &metadataSupplier{
metadata: md,
})
@@ -67,7 +67,7 @@ func inject(ctx context.Context, propagators propagation.TextMapPropagator) cont
// This function is meant to be used on incoming requests.
// Deprecated: Unnecessary public func.
func Extract(ctx context.Context, md *metadata.MD, opts ...Option) (baggage.Baggage, trace.SpanContext) {
- c := newConfig(opts, "")
+ c := newConfig(opts)
ctx = c.Propagators.Extract(ctx, &metadataSupplier{
metadata: md,
})
diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/semconv.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/semconv.go
deleted file mode 100644
index 409c621b7..000000000
--- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/semconv.go
+++ /dev/null
@@ -1,41 +0,0 @@
-// Copyright The OpenTelemetry Authors
-// SPDX-License-Identifier: Apache-2.0
-
-package otelgrpc // import "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc"
-
-import (
- "go.opentelemetry.io/otel/attribute"
- semconv "go.opentelemetry.io/otel/semconv/v1.17.0"
-)
-
-// Semantic conventions for attribute keys for gRPC.
-const (
- // Name of message transmitted or received.
- RPCNameKey = attribute.Key("name")
-
- // Type of message transmitted or received.
- RPCMessageTypeKey = attribute.Key("message.type")
-
- // Identifier of message transmitted or received.
- RPCMessageIDKey = attribute.Key("message.id")
-
- // The compressed size of the message transmitted or received in bytes.
- RPCMessageCompressedSizeKey = attribute.Key("message.compressed_size")
-
- // The uncompressed size of the message transmitted or received in
- // bytes.
- RPCMessageUncompressedSizeKey = attribute.Key("message.uncompressed_size")
-)
-
-// Semantic conventions for common RPC attributes.
-var (
- // Semantic convention for gRPC as the remoting system.
- RPCSystemGRPC = semconv.RPCSystemGRPC
-
- // Semantic convention for a message named message.
- RPCNameMessage = RPCNameKey.String("message")
-
- // Semantic conventions for RPC message types.
- RPCMessageTypeSent = RPCMessageTypeKey.String("SENT")
- RPCMessageTypeReceived = RPCMessageTypeKey.String("RECEIVED")
-)
diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go
index 216127d6f..9bec51df3 100644
--- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go
+++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go
@@ -13,10 +13,12 @@ import (
"google.golang.org/grpc/stats"
"google.golang.org/grpc/status"
+ "go.opentelemetry.io/otel"
"go.opentelemetry.io/otel/attribute"
"go.opentelemetry.io/otel/codes"
"go.opentelemetry.io/otel/metric"
- semconv "go.opentelemetry.io/otel/semconv/v1.17.0"
+ "go.opentelemetry.io/otel/metric/noop"
+ semconv "go.opentelemetry.io/otel/semconv/v1.30.0"
"go.opentelemetry.io/otel/trace"
"go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal"
@@ -33,12 +35,91 @@ type gRPCContext struct {
type serverHandler struct {
*config
+
+ tracer trace.Tracer
+
+ duration metric.Float64Histogram
+ inSize metric.Int64Histogram
+ outSize metric.Int64Histogram
+ inMsg metric.Int64Histogram
+ outMsg metric.Int64Histogram
}
// NewServerHandler creates a stats.Handler for a gRPC server.
func NewServerHandler(opts ...Option) stats.Handler {
- h := &serverHandler{
- config: newConfig(opts, "server"),
+ c := newConfig(opts)
+ h := &serverHandler{config: c}
+
+ h.tracer = c.TracerProvider.Tracer(
+ ScopeName,
+ trace.WithInstrumentationVersion(Version()),
+ )
+
+ meter := c.MeterProvider.Meter(
+ ScopeName,
+ metric.WithInstrumentationVersion(Version()),
+ metric.WithSchemaURL(semconv.SchemaURL),
+ )
+
+ var err error
+ h.duration, err = meter.Float64Histogram(
+ semconv.RPCServerDurationName,
+ metric.WithDescription(semconv.RPCServerDurationDescription),
+ metric.WithUnit(semconv.RPCServerDurationUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.duration == nil {
+ h.duration = noop.Float64Histogram{}
+ }
+ }
+
+ h.inSize, err = meter.Int64Histogram(
+ semconv.RPCServerRequestSizeName,
+ metric.WithDescription(semconv.RPCServerRequestSizeDescription),
+ metric.WithUnit(semconv.RPCServerRequestSizeUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.inSize == nil {
+ h.inSize = noop.Int64Histogram{}
+ }
+ }
+
+ h.outSize, err = meter.Int64Histogram(
+ semconv.RPCServerResponseSizeName,
+ metric.WithDescription(semconv.RPCServerResponseSizeDescription),
+ metric.WithUnit(semconv.RPCServerResponseSizeUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.outSize == nil {
+ h.outSize = noop.Int64Histogram{}
+ }
+ }
+
+ h.inMsg, err = meter.Int64Histogram(
+ semconv.RPCServerRequestsPerRPCName,
+ metric.WithDescription(semconv.RPCServerRequestsPerRPCDescription),
+ metric.WithUnit(semconv.RPCServerRequestsPerRPCUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.inMsg == nil {
+ h.inMsg = noop.Int64Histogram{}
+ }
+ }
+
+ h.outMsg, err = meter.Int64Histogram(
+ semconv.RPCServerResponsesPerRPCName,
+ metric.WithDescription(semconv.RPCServerResponsesPerRPCDescription),
+ metric.WithUnit(semconv.RPCServerResponsesPerRPCUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.outMsg == nil {
+ h.outMsg = noop.Int64Histogram{}
+ }
}
return h
@@ -55,14 +136,14 @@ func (h *serverHandler) HandleConn(ctx context.Context, info stats.ConnStats) {
// TagRPC can attach some information to the given context.
func (h *serverHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) context.Context {
- ctx = extract(ctx, h.config.Propagators)
+ ctx = extract(ctx, h.Propagators)
name, attrs := internal.ParseFullMethod(info.FullMethodName)
- attrs = append(attrs, RPCSystemGRPC)
+ attrs = append(attrs, semconv.RPCSystemGRPC)
record := true
- if h.config.Filter != nil {
- record = h.config.Filter(info)
+ if h.Filter != nil {
+ record = h.Filter(info)
}
if record {
@@ -70,12 +151,12 @@ func (h *serverHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) cont
trace.ContextWithRemoteSpanContext(ctx, trace.SpanContextFromContext(ctx)),
name,
trace.WithSpanKind(trace.SpanKindServer),
- trace.WithAttributes(append(attrs, h.config.SpanAttributes...)...),
+ trace.WithAttributes(append(attrs, h.SpanAttributes...)...),
)
}
gctx := gRPCContext{
- metricAttrs: append(attrs, h.config.MetricAttributes...),
+ metricAttrs: append(attrs, h.MetricAttributes...),
record: record,
}
@@ -84,18 +165,96 @@ func (h *serverHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) cont
// HandleRPC processes the RPC stats.
func (h *serverHandler) HandleRPC(ctx context.Context, rs stats.RPCStats) {
- isServer := true
- h.handleRPC(ctx, rs, isServer)
+ h.handleRPC(ctx, rs, h.duration, h.inSize, h.outSize, h.inMsg, h.outMsg, serverStatus)
}
type clientHandler struct {
*config
+
+ tracer trace.Tracer
+
+ duration metric.Float64Histogram
+ inSize metric.Int64Histogram
+ outSize metric.Int64Histogram
+ inMsg metric.Int64Histogram
+ outMsg metric.Int64Histogram
}
// NewClientHandler creates a stats.Handler for a gRPC client.
func NewClientHandler(opts ...Option) stats.Handler {
- h := &clientHandler{
- config: newConfig(opts, "client"),
+ c := newConfig(opts)
+ h := &clientHandler{config: c}
+
+ h.tracer = c.TracerProvider.Tracer(
+ ScopeName,
+ trace.WithInstrumentationVersion(Version()),
+ )
+
+ meter := c.MeterProvider.Meter(
+ ScopeName,
+ metric.WithInstrumentationVersion(Version()),
+ metric.WithSchemaURL(semconv.SchemaURL),
+ )
+
+ var err error
+ h.duration, err = meter.Float64Histogram(
+ semconv.RPCClientDurationName,
+ metric.WithDescription(semconv.RPCClientDurationDescription),
+ metric.WithUnit(semconv.RPCClientDurationUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.duration == nil {
+ h.duration = noop.Float64Histogram{}
+ }
+ }
+
+ h.outSize, err = meter.Int64Histogram(
+ semconv.RPCClientRequestSizeName,
+ metric.WithDescription(semconv.RPCClientRequestSizeDescription),
+ metric.WithUnit(semconv.RPCClientRequestSizeUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.outSize == nil {
+ h.outSize = noop.Int64Histogram{}
+ }
+ }
+
+ h.inSize, err = meter.Int64Histogram(
+ semconv.RPCClientResponseSizeName,
+ metric.WithDescription(semconv.RPCClientResponseSizeDescription),
+ metric.WithUnit(semconv.RPCClientResponseSizeUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.inSize == nil {
+ h.inSize = noop.Int64Histogram{}
+ }
+ }
+
+ h.outMsg, err = meter.Int64Histogram(
+ semconv.RPCClientRequestsPerRPCName,
+ metric.WithDescription(semconv.RPCClientRequestsPerRPCDescription),
+ metric.WithUnit(semconv.RPCClientRequestsPerRPCUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.outMsg == nil {
+ h.outMsg = noop.Int64Histogram{}
+ }
+ }
+
+ h.inMsg, err = meter.Int64Histogram(
+ semconv.RPCClientResponsesPerRPCName,
+ metric.WithDescription(semconv.RPCClientResponsesPerRPCDescription),
+ metric.WithUnit(semconv.RPCClientResponsesPerRPCUnit),
+ )
+ if err != nil {
+ otel.Handle(err)
+ if h.inMsg == nil {
+ h.inMsg = noop.Int64Histogram{}
+ }
}
return h
@@ -104,11 +263,11 @@ func NewClientHandler(opts ...Option) stats.Handler {
// TagRPC can attach some information to the given context.
func (h *clientHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) context.Context {
name, attrs := internal.ParseFullMethod(info.FullMethodName)
- attrs = append(attrs, RPCSystemGRPC)
+ attrs = append(attrs, semconv.RPCSystemGRPC)
record := true
- if h.config.Filter != nil {
- record = h.config.Filter(info)
+ if h.Filter != nil {
+ record = h.Filter(info)
}
if record {
@@ -116,22 +275,26 @@ func (h *clientHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) cont
ctx,
name,
trace.WithSpanKind(trace.SpanKindClient),
- trace.WithAttributes(append(attrs, h.config.SpanAttributes...)...),
+ trace.WithAttributes(append(attrs, h.SpanAttributes...)...),
)
}
gctx := gRPCContext{
- metricAttrs: append(attrs, h.config.MetricAttributes...),
+ metricAttrs: append(attrs, h.MetricAttributes...),
record: record,
}
- return inject(context.WithValue(ctx, gRPCContextKey{}, &gctx), h.config.Propagators)
+ return inject(context.WithValue(ctx, gRPCContextKey{}, &gctx), h.Propagators)
}
// HandleRPC processes the RPC stats.
func (h *clientHandler) HandleRPC(ctx context.Context, rs stats.RPCStats) {
- isServer := false
- h.handleRPC(ctx, rs, isServer)
+ h.handleRPC(
+ ctx, rs, h.duration, h.inSize, h.outSize, h.inMsg, h.outMsg,
+ func(s *status.Status) (codes.Code, string) {
+ return codes.Error, s.Message()
+ },
+ )
}
// TagConn can attach some information to the given context.
@@ -144,77 +307,86 @@ func (h *clientHandler) HandleConn(context.Context, stats.ConnStats) {
// no-op
}
-func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool) { // nolint: revive // isServer is not a control flag.
- span := trace.SpanFromContext(ctx)
- var metricAttrs []attribute.KeyValue
- var messageId int64
-
+func (c *config) handleRPC(
+ ctx context.Context,
+ rs stats.RPCStats,
+ duration metric.Float64Histogram,
+ inSize, outSize, inMsg, outMsg metric.Int64Histogram,
+ recordStatus func(*status.Status) (codes.Code, string),
+) {
gctx, _ := ctx.Value(gRPCContextKey{}).(*gRPCContext)
- if gctx != nil {
- if !gctx.record {
- return
- }
- metricAttrs = make([]attribute.KeyValue, 0, len(gctx.metricAttrs)+1)
- metricAttrs = append(metricAttrs, gctx.metricAttrs...)
+ if gctx != nil && !gctx.record {
+ return
}
+ span := trace.SpanFromContext(ctx)
+ var messageId int64
+
switch rs := rs.(type) {
case *stats.Begin:
case *stats.InPayload:
if gctx != nil {
messageId = atomic.AddInt64(&gctx.inMessages, 1)
- c.rpcInBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...)))
+ inSize.Record(ctx, int64(rs.Length), metric.WithAttributes(gctx.metricAttrs...))
}
- if c.ReceivedEvent {
+ if c.ReceivedEvent && span.IsRecording() {
span.AddEvent("message",
trace.WithAttributes(
- semconv.MessageTypeReceived,
- semconv.MessageIDKey.Int64(messageId),
- semconv.MessageCompressedSizeKey.Int(rs.CompressedLength),
- semconv.MessageUncompressedSizeKey.Int(rs.Length),
+ semconv.RPCMessageTypeReceived,
+ semconv.RPCMessageIDKey.Int64(messageId),
+ semconv.RPCMessageCompressedSizeKey.Int(rs.CompressedLength),
+ semconv.RPCMessageUncompressedSizeKey.Int(rs.Length),
),
)
}
case *stats.OutPayload:
if gctx != nil {
messageId = atomic.AddInt64(&gctx.outMessages, 1)
- c.rpcOutBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...)))
+ outSize.Record(ctx, int64(rs.Length), metric.WithAttributes(gctx.metricAttrs...))
}
- if c.SentEvent {
+ if c.SentEvent && span.IsRecording() {
span.AddEvent("message",
trace.WithAttributes(
- semconv.MessageTypeSent,
- semconv.MessageIDKey.Int64(messageId),
- semconv.MessageCompressedSizeKey.Int(rs.CompressedLength),
- semconv.MessageUncompressedSizeKey.Int(rs.Length),
+ semconv.RPCMessageTypeSent,
+ semconv.RPCMessageIDKey.Int64(messageId),
+ semconv.RPCMessageCompressedSizeKey.Int(rs.CompressedLength),
+ semconv.RPCMessageUncompressedSizeKey.Int(rs.Length),
),
)
}
case *stats.OutTrailer:
case *stats.OutHeader:
- if p, ok := peer.FromContext(ctx); ok {
- span.SetAttributes(peerAttr(p.Addr.String())...)
+ if span.IsRecording() {
+ if p, ok := peer.FromContext(ctx); ok {
+ span.SetAttributes(serverAddrAttrs(p.Addr.String())...)
+ }
}
case *stats.End:
var rpcStatusAttr attribute.KeyValue
+ var s *status.Status
if rs.Error != nil {
- s, _ := status.FromError(rs.Error)
- if isServer {
- statusCode, msg := serverStatus(s)
- span.SetStatus(statusCode, msg)
- } else {
- span.SetStatus(codes.Error, s.Message())
- }
+ s, _ = status.FromError(rs.Error)
rpcStatusAttr = semconv.RPCGRPCStatusCodeKey.Int(int(s.Code()))
} else {
rpcStatusAttr = semconv.RPCGRPCStatusCodeKey.Int(int(grpc_codes.OK))
}
- span.SetAttributes(rpcStatusAttr)
- span.End()
+ if span.IsRecording() {
+ if s != nil {
+ c, m := recordStatus(s)
+ span.SetStatus(c, m)
+ }
+ span.SetAttributes(rpcStatusAttr)
+ span.End()
+ }
+ var metricAttrs []attribute.KeyValue
+ if gctx != nil {
+ metricAttrs = make([]attribute.KeyValue, 0, len(gctx.metricAttrs)+1)
+ metricAttrs = append(metricAttrs, gctx.metricAttrs...)
+ }
metricAttrs = append(metricAttrs, rpcStatusAttr)
// Allocate vararg slice once.
recordOpts := []metric.RecordOption{metric.WithAttributeSet(attribute.NewSet(metricAttrs...))}
@@ -223,10 +395,10 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool
// Measure right before calling Record() to capture as much elapsed time as possible.
elapsedTime := float64(rs.EndTime.Sub(rs.BeginTime)) / float64(time.Millisecond)
- c.rpcDuration.Record(ctx, elapsedTime, recordOpts...)
+ duration.Record(ctx, elapsedTime, recordOpts...)
if gctx != nil {
- c.rpcInMessages.Record(ctx, atomic.LoadInt64(&gctx.inMessages), recordOpts...)
- c.rpcOutMessages.Record(ctx, atomic.LoadInt64(&gctx.outMessages), recordOpts...)
+ inMsg.Record(ctx, atomic.LoadInt64(&gctx.inMessages), recordOpts...)
+ outMsg.Record(ctx, atomic.LoadInt64(&gctx.outMessages), recordOpts...)
}
default:
return
diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go
index 442e8a838..b1feeca49 100644
--- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go
+++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go
@@ -5,13 +5,6 @@ package otelgrpc // import "go.opentelemetry.io/contrib/instrumentation/google.g
// Version is the current release version of the gRPC instrumentation.
func Version() string {
- return "0.60.0"
+ return "0.61.0"
// This string is updated by the pre_release.sh script during release
}
-
-// SemVersion is the semantic version to be supplied to tracer/meter creation.
-//
-// Deprecated: Use [Version] instead.
-func SemVersion() string {
- return Version()
-}
diff --git a/vendor/go.opentelemetry.io/otel/.clomonitor.yml b/vendor/go.opentelemetry.io/otel/.clomonitor.yml
new file mode 100644
index 000000000..128d61a22
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/.clomonitor.yml
@@ -0,0 +1,3 @@
+exemptions:
+ - check: artifacthub_badge
+ reason: "Artifact Hub doesn't support Go packages"
diff --git a/vendor/go.opentelemetry.io/otel/.golangci.yml b/vendor/go.opentelemetry.io/otel/.golangci.yml
index 888e5da80..5f69cc027 100644
--- a/vendor/go.opentelemetry.io/otel/.golangci.yml
+++ b/vendor/go.opentelemetry.io/otel/.golangci.yml
@@ -66,8 +66,6 @@ linters:
desc: Do not use cross-module internal packages.
- pkg: go.opentelemetry.io/otel/internal/internaltest
desc: Do not use cross-module internal packages.
- - pkg: go.opentelemetry.io/otel/internal/matchers
- desc: Do not use cross-module internal packages.
otlp-internal:
files:
- '!**/exporters/otlp/internal/**/*.go'
@@ -190,6 +188,10 @@ linters:
- legacy
- std-error-handling
rules:
+ - linters:
+ - revive
+ path: schema/v.*/types/.*
+ text: avoid meaningless package names
# TODO: Having appropriate comments for exported objects helps development,
# even for objects in internal packages. Appropriate comments for all
# exported objects should be added and this exclusion removed.
diff --git a/vendor/go.opentelemetry.io/otel/CHANGELOG.md b/vendor/go.opentelemetry.io/otel/CHANGELOG.md
index 648e4abab..4acc75701 100644
--- a/vendor/go.opentelemetry.io/otel/CHANGELOG.md
+++ b/vendor/go.opentelemetry.io/otel/CHANGELOG.md
@@ -11,6 +11,61 @@ This project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.htm
+## [1.37.0/0.59.0/0.13.0] 2025-06-25
+
+### Added
+
+- The `go.opentelemetry.io/otel/semconv/v1.33.0` package.
+ The package contains semantic conventions from the `v1.33.0` version of the OpenTelemetry Semantic Conventions.
+ See the [migration documentation](./semconv/v1.33.0/MIGRATION.md) for information on how to upgrade from `go.opentelemetry.io/otel/semconv/v1.32.0.`(#6799)
+- The `go.opentelemetry.io/otel/semconv/v1.34.0` package.
+ The package contains semantic conventions from the `v1.34.0` version of the OpenTelemetry Semantic Conventions. (#6812)
+- Add metric's schema URL as `otel_scope_schema_url` label in `go.opentelemetry.io/otel/exporters/prometheus`. (#5947)
+- Add metric's scope attributes as `otel_scope_[attribute]` labels in `go.opentelemetry.io/otel/exporters/prometheus`. (#5947)
+- Add `EventName` to `EnabledParameters` in `go.opentelemetry.io/otel/log`. (#6825)
+- Add `EventName` to `EnabledParameters` in `go.opentelemetry.io/otel/sdk/log`. (#6825)
+- Changed handling of `go.opentelemetry.io/otel/exporters/prometheus` metric renaming to add unit suffixes when it doesn't match one of the pre-defined values in the unit suffix map. (#6839)
+
+### Changed
+
+- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/bridge/opentracing`. (#6827)
+- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/exporters/zipkin`. (#6829)
+- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/metric`. (#6832)
+- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/sdk/resource`. (#6834)
+- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/sdk/trace`. (#6835)
+- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/trace`. (#6836)
+- `Record.Resource` now returns `*resource.Resource` instead of `resource.Resource` in `go.opentelemetry.io/otel/sdk/log`. (#6864)
+- Retry now shows error cause for context timeout in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp`, `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp`, `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp`. (#6898)
+
+### Fixed
+
+- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc`. (#6710)
+- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp`. (#6710)
+- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc`. (#6710)
+- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp`. (#6710)
+- Validate exponential histogram scale range for Prometheus compatibility in `go.opentelemetry.io/otel/exporters/prometheus`. (#6822)
+- Context cancellation during metric pipeline produce does not corrupt data in `go.opentelemetry.io/otel/sdk/metric`. (#6914)
+
+### Removed
+
+- `go.opentelemetry.io/otel/exporters/prometheus` no longer exports `otel_scope_info` metric. (#6770)
+
+## [0.12.2] 2025-05-22
+
+### Fixed
+
+- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc` module that contains invalid dependencies. (#6804)
+- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp` module that contains invalid dependencies. (#6804)
+- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/stdout/stdoutlog` module that contains invalid dependencies. (#6804)
+
+## [0.12.1] 2025-05-21
+
+### Fixes
+
+- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc`. (#6800)
+- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp`. (#6800)
+- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/stdout/stdoutlog`. (#6800)
+
## [1.36.0/0.58.0/0.12.0] 2025-05-20
### Added
@@ -3288,7 +3343,10 @@ It contains api and sdk for trace and meter.
- CircleCI build CI manifest files.
- CODEOWNERS file to track owners of this project.
-[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.36.0...HEAD
+[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.37.0...HEAD
+[1.37.0/0.59.0/0.13.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.37.0
+[0.12.2]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/log/v0.12.2
+[0.12.1]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/log/v0.12.1
[1.36.0/0.58.0/0.12.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.36.0
[1.35.0/0.57.0/0.11.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.35.0
[1.34.0/0.56.0/0.10.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.34.0
diff --git a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md
index 1902dac05..f9ddc281f 100644
--- a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md
+++ b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md
@@ -109,10 +109,9 @@ A PR is considered **ready to merge** when:
This is not enforced through automation, but needs to be validated by the
maintainer merging.
- * The qualified approvals need to be from [Approver]s/[Maintainer]s
- affiliated with different companies. Two qualified approvals from
- [Approver]s or [Maintainer]s affiliated with the same company counts as a
- single qualified approval.
+ * At least one of the qualified approvals need to be from an
+ [Approver]/[Maintainer] affiliated with a different company than the author
+ of the PR.
* PRs introducing changes that have already been discussed and consensus
reached only need one qualified approval. The discussion and resolution
needs to be linked to the PR.
@@ -650,11 +649,11 @@ should be canceled.
### Maintainers
-- [Damien Mathieu](https://github.com/dmathieu), Elastic
-- [David Ashpole](https://github.com/dashpole), Google
-- [Robert PajÄ…k](https://github.com/pellared), Splunk
-- [Sam Xie](https://github.com/XSAM), Cisco/AppDynamics
-- [Tyler Yahn](https://github.com/MrAlias), Splunk
+- [Damien Mathieu](https://github.com/dmathieu), Elastic ([GPG](https://keys.openpgp.org/search?q=5A126B972A81A6CE443E5E1B408B8E44F0873832))
+- [David Ashpole](https://github.com/dashpole), Google ([GPG](https://keys.openpgp.org/search?q=C0D1BDDCAAEAE573673085F176327DA4D864DC70))
+- [Robert PajÄ…k](https://github.com/pellared), Splunk ([GPG](https://keys.openpgp.org/search?q=CDAD3A60476A3DE599AA5092E5F7C35A4DBE90C2))
+- [Sam Xie](https://github.com/XSAM), Splunk ([GPG](https://keys.openpgp.org/search?q=AEA033782371ABB18EE39188B8044925D6FEEBEA))
+- [Tyler Yahn](https://github.com/MrAlias), Splunk ([GPG](https://keys.openpgp.org/search?q=0x46B0F3E1A8B1BA5A))
### Emeritus
diff --git a/vendor/go.opentelemetry.io/otel/Makefile b/vendor/go.opentelemetry.io/otel/Makefile
index 62a56f4d3..4fa423ca0 100644
--- a/vendor/go.opentelemetry.io/otel/Makefile
+++ b/vendor/go.opentelemetry.io/otel/Makefile
@@ -293,7 +293,7 @@ semconv-generate: $(SEMCONVKIT)
--param tag=$(TAG) \
go \
/home/weaver/target
- $(SEMCONVKIT) -output "$(SEMCONVPKG)/$(TAG)" -tag "$(TAG)"
+ $(SEMCONVKIT) -semconv "$(SEMCONVPKG)" -tag "$(TAG)"
.PHONY: gorelease
gorelease: $(OTEL_GO_MOD_DIRS:%=gorelease/%)
diff --git a/vendor/go.opentelemetry.io/otel/README.md b/vendor/go.opentelemetry.io/otel/README.md
index b60078812..5fa1b75c6 100644
--- a/vendor/go.opentelemetry.io/otel/README.md
+++ b/vendor/go.opentelemetry.io/otel/README.md
@@ -7,6 +7,7 @@
[](https://scorecard.dev/viewer/?uri=github.com/open-telemetry/opentelemetry-go)
[](https://www.bestpractices.dev/projects/9996)
[](https://issues.oss-fuzz.com/issues?q=project:opentelemetry-go)
+[](https://app.fossa.com/projects/custom%2B162%2Fgithub.com%2Fopen-telemetry%2Fopentelemetry-go?ref=badge_shield&issueType=license)
[](https://cloud-native.slack.com/archives/C01NPAXACKT)
OpenTelemetry-Go is the [Go](https://golang.org/) implementation of [OpenTelemetry](https://opentelemetry.io/).
diff --git a/vendor/go.opentelemetry.io/otel/RELEASING.md b/vendor/go.opentelemetry.io/otel/RELEASING.md
index 7c1a9119d..1ddcdef03 100644
--- a/vendor/go.opentelemetry.io/otel/RELEASING.md
+++ b/vendor/go.opentelemetry.io/otel/RELEASING.md
@@ -112,6 +112,29 @@ It is critical you make sure the version you push upstream is correct.
Finally create a Release for the new `` on GitHub.
The release body should include all the release notes from the Changelog for this release.
+### Sign the Release Artifact
+
+To ensure we comply with CNCF best practices, we need to sign the release artifact.
+The tarball attached to the GitHub release needs to be signed with your GPG key.
+
+Follow [these steps] to sign the release artifact and upload it to GitHub.
+You can use [this script] to verify the contents of the tarball before signing it.
+
+Be sure to use the correct GPG key when signing the release artifact.
+
+```terminal
+gpg --local-user --armor --detach-sign opentelemetry-go-.tar.gz
+```
+
+You can verify the signature with:
+
+```terminal
+gpg --verify opentelemetry-go-.tar.gz.asc opentelemetry-go-.tar.gz
+```
+
+[these steps]: https://wiki.debian.org/Creating%20signed%20GitHub%20releases
+[this script]: https://github.com/MrAlias/attest-sh
+
## Post-Release
### Contrib Repository
diff --git a/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile b/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile
index 51fb76b30..935bd4876 100644
--- a/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile
+++ b/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile
@@ -1,4 +1,4 @@
# This is a renovate-friendly source of Docker images.
-FROM python:3.13.3-slim-bullseye@sha256:9e3f9243e06fd68eb9519074b49878eda20ad39a855fac51aaffb741de20726e AS python
-FROM otel/weaver:v0.15.0@sha256:1cf1c72eaed57dad813c2e359133b8a15bd4facf305aae5b13bdca6d3eccff56 AS weaver
+FROM python:3.13.5-slim-bullseye@sha256:5b9fc0d8ef79cfb5f300e61cb516e0c668067bbf77646762c38c94107e230dbc AS python
+FROM otel/weaver:v0.15.2@sha256:b13acea09f721774daba36344861f689ac4bb8d6ecd94c4600b4d590c8fb34b9 AS weaver
FROM avtodev/markdown-lint:v1@sha256:6aeedc2f49138ce7a1cd0adffc1b1c0321b841dc2102408967d9301c031949ee AS markdown
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/README.md b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/README.md
deleted file mode 100644
index 87b842c5d..000000000
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/README.md
+++ /dev/null
@@ -1,3 +0,0 @@
-# Semconv v1.17.0
-
-[](https://pkg.go.dev/go.opentelemetry.io/otel/semconv/v1.17.0)
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/event.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/event.go
deleted file mode 100644
index c7b804bbe..000000000
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/event.go
+++ /dev/null
@@ -1,188 +0,0 @@
-// Copyright The OpenTelemetry Authors
-// SPDX-License-Identifier: Apache-2.0
-
-// Code generated from semantic convention specification. DO NOT EDIT.
-
-package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0"
-
-import "go.opentelemetry.io/otel/attribute"
-
-// This semantic convention defines the attributes used to represent a feature
-// flag evaluation as an event.
-const (
- // FeatureFlagKeyKey is the attribute Key conforming to the
- // "feature_flag.key" semantic conventions. It represents the unique
- // identifier of the feature flag.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'logo-color'
- FeatureFlagKeyKey = attribute.Key("feature_flag.key")
-
- // FeatureFlagProviderNameKey is the attribute Key conforming to the
- // "feature_flag.provider_name" semantic conventions. It represents the
- // name of the service provider that performs the flag evaluation.
- //
- // Type: string
- // RequirementLevel: Recommended
- // Stability: stable
- // Examples: 'Flag Manager'
- FeatureFlagProviderNameKey = attribute.Key("feature_flag.provider_name")
-
- // FeatureFlagVariantKey is the attribute Key conforming to the
- // "feature_flag.variant" semantic conventions. It represents the sHOULD be
- // a semantic identifier for a value. If one is unavailable, a stringified
- // version of the value can be used.
- //
- // Type: string
- // RequirementLevel: Recommended
- // Stability: stable
- // Examples: 'red', 'true', 'on'
- // Note: A semantic identifier, commonly referred to as a variant, provides
- // a means
- // for referring to a value without including the value itself. This can
- // provide additional context for understanding the meaning behind a value.
- // For example, the variant `red` maybe be used for the value `#c05543`.
- //
- // A stringified version of the value can be used in situations where a
- // semantic identifier is unavailable. String representation of the value
- // should be determined by the implementer.
- FeatureFlagVariantKey = attribute.Key("feature_flag.variant")
-)
-
-// FeatureFlagKey returns an attribute KeyValue conforming to the
-// "feature_flag.key" semantic conventions. It represents the unique identifier
-// of the feature flag.
-func FeatureFlagKey(val string) attribute.KeyValue {
- return FeatureFlagKeyKey.String(val)
-}
-
-// FeatureFlagProviderName returns an attribute KeyValue conforming to the
-// "feature_flag.provider_name" semantic conventions. It represents the name of
-// the service provider that performs the flag evaluation.
-func FeatureFlagProviderName(val string) attribute.KeyValue {
- return FeatureFlagProviderNameKey.String(val)
-}
-
-// FeatureFlagVariant returns an attribute KeyValue conforming to the
-// "feature_flag.variant" semantic conventions. It represents the sHOULD be a
-// semantic identifier for a value. If one is unavailable, a stringified
-// version of the value can be used.
-func FeatureFlagVariant(val string) attribute.KeyValue {
- return FeatureFlagVariantKey.String(val)
-}
-
-// RPC received/sent message.
-const (
- // MessageTypeKey is the attribute Key conforming to the "message.type"
- // semantic conventions. It represents the whether this is a received or
- // sent message.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- MessageTypeKey = attribute.Key("message.type")
-
- // MessageIDKey is the attribute Key conforming to the "message.id"
- // semantic conventions. It represents the mUST be calculated as two
- // different counters starting from `1` one for sent messages and one for
- // received message.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Note: This way we guarantee that the values will be consistent between
- // different implementations.
- MessageIDKey = attribute.Key("message.id")
-
- // MessageCompressedSizeKey is the attribute Key conforming to the
- // "message.compressed_size" semantic conventions. It represents the
- // compressed size of the message in bytes.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- MessageCompressedSizeKey = attribute.Key("message.compressed_size")
-
- // MessageUncompressedSizeKey is the attribute Key conforming to the
- // "message.uncompressed_size" semantic conventions. It represents the
- // uncompressed size of the message in bytes.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- MessageUncompressedSizeKey = attribute.Key("message.uncompressed_size")
-)
-
-var (
- // sent
- MessageTypeSent = MessageTypeKey.String("SENT")
- // received
- MessageTypeReceived = MessageTypeKey.String("RECEIVED")
-)
-
-// MessageID returns an attribute KeyValue conforming to the "message.id"
-// semantic conventions. It represents the mUST be calculated as two different
-// counters starting from `1` one for sent messages and one for received
-// message.
-func MessageID(val int) attribute.KeyValue {
- return MessageIDKey.Int(val)
-}
-
-// MessageCompressedSize returns an attribute KeyValue conforming to the
-// "message.compressed_size" semantic conventions. It represents the compressed
-// size of the message in bytes.
-func MessageCompressedSize(val int) attribute.KeyValue {
- return MessageCompressedSizeKey.Int(val)
-}
-
-// MessageUncompressedSize returns an attribute KeyValue conforming to the
-// "message.uncompressed_size" semantic conventions. It represents the
-// uncompressed size of the message in bytes.
-func MessageUncompressedSize(val int) attribute.KeyValue {
- return MessageUncompressedSizeKey.Int(val)
-}
-
-// The attributes used to report a single exception associated with a span.
-const (
- // ExceptionEscapedKey is the attribute Key conforming to the
- // "exception.escaped" semantic conventions. It represents the sHOULD be
- // set to true if the exception event is recorded at a point where it is
- // known that the exception is escaping the scope of the span.
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- // Note: An exception is considered to have escaped (or left) the scope of
- // a span,
- // if that span is ended while the exception is still logically "in
- // flight".
- // This may be actually "in flight" in some languages (e.g. if the
- // exception
- // is passed to a Context manager's `__exit__` method in Python) but will
- // usually be caught at the point of recording the exception in most
- // languages.
- //
- // It is usually not possible to determine at the point where an exception
- // is thrown
- // whether it will escape the scope of a span.
- // However, it is trivial to know that an exception
- // will escape, if one checks for an active exception just before ending
- // the span,
- // as done in the [example above](#recording-an-exception).
- //
- // It follows that an exception may still escape the scope of the span
- // even if the `exception.escaped` attribute was not set or set to false,
- // since the event might have been recorded at a time where it was not
- // clear whether the exception will escape.
- ExceptionEscapedKey = attribute.Key("exception.escaped")
-)
-
-// ExceptionEscaped returns an attribute KeyValue conforming to the
-// "exception.escaped" semantic conventions. It represents the sHOULD be set to
-// true if the exception event is recorded at a point where it is known that
-// the exception is escaping the scope of the span.
-func ExceptionEscaped(val bool) attribute.KeyValue {
- return ExceptionEscapedKey.Bool(val)
-}
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/http.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/http.go
deleted file mode 100644
index d318221e5..000000000
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/http.go
+++ /dev/null
@@ -1,10 +0,0 @@
-// Copyright The OpenTelemetry Authors
-// SPDX-License-Identifier: Apache-2.0
-
-package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0"
-
-// HTTP scheme attributes.
-var (
- HTTPSchemeHTTP = HTTPSchemeKey.String("http")
- HTTPSchemeHTTPS = HTTPSchemeKey.String("https")
-)
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/resource.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/resource.go
deleted file mode 100644
index 7e365e82c..000000000
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/resource.go
+++ /dev/null
@@ -1,1999 +0,0 @@
-// Copyright The OpenTelemetry Authors
-// SPDX-License-Identifier: Apache-2.0
-
-// Code generated from semantic convention specification. DO NOT EDIT.
-
-package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0"
-
-import "go.opentelemetry.io/otel/attribute"
-
-// The web browser in which the application represented by the resource is
-// running. The `browser.*` attributes MUST be used only for resources that
-// represent applications running in a web browser (regardless of whether
-// running on a mobile or desktop device).
-const (
- // BrowserBrandsKey is the attribute Key conforming to the "browser.brands"
- // semantic conventions. It represents the array of brand name and version
- // separated by a space
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: ' Not A;Brand 99', 'Chromium 99', 'Chrome 99'
- // Note: This value is intended to be taken from the [UA client hints
- // API](https://wicg.github.io/ua-client-hints/#interface)
- // (`navigator.userAgentData.brands`).
- BrowserBrandsKey = attribute.Key("browser.brands")
-
- // BrowserPlatformKey is the attribute Key conforming to the
- // "browser.platform" semantic conventions. It represents the platform on
- // which the browser is running
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Windows', 'macOS', 'Android'
- // Note: This value is intended to be taken from the [UA client hints
- // API](https://wicg.github.io/ua-client-hints/#interface)
- // (`navigator.userAgentData.platform`). If unavailable, the legacy
- // `navigator.platform` API SHOULD NOT be used instead and this attribute
- // SHOULD be left unset in order for the values to be consistent.
- // The list of possible values is defined in the [W3C User-Agent Client
- // Hints
- // specification](https://wicg.github.io/ua-client-hints/#sec-ch-ua-platform).
- // Note that some (but not all) of these values can overlap with values in
- // the [`os.type` and `os.name` attributes](./os.md). However, for
- // consistency, the values in the `browser.platform` attribute should
- // capture the exact value that the user agent provides.
- BrowserPlatformKey = attribute.Key("browser.platform")
-
- // BrowserMobileKey is the attribute Key conforming to the "browser.mobile"
- // semantic conventions. It represents a boolean that is true if the
- // browser is running on a mobile device
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- // Note: This value is intended to be taken from the [UA client hints
- // API](https://wicg.github.io/ua-client-hints/#interface)
- // (`navigator.userAgentData.mobile`). If unavailable, this attribute
- // SHOULD be left unset.
- BrowserMobileKey = attribute.Key("browser.mobile")
-
- // BrowserUserAgentKey is the attribute Key conforming to the
- // "browser.user_agent" semantic conventions. It represents the full
- // user-agent string provided by the browser
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7)
- // AppleWebKit/537.36 (KHTML, '
- // 'like Gecko) Chrome/95.0.4638.54 Safari/537.36'
- // Note: The user-agent value SHOULD be provided only from browsers that do
- // not have a mechanism to retrieve brands and platform individually from
- // the User-Agent Client Hints API. To retrieve the value, the legacy
- // `navigator.userAgent` API can be used.
- BrowserUserAgentKey = attribute.Key("browser.user_agent")
-
- // BrowserLanguageKey is the attribute Key conforming to the
- // "browser.language" semantic conventions. It represents the preferred
- // language of the user using the browser
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'en', 'en-US', 'fr', 'fr-FR'
- // Note: This value is intended to be taken from the Navigator API
- // `navigator.language`.
- BrowserLanguageKey = attribute.Key("browser.language")
-)
-
-// BrowserBrands returns an attribute KeyValue conforming to the
-// "browser.brands" semantic conventions. It represents the array of brand name
-// and version separated by a space
-func BrowserBrands(val ...string) attribute.KeyValue {
- return BrowserBrandsKey.StringSlice(val)
-}
-
-// BrowserPlatform returns an attribute KeyValue conforming to the
-// "browser.platform" semantic conventions. It represents the platform on which
-// the browser is running
-func BrowserPlatform(val string) attribute.KeyValue {
- return BrowserPlatformKey.String(val)
-}
-
-// BrowserMobile returns an attribute KeyValue conforming to the
-// "browser.mobile" semantic conventions. It represents a boolean that is true
-// if the browser is running on a mobile device
-func BrowserMobile(val bool) attribute.KeyValue {
- return BrowserMobileKey.Bool(val)
-}
-
-// BrowserUserAgent returns an attribute KeyValue conforming to the
-// "browser.user_agent" semantic conventions. It represents the full user-agent
-// string provided by the browser
-func BrowserUserAgent(val string) attribute.KeyValue {
- return BrowserUserAgentKey.String(val)
-}
-
-// BrowserLanguage returns an attribute KeyValue conforming to the
-// "browser.language" semantic conventions. It represents the preferred
-// language of the user using the browser
-func BrowserLanguage(val string) attribute.KeyValue {
- return BrowserLanguageKey.String(val)
-}
-
-// A cloud environment (e.g. GCP, Azure, AWS)
-const (
- // CloudProviderKey is the attribute Key conforming to the "cloud.provider"
- // semantic conventions. It represents the name of the cloud provider.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- CloudProviderKey = attribute.Key("cloud.provider")
-
- // CloudAccountIDKey is the attribute Key conforming to the
- // "cloud.account.id" semantic conventions. It represents the cloud account
- // ID the resource is assigned to.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '111111111111', 'opentelemetry'
- CloudAccountIDKey = attribute.Key("cloud.account.id")
-
- // CloudRegionKey is the attribute Key conforming to the "cloud.region"
- // semantic conventions. It represents the geographical region the resource
- // is running.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'us-central1', 'us-east-1'
- // Note: Refer to your provider's docs to see the available regions, for
- // example [Alibaba Cloud
- // regions](https://www.alibabacloud.com/help/doc-detail/40654.htm), [AWS
- // regions](https://aws.amazon.com/about-aws/global-infrastructure/regions_az/),
- // [Azure
- // regions](https://azure.microsoft.com/en-us/global-infrastructure/geographies/),
- // [Google Cloud regions](https://cloud.google.com/about/locations), or
- // [Tencent Cloud
- // regions](https://intl.cloud.tencent.com/document/product/213/6091).
- CloudRegionKey = attribute.Key("cloud.region")
-
- // CloudAvailabilityZoneKey is the attribute Key conforming to the
- // "cloud.availability_zone" semantic conventions. It represents the cloud
- // regions often have multiple, isolated locations known as zones to
- // increase availability. Availability zone represents the zone where the
- // resource is running.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'us-east-1c'
- // Note: Availability zones are called "zones" on Alibaba Cloud and Google
- // Cloud.
- CloudAvailabilityZoneKey = attribute.Key("cloud.availability_zone")
-
- // CloudPlatformKey is the attribute Key conforming to the "cloud.platform"
- // semantic conventions. It represents the cloud platform in use.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- // Note: The prefix of the service SHOULD match the one specified in
- // `cloud.provider`.
- CloudPlatformKey = attribute.Key("cloud.platform")
-)
-
-var (
- // Alibaba Cloud
- CloudProviderAlibabaCloud = CloudProviderKey.String("alibaba_cloud")
- // Amazon Web Services
- CloudProviderAWS = CloudProviderKey.String("aws")
- // Microsoft Azure
- CloudProviderAzure = CloudProviderKey.String("azure")
- // Google Cloud Platform
- CloudProviderGCP = CloudProviderKey.String("gcp")
- // IBM Cloud
- CloudProviderIbmCloud = CloudProviderKey.String("ibm_cloud")
- // Tencent Cloud
- CloudProviderTencentCloud = CloudProviderKey.String("tencent_cloud")
-)
-
-var (
- // Alibaba Cloud Elastic Compute Service
- CloudPlatformAlibabaCloudECS = CloudPlatformKey.String("alibaba_cloud_ecs")
- // Alibaba Cloud Function Compute
- CloudPlatformAlibabaCloudFc = CloudPlatformKey.String("alibaba_cloud_fc")
- // Red Hat OpenShift on Alibaba Cloud
- CloudPlatformAlibabaCloudOpenshift = CloudPlatformKey.String("alibaba_cloud_openshift")
- // AWS Elastic Compute Cloud
- CloudPlatformAWSEC2 = CloudPlatformKey.String("aws_ec2")
- // AWS Elastic Container Service
- CloudPlatformAWSECS = CloudPlatformKey.String("aws_ecs")
- // AWS Elastic Kubernetes Service
- CloudPlatformAWSEKS = CloudPlatformKey.String("aws_eks")
- // AWS Lambda
- CloudPlatformAWSLambda = CloudPlatformKey.String("aws_lambda")
- // AWS Elastic Beanstalk
- CloudPlatformAWSElasticBeanstalk = CloudPlatformKey.String("aws_elastic_beanstalk")
- // AWS App Runner
- CloudPlatformAWSAppRunner = CloudPlatformKey.String("aws_app_runner")
- // Red Hat OpenShift on AWS (ROSA)
- CloudPlatformAWSOpenshift = CloudPlatformKey.String("aws_openshift")
- // Azure Virtual Machines
- CloudPlatformAzureVM = CloudPlatformKey.String("azure_vm")
- // Azure Container Instances
- CloudPlatformAzureContainerInstances = CloudPlatformKey.String("azure_container_instances")
- // Azure Kubernetes Service
- CloudPlatformAzureAKS = CloudPlatformKey.String("azure_aks")
- // Azure Functions
- CloudPlatformAzureFunctions = CloudPlatformKey.String("azure_functions")
- // Azure App Service
- CloudPlatformAzureAppService = CloudPlatformKey.String("azure_app_service")
- // Azure Red Hat OpenShift
- CloudPlatformAzureOpenshift = CloudPlatformKey.String("azure_openshift")
- // Google Cloud Compute Engine (GCE)
- CloudPlatformGCPComputeEngine = CloudPlatformKey.String("gcp_compute_engine")
- // Google Cloud Run
- CloudPlatformGCPCloudRun = CloudPlatformKey.String("gcp_cloud_run")
- // Google Cloud Kubernetes Engine (GKE)
- CloudPlatformGCPKubernetesEngine = CloudPlatformKey.String("gcp_kubernetes_engine")
- // Google Cloud Functions (GCF)
- CloudPlatformGCPCloudFunctions = CloudPlatformKey.String("gcp_cloud_functions")
- // Google Cloud App Engine (GAE)
- CloudPlatformGCPAppEngine = CloudPlatformKey.String("gcp_app_engine")
- // Red Hat OpenShift on Google Cloud
- CloudPlatformGoogleCloudOpenshift = CloudPlatformKey.String("google_cloud_openshift")
- // Red Hat OpenShift on IBM Cloud
- CloudPlatformIbmCloudOpenshift = CloudPlatformKey.String("ibm_cloud_openshift")
- // Tencent Cloud Cloud Virtual Machine (CVM)
- CloudPlatformTencentCloudCvm = CloudPlatformKey.String("tencent_cloud_cvm")
- // Tencent Cloud Elastic Kubernetes Service (EKS)
- CloudPlatformTencentCloudEKS = CloudPlatformKey.String("tencent_cloud_eks")
- // Tencent Cloud Serverless Cloud Function (SCF)
- CloudPlatformTencentCloudScf = CloudPlatformKey.String("tencent_cloud_scf")
-)
-
-// CloudAccountID returns an attribute KeyValue conforming to the
-// "cloud.account.id" semantic conventions. It represents the cloud account ID
-// the resource is assigned to.
-func CloudAccountID(val string) attribute.KeyValue {
- return CloudAccountIDKey.String(val)
-}
-
-// CloudRegion returns an attribute KeyValue conforming to the
-// "cloud.region" semantic conventions. It represents the geographical region
-// the resource is running.
-func CloudRegion(val string) attribute.KeyValue {
- return CloudRegionKey.String(val)
-}
-
-// CloudAvailabilityZone returns an attribute KeyValue conforming to the
-// "cloud.availability_zone" semantic conventions. It represents the cloud
-// regions often have multiple, isolated locations known as zones to increase
-// availability. Availability zone represents the zone where the resource is
-// running.
-func CloudAvailabilityZone(val string) attribute.KeyValue {
- return CloudAvailabilityZoneKey.String(val)
-}
-
-// Resources used by AWS Elastic Container Service (ECS).
-const (
- // AWSECSContainerARNKey is the attribute Key conforming to the
- // "aws.ecs.container.arn" semantic conventions. It represents the Amazon
- // Resource Name (ARN) of an [ECS container
- // instance](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples:
- // 'arn:aws:ecs:us-west-1:123456789123:container/32624152-9086-4f0e-acae-1a75b14fe4d9'
- AWSECSContainerARNKey = attribute.Key("aws.ecs.container.arn")
-
- // AWSECSClusterARNKey is the attribute Key conforming to the
- // "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an
- // [ECS
- // cluster](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster'
- AWSECSClusterARNKey = attribute.Key("aws.ecs.cluster.arn")
-
- // AWSECSLaunchtypeKey is the attribute Key conforming to the
- // "aws.ecs.launchtype" semantic conventions. It represents the [launch
- // type](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/launch_types.html)
- // for an ECS task.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- AWSECSLaunchtypeKey = attribute.Key("aws.ecs.launchtype")
-
- // AWSECSTaskARNKey is the attribute Key conforming to the
- // "aws.ecs.task.arn" semantic conventions. It represents the ARN of an
- // [ECS task
- // definition](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples:
- // 'arn:aws:ecs:us-west-1:123456789123:task/10838bed-421f-43ef-870a-f43feacbbb5b'
- AWSECSTaskARNKey = attribute.Key("aws.ecs.task.arn")
-
- // AWSECSTaskFamilyKey is the attribute Key conforming to the
- // "aws.ecs.task.family" semantic conventions. It represents the task
- // definition family this task definition is a member of.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry-family'
- AWSECSTaskFamilyKey = attribute.Key("aws.ecs.task.family")
-
- // AWSECSTaskRevisionKey is the attribute Key conforming to the
- // "aws.ecs.task.revision" semantic conventions. It represents the revision
- // for this task definition.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '8', '26'
- AWSECSTaskRevisionKey = attribute.Key("aws.ecs.task.revision")
-)
-
-var (
- // ec2
- AWSECSLaunchtypeEC2 = AWSECSLaunchtypeKey.String("ec2")
- // fargate
- AWSECSLaunchtypeFargate = AWSECSLaunchtypeKey.String("fargate")
-)
-
-// AWSECSContainerARN returns an attribute KeyValue conforming to the
-// "aws.ecs.container.arn" semantic conventions. It represents the Amazon
-// Resource Name (ARN) of an [ECS container
-// instance](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html).
-func AWSECSContainerARN(val string) attribute.KeyValue {
- return AWSECSContainerARNKey.String(val)
-}
-
-// AWSECSClusterARN returns an attribute KeyValue conforming to the
-// "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an [ECS
-// cluster](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html).
-func AWSECSClusterARN(val string) attribute.KeyValue {
- return AWSECSClusterARNKey.String(val)
-}
-
-// AWSECSTaskARN returns an attribute KeyValue conforming to the
-// "aws.ecs.task.arn" semantic conventions. It represents the ARN of an [ECS
-// task
-// definition](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html).
-func AWSECSTaskARN(val string) attribute.KeyValue {
- return AWSECSTaskARNKey.String(val)
-}
-
-// AWSECSTaskFamily returns an attribute KeyValue conforming to the
-// "aws.ecs.task.family" semantic conventions. It represents the task
-// definition family this task definition is a member of.
-func AWSECSTaskFamily(val string) attribute.KeyValue {
- return AWSECSTaskFamilyKey.String(val)
-}
-
-// AWSECSTaskRevision returns an attribute KeyValue conforming to the
-// "aws.ecs.task.revision" semantic conventions. It represents the revision for
-// this task definition.
-func AWSECSTaskRevision(val string) attribute.KeyValue {
- return AWSECSTaskRevisionKey.String(val)
-}
-
-// Resources used by AWS Elastic Kubernetes Service (EKS).
-const (
- // AWSEKSClusterARNKey is the attribute Key conforming to the
- // "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an
- // EKS cluster.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster'
- AWSEKSClusterARNKey = attribute.Key("aws.eks.cluster.arn")
-)
-
-// AWSEKSClusterARN returns an attribute KeyValue conforming to the
-// "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS
-// cluster.
-func AWSEKSClusterARN(val string) attribute.KeyValue {
- return AWSEKSClusterARNKey.String(val)
-}
-
-// Resources specific to Amazon Web Services.
-const (
- // AWSLogGroupNamesKey is the attribute Key conforming to the
- // "aws.log.group.names" semantic conventions. It represents the name(s) of
- // the AWS log group(s) an application is writing to.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '/aws/lambda/my-function', 'opentelemetry-service'
- // Note: Multiple log groups must be supported for cases like
- // multi-container applications, where a single application has sidecar
- // containers, and each write to their own log group.
- AWSLogGroupNamesKey = attribute.Key("aws.log.group.names")
-
- // AWSLogGroupARNsKey is the attribute Key conforming to the
- // "aws.log.group.arns" semantic conventions. It represents the Amazon
- // Resource Name(s) (ARN) of the AWS log group(s).
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples:
- // 'arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:*'
- // Note: See the [log group ARN format
- // documentation](https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format).
- AWSLogGroupARNsKey = attribute.Key("aws.log.group.arns")
-
- // AWSLogStreamNamesKey is the attribute Key conforming to the
- // "aws.log.stream.names" semantic conventions. It represents the name(s)
- // of the AWS log stream(s) an application is writing to.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'logs/main/10838bed-421f-43ef-870a-f43feacbbb5b'
- AWSLogStreamNamesKey = attribute.Key("aws.log.stream.names")
-
- // AWSLogStreamARNsKey is the attribute Key conforming to the
- // "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of
- // the AWS log stream(s).
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples:
- // 'arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:log-stream:logs/main/10838bed-421f-43ef-870a-f43feacbbb5b'
- // Note: See the [log stream ARN format
- // documentation](https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format).
- // One log group can contain several log streams, so these ARNs necessarily
- // identify both a log group and a log stream.
- AWSLogStreamARNsKey = attribute.Key("aws.log.stream.arns")
-)
-
-// AWSLogGroupNames returns an attribute KeyValue conforming to the
-// "aws.log.group.names" semantic conventions. It represents the name(s) of the
-// AWS log group(s) an application is writing to.
-func AWSLogGroupNames(val ...string) attribute.KeyValue {
- return AWSLogGroupNamesKey.StringSlice(val)
-}
-
-// AWSLogGroupARNs returns an attribute KeyValue conforming to the
-// "aws.log.group.arns" semantic conventions. It represents the Amazon Resource
-// Name(s) (ARN) of the AWS log group(s).
-func AWSLogGroupARNs(val ...string) attribute.KeyValue {
- return AWSLogGroupARNsKey.StringSlice(val)
-}
-
-// AWSLogStreamNames returns an attribute KeyValue conforming to the
-// "aws.log.stream.names" semantic conventions. It represents the name(s) of
-// the AWS log stream(s) an application is writing to.
-func AWSLogStreamNames(val ...string) attribute.KeyValue {
- return AWSLogStreamNamesKey.StringSlice(val)
-}
-
-// AWSLogStreamARNs returns an attribute KeyValue conforming to the
-// "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the
-// AWS log stream(s).
-func AWSLogStreamARNs(val ...string) attribute.KeyValue {
- return AWSLogStreamARNsKey.StringSlice(val)
-}
-
-// A container instance.
-const (
- // ContainerNameKey is the attribute Key conforming to the "container.name"
- // semantic conventions. It represents the container name used by container
- // runtime.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry-autoconf'
- ContainerNameKey = attribute.Key("container.name")
-
- // ContainerIDKey is the attribute Key conforming to the "container.id"
- // semantic conventions. It represents the container ID. Usually a UUID, as
- // for example used to [identify Docker
- // containers](https://docs.docker.com/engine/reference/run/#container-identification).
- // The UUID might be abbreviated.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'a3bf90e006b2'
- ContainerIDKey = attribute.Key("container.id")
-
- // ContainerRuntimeKey is the attribute Key conforming to the
- // "container.runtime" semantic conventions. It represents the container
- // runtime managing this container.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'docker', 'containerd', 'rkt'
- ContainerRuntimeKey = attribute.Key("container.runtime")
-
- // ContainerImageNameKey is the attribute Key conforming to the
- // "container.image.name" semantic conventions. It represents the name of
- // the image the container was built on.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'gcr.io/opentelemetry/operator'
- ContainerImageNameKey = attribute.Key("container.image.name")
-
- // ContainerImageTagKey is the attribute Key conforming to the
- // "container.image.tag" semantic conventions. It represents the container
- // image tag.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '0.1'
- ContainerImageTagKey = attribute.Key("container.image.tag")
-)
-
-// ContainerName returns an attribute KeyValue conforming to the
-// "container.name" semantic conventions. It represents the container name used
-// by container runtime.
-func ContainerName(val string) attribute.KeyValue {
- return ContainerNameKey.String(val)
-}
-
-// ContainerID returns an attribute KeyValue conforming to the
-// "container.id" semantic conventions. It represents the container ID. Usually
-// a UUID, as for example used to [identify Docker
-// containers](https://docs.docker.com/engine/reference/run/#container-identification).
-// The UUID might be abbreviated.
-func ContainerID(val string) attribute.KeyValue {
- return ContainerIDKey.String(val)
-}
-
-// ContainerRuntime returns an attribute KeyValue conforming to the
-// "container.runtime" semantic conventions. It represents the container
-// runtime managing this container.
-func ContainerRuntime(val string) attribute.KeyValue {
- return ContainerRuntimeKey.String(val)
-}
-
-// ContainerImageName returns an attribute KeyValue conforming to the
-// "container.image.name" semantic conventions. It represents the name of the
-// image the container was built on.
-func ContainerImageName(val string) attribute.KeyValue {
- return ContainerImageNameKey.String(val)
-}
-
-// ContainerImageTag returns an attribute KeyValue conforming to the
-// "container.image.tag" semantic conventions. It represents the container
-// image tag.
-func ContainerImageTag(val string) attribute.KeyValue {
- return ContainerImageTagKey.String(val)
-}
-
-// The software deployment.
-const (
- // DeploymentEnvironmentKey is the attribute Key conforming to the
- // "deployment.environment" semantic conventions. It represents the name of
- // the [deployment
- // environment](https://en.wikipedia.org/wiki/Deployment_environment) (aka
- // deployment tier).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'staging', 'production'
- DeploymentEnvironmentKey = attribute.Key("deployment.environment")
-)
-
-// DeploymentEnvironment returns an attribute KeyValue conforming to the
-// "deployment.environment" semantic conventions. It represents the name of the
-// [deployment
-// environment](https://en.wikipedia.org/wiki/Deployment_environment) (aka
-// deployment tier).
-func DeploymentEnvironment(val string) attribute.KeyValue {
- return DeploymentEnvironmentKey.String(val)
-}
-
-// The device on which the process represented by this resource is running.
-const (
- // DeviceIDKey is the attribute Key conforming to the "device.id" semantic
- // conventions. It represents a unique identifier representing the device
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '2ab2916d-a51f-4ac8-80ee-45ac31a28092'
- // Note: The device identifier MUST only be defined using the values
- // outlined below. This value is not an advertising identifier and MUST NOT
- // be used as such. On iOS (Swift or Objective-C), this value MUST be equal
- // to the [vendor
- // identifier](https://developer.apple.com/documentation/uikit/uidevice/1620059-identifierforvendor).
- // On Android (Java or Kotlin), this value MUST be equal to the Firebase
- // Installation ID or a globally unique UUID which is persisted across
- // sessions in your application. More information can be found
- // [here](https://developer.android.com/training/articles/user-data-ids) on
- // best practices and exact implementation details. Caution should be taken
- // when storing personal data or anything which can identify a user. GDPR
- // and data protection laws may apply, ensure you do your own due
- // diligence.
- DeviceIDKey = attribute.Key("device.id")
-
- // DeviceModelIdentifierKey is the attribute Key conforming to the
- // "device.model.identifier" semantic conventions. It represents the model
- // identifier for the device
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'iPhone3,4', 'SM-G920F'
- // Note: It's recommended this value represents a machine readable version
- // of the model identifier rather than the market or consumer-friendly name
- // of the device.
- DeviceModelIdentifierKey = attribute.Key("device.model.identifier")
-
- // DeviceModelNameKey is the attribute Key conforming to the
- // "device.model.name" semantic conventions. It represents the marketing
- // name for the device model
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'iPhone 6s Plus', 'Samsung Galaxy S6'
- // Note: It's recommended this value represents a human readable version of
- // the device model rather than a machine readable alternative.
- DeviceModelNameKey = attribute.Key("device.model.name")
-
- // DeviceManufacturerKey is the attribute Key conforming to the
- // "device.manufacturer" semantic conventions. It represents the name of
- // the device manufacturer
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Apple', 'Samsung'
- // Note: The Android OS provides this field via
- // [Build](https://developer.android.com/reference/android/os/Build#MANUFACTURER).
- // iOS apps SHOULD hardcode the value `Apple`.
- DeviceManufacturerKey = attribute.Key("device.manufacturer")
-)
-
-// DeviceID returns an attribute KeyValue conforming to the "device.id"
-// semantic conventions. It represents a unique identifier representing the
-// device
-func DeviceID(val string) attribute.KeyValue {
- return DeviceIDKey.String(val)
-}
-
-// DeviceModelIdentifier returns an attribute KeyValue conforming to the
-// "device.model.identifier" semantic conventions. It represents the model
-// identifier for the device
-func DeviceModelIdentifier(val string) attribute.KeyValue {
- return DeviceModelIdentifierKey.String(val)
-}
-
-// DeviceModelName returns an attribute KeyValue conforming to the
-// "device.model.name" semantic conventions. It represents the marketing name
-// for the device model
-func DeviceModelName(val string) attribute.KeyValue {
- return DeviceModelNameKey.String(val)
-}
-
-// DeviceManufacturer returns an attribute KeyValue conforming to the
-// "device.manufacturer" semantic conventions. It represents the name of the
-// device manufacturer
-func DeviceManufacturer(val string) attribute.KeyValue {
- return DeviceManufacturerKey.String(val)
-}
-
-// A serverless instance.
-const (
- // FaaSNameKey is the attribute Key conforming to the "faas.name" semantic
- // conventions. It represents the name of the single function that this
- // runtime instance executes.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'my-function', 'myazurefunctionapp/some-function-name'
- // Note: This is the name of the function as configured/deployed on the
- // FaaS
- // platform and is usually different from the name of the callback
- // function (which may be stored in the
- // [`code.namespace`/`code.function`](../../trace/semantic_conventions/span-general.md#source-code-attributes)
- // span attributes).
- //
- // For some cloud providers, the above definition is ambiguous. The
- // following
- // definition of function name MUST be used for this attribute
- // (and consequently the span name) for the listed cloud
- // providers/products:
- //
- // * **Azure:** The full name `/`, i.e., function app name
- // followed by a forward slash followed by the function name (this form
- // can also be seen in the resource JSON for the function).
- // This means that a span attribute MUST be used, as an Azure function
- // app can host multiple functions that would usually share
- // a TracerProvider (see also the `faas.id` attribute).
- FaaSNameKey = attribute.Key("faas.name")
-
- // FaaSIDKey is the attribute Key conforming to the "faas.id" semantic
- // conventions. It represents the unique ID of the single function that
- // this runtime instance executes.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'arn:aws:lambda:us-west-2:123456789012:function:my-function'
- // Note: On some cloud providers, it may not be possible to determine the
- // full ID at startup,
- // so consider setting `faas.id` as a span attribute instead.
- //
- // The exact value to use for `faas.id` depends on the cloud provider:
- //
- // * **AWS Lambda:** The function
- // [ARN](https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html).
- // Take care not to use the "invoked ARN" directly but replace any
- // [alias
- // suffix](https://docs.aws.amazon.com/lambda/latest/dg/configuration-aliases.html)
- // with the resolved function version, as the same runtime instance may
- // be invokable with
- // multiple different aliases.
- // * **GCP:** The [URI of the
- // resource](https://cloud.google.com/iam/docs/full-resource-names)
- // * **Azure:** The [Fully Qualified Resource
- // ID](https://docs.microsoft.com/en-us/rest/api/resources/resources/get-by-id)
- // of the invoked function,
- // *not* the function app, having the form
- // `/subscriptions//resourceGroups//providers/Microsoft.Web/sites//functions/`.
- // This means that a span attribute MUST be used, as an Azure function
- // app can host multiple functions that would usually share
- // a TracerProvider.
- FaaSIDKey = attribute.Key("faas.id")
-
- // FaaSVersionKey is the attribute Key conforming to the "faas.version"
- // semantic conventions. It represents the immutable version of the
- // function being executed.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '26', 'pinkfroid-00002'
- // Note: Depending on the cloud provider and platform, use:
- //
- // * **AWS Lambda:** The [function
- // version](https://docs.aws.amazon.com/lambda/latest/dg/configuration-versions.html)
- // (an integer represented as a decimal string).
- // * **Google Cloud Run:** The
- // [revision](https://cloud.google.com/run/docs/managing/revisions)
- // (i.e., the function name plus the revision suffix).
- // * **Google Cloud Functions:** The value of the
- // [`K_REVISION` environment
- // variable](https://cloud.google.com/functions/docs/env-var#runtime_environment_variables_set_automatically).
- // * **Azure Functions:** Not applicable. Do not set this attribute.
- FaaSVersionKey = attribute.Key("faas.version")
-
- // FaaSInstanceKey is the attribute Key conforming to the "faas.instance"
- // semantic conventions. It represents the execution environment ID as a
- // string, that will be potentially reused for other invocations to the
- // same function/function version.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '2021/06/28/[$LATEST]2f399eb14537447da05ab2a2e39309de'
- // Note: * **AWS Lambda:** Use the (full) log stream name.
- FaaSInstanceKey = attribute.Key("faas.instance")
-
- // FaaSMaxMemoryKey is the attribute Key conforming to the
- // "faas.max_memory" semantic conventions. It represents the amount of
- // memory available to the serverless function in MiB.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 128
- // Note: It's recommended to set this attribute since e.g. too little
- // memory can easily stop a Java AWS Lambda function from working
- // correctly. On AWS Lambda, the environment variable
- // `AWS_LAMBDA_FUNCTION_MEMORY_SIZE` provides this information.
- FaaSMaxMemoryKey = attribute.Key("faas.max_memory")
-)
-
-// FaaSName returns an attribute KeyValue conforming to the "faas.name"
-// semantic conventions. It represents the name of the single function that
-// this runtime instance executes.
-func FaaSName(val string) attribute.KeyValue {
- return FaaSNameKey.String(val)
-}
-
-// FaaSID returns an attribute KeyValue conforming to the "faas.id" semantic
-// conventions. It represents the unique ID of the single function that this
-// runtime instance executes.
-func FaaSID(val string) attribute.KeyValue {
- return FaaSIDKey.String(val)
-}
-
-// FaaSVersion returns an attribute KeyValue conforming to the
-// "faas.version" semantic conventions. It represents the immutable version of
-// the function being executed.
-func FaaSVersion(val string) attribute.KeyValue {
- return FaaSVersionKey.String(val)
-}
-
-// FaaSInstance returns an attribute KeyValue conforming to the
-// "faas.instance" semantic conventions. It represents the execution
-// environment ID as a string, that will be potentially reused for other
-// invocations to the same function/function version.
-func FaaSInstance(val string) attribute.KeyValue {
- return FaaSInstanceKey.String(val)
-}
-
-// FaaSMaxMemory returns an attribute KeyValue conforming to the
-// "faas.max_memory" semantic conventions. It represents the amount of memory
-// available to the serverless function in MiB.
-func FaaSMaxMemory(val int) attribute.KeyValue {
- return FaaSMaxMemoryKey.Int(val)
-}
-
-// A host is defined as a general computing instance.
-const (
- // HostIDKey is the attribute Key conforming to the "host.id" semantic
- // conventions. It represents the unique host ID. For Cloud, this must be
- // the instance_id assigned by the cloud provider. For non-containerized
- // Linux systems, the `machine-id` located in `/etc/machine-id` or
- // `/var/lib/dbus/machine-id` may be used.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'fdbf79e8af94cb7f9e8df36789187052'
- HostIDKey = attribute.Key("host.id")
-
- // HostNameKey is the attribute Key conforming to the "host.name" semantic
- // conventions. It represents the name of the host. On Unix systems, it may
- // contain what the hostname command returns, or the fully qualified
- // hostname, or another name specified by the user.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry-test'
- HostNameKey = attribute.Key("host.name")
-
- // HostTypeKey is the attribute Key conforming to the "host.type" semantic
- // conventions. It represents the type of host. For Cloud, this must be the
- // machine type.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'n1-standard-1'
- HostTypeKey = attribute.Key("host.type")
-
- // HostArchKey is the attribute Key conforming to the "host.arch" semantic
- // conventions. It represents the CPU architecture the host system is
- // running on.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- HostArchKey = attribute.Key("host.arch")
-
- // HostImageNameKey is the attribute Key conforming to the
- // "host.image.name" semantic conventions. It represents the name of the VM
- // image or OS install the host was instantiated from.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'infra-ami-eks-worker-node-7d4ec78312', 'CentOS-8-x86_64-1905'
- HostImageNameKey = attribute.Key("host.image.name")
-
- // HostImageIDKey is the attribute Key conforming to the "host.image.id"
- // semantic conventions. It represents the vM image ID. For Cloud, this
- // value is from the provider.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'ami-07b06b442921831e5'
- HostImageIDKey = attribute.Key("host.image.id")
-
- // HostImageVersionKey is the attribute Key conforming to the
- // "host.image.version" semantic conventions. It represents the version
- // string of the VM image as defined in [Version
- // Attributes](README.md#version-attributes).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '0.1'
- HostImageVersionKey = attribute.Key("host.image.version")
-)
-
-var (
- // AMD64
- HostArchAMD64 = HostArchKey.String("amd64")
- // ARM32
- HostArchARM32 = HostArchKey.String("arm32")
- // ARM64
- HostArchARM64 = HostArchKey.String("arm64")
- // Itanium
- HostArchIA64 = HostArchKey.String("ia64")
- // 32-bit PowerPC
- HostArchPPC32 = HostArchKey.String("ppc32")
- // 64-bit PowerPC
- HostArchPPC64 = HostArchKey.String("ppc64")
- // IBM z/Architecture
- HostArchS390x = HostArchKey.String("s390x")
- // 32-bit x86
- HostArchX86 = HostArchKey.String("x86")
-)
-
-// HostID returns an attribute KeyValue conforming to the "host.id" semantic
-// conventions. It represents the unique host ID. For Cloud, this must be the
-// instance_id assigned by the cloud provider. For non-containerized Linux
-// systems, the `machine-id` located in `/etc/machine-id` or
-// `/var/lib/dbus/machine-id` may be used.
-func HostID(val string) attribute.KeyValue {
- return HostIDKey.String(val)
-}
-
-// HostName returns an attribute KeyValue conforming to the "host.name"
-// semantic conventions. It represents the name of the host. On Unix systems,
-// it may contain what the hostname command returns, or the fully qualified
-// hostname, or another name specified by the user.
-func HostName(val string) attribute.KeyValue {
- return HostNameKey.String(val)
-}
-
-// HostType returns an attribute KeyValue conforming to the "host.type"
-// semantic conventions. It represents the type of host. For Cloud, this must
-// be the machine type.
-func HostType(val string) attribute.KeyValue {
- return HostTypeKey.String(val)
-}
-
-// HostImageName returns an attribute KeyValue conforming to the
-// "host.image.name" semantic conventions. It represents the name of the VM
-// image or OS install the host was instantiated from.
-func HostImageName(val string) attribute.KeyValue {
- return HostImageNameKey.String(val)
-}
-
-// HostImageID returns an attribute KeyValue conforming to the
-// "host.image.id" semantic conventions. It represents the vM image ID. For
-// Cloud, this value is from the provider.
-func HostImageID(val string) attribute.KeyValue {
- return HostImageIDKey.String(val)
-}
-
-// HostImageVersion returns an attribute KeyValue conforming to the
-// "host.image.version" semantic conventions. It represents the version string
-// of the VM image as defined in [Version
-// Attributes](README.md#version-attributes).
-func HostImageVersion(val string) attribute.KeyValue {
- return HostImageVersionKey.String(val)
-}
-
-// A Kubernetes Cluster.
-const (
- // K8SClusterNameKey is the attribute Key conforming to the
- // "k8s.cluster.name" semantic conventions. It represents the name of the
- // cluster.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry-cluster'
- K8SClusterNameKey = attribute.Key("k8s.cluster.name")
-)
-
-// K8SClusterName returns an attribute KeyValue conforming to the
-// "k8s.cluster.name" semantic conventions. It represents the name of the
-// cluster.
-func K8SClusterName(val string) attribute.KeyValue {
- return K8SClusterNameKey.String(val)
-}
-
-// A Kubernetes Node object.
-const (
- // K8SNodeNameKey is the attribute Key conforming to the "k8s.node.name"
- // semantic conventions. It represents the name of the Node.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'node-1'
- K8SNodeNameKey = attribute.Key("k8s.node.name")
-
- // K8SNodeUIDKey is the attribute Key conforming to the "k8s.node.uid"
- // semantic conventions. It represents the UID of the Node.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '1eb3a0c6-0477-4080-a9cb-0cb7db65c6a2'
- K8SNodeUIDKey = attribute.Key("k8s.node.uid")
-)
-
-// K8SNodeName returns an attribute KeyValue conforming to the
-// "k8s.node.name" semantic conventions. It represents the name of the Node.
-func K8SNodeName(val string) attribute.KeyValue {
- return K8SNodeNameKey.String(val)
-}
-
-// K8SNodeUID returns an attribute KeyValue conforming to the "k8s.node.uid"
-// semantic conventions. It represents the UID of the Node.
-func K8SNodeUID(val string) attribute.KeyValue {
- return K8SNodeUIDKey.String(val)
-}
-
-// A Kubernetes Namespace.
-const (
- // K8SNamespaceNameKey is the attribute Key conforming to the
- // "k8s.namespace.name" semantic conventions. It represents the name of the
- // namespace that the pod is running in.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'default'
- K8SNamespaceNameKey = attribute.Key("k8s.namespace.name")
-)
-
-// K8SNamespaceName returns an attribute KeyValue conforming to the
-// "k8s.namespace.name" semantic conventions. It represents the name of the
-// namespace that the pod is running in.
-func K8SNamespaceName(val string) attribute.KeyValue {
- return K8SNamespaceNameKey.String(val)
-}
-
-// A Kubernetes Pod object.
-const (
- // K8SPodUIDKey is the attribute Key conforming to the "k8s.pod.uid"
- // semantic conventions. It represents the UID of the Pod.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff'
- K8SPodUIDKey = attribute.Key("k8s.pod.uid")
-
- // K8SPodNameKey is the attribute Key conforming to the "k8s.pod.name"
- // semantic conventions. It represents the name of the Pod.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry-pod-autoconf'
- K8SPodNameKey = attribute.Key("k8s.pod.name")
-)
-
-// K8SPodUID returns an attribute KeyValue conforming to the "k8s.pod.uid"
-// semantic conventions. It represents the UID of the Pod.
-func K8SPodUID(val string) attribute.KeyValue {
- return K8SPodUIDKey.String(val)
-}
-
-// K8SPodName returns an attribute KeyValue conforming to the "k8s.pod.name"
-// semantic conventions. It represents the name of the Pod.
-func K8SPodName(val string) attribute.KeyValue {
- return K8SPodNameKey.String(val)
-}
-
-// A container in a
-// [PodTemplate](https://kubernetes.io/docs/concepts/workloads/pods/#pod-templates).
-const (
- // K8SContainerNameKey is the attribute Key conforming to the
- // "k8s.container.name" semantic conventions. It represents the name of the
- // Container from Pod specification, must be unique within a Pod. Container
- // runtime usually uses different globally unique name (`container.name`).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'redis'
- K8SContainerNameKey = attribute.Key("k8s.container.name")
-
- // K8SContainerRestartCountKey is the attribute Key conforming to the
- // "k8s.container.restart_count" semantic conventions. It represents the
- // number of times the container was restarted. This attribute can be used
- // to identify a particular container (running or stopped) within a
- // container spec.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 0, 2
- K8SContainerRestartCountKey = attribute.Key("k8s.container.restart_count")
-)
-
-// K8SContainerName returns an attribute KeyValue conforming to the
-// "k8s.container.name" semantic conventions. It represents the name of the
-// Container from Pod specification, must be unique within a Pod. Container
-// runtime usually uses different globally unique name (`container.name`).
-func K8SContainerName(val string) attribute.KeyValue {
- return K8SContainerNameKey.String(val)
-}
-
-// K8SContainerRestartCount returns an attribute KeyValue conforming to the
-// "k8s.container.restart_count" semantic conventions. It represents the number
-// of times the container was restarted. This attribute can be used to identify
-// a particular container (running or stopped) within a container spec.
-func K8SContainerRestartCount(val int) attribute.KeyValue {
- return K8SContainerRestartCountKey.Int(val)
-}
-
-// A Kubernetes ReplicaSet object.
-const (
- // K8SReplicaSetUIDKey is the attribute Key conforming to the
- // "k8s.replicaset.uid" semantic conventions. It represents the UID of the
- // ReplicaSet.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff'
- K8SReplicaSetUIDKey = attribute.Key("k8s.replicaset.uid")
-
- // K8SReplicaSetNameKey is the attribute Key conforming to the
- // "k8s.replicaset.name" semantic conventions. It represents the name of
- // the ReplicaSet.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry'
- K8SReplicaSetNameKey = attribute.Key("k8s.replicaset.name")
-)
-
-// K8SReplicaSetUID returns an attribute KeyValue conforming to the
-// "k8s.replicaset.uid" semantic conventions. It represents the UID of the
-// ReplicaSet.
-func K8SReplicaSetUID(val string) attribute.KeyValue {
- return K8SReplicaSetUIDKey.String(val)
-}
-
-// K8SReplicaSetName returns an attribute KeyValue conforming to the
-// "k8s.replicaset.name" semantic conventions. It represents the name of the
-// ReplicaSet.
-func K8SReplicaSetName(val string) attribute.KeyValue {
- return K8SReplicaSetNameKey.String(val)
-}
-
-// A Kubernetes Deployment object.
-const (
- // K8SDeploymentUIDKey is the attribute Key conforming to the
- // "k8s.deployment.uid" semantic conventions. It represents the UID of the
- // Deployment.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff'
- K8SDeploymentUIDKey = attribute.Key("k8s.deployment.uid")
-
- // K8SDeploymentNameKey is the attribute Key conforming to the
- // "k8s.deployment.name" semantic conventions. It represents the name of
- // the Deployment.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry'
- K8SDeploymentNameKey = attribute.Key("k8s.deployment.name")
-)
-
-// K8SDeploymentUID returns an attribute KeyValue conforming to the
-// "k8s.deployment.uid" semantic conventions. It represents the UID of the
-// Deployment.
-func K8SDeploymentUID(val string) attribute.KeyValue {
- return K8SDeploymentUIDKey.String(val)
-}
-
-// K8SDeploymentName returns an attribute KeyValue conforming to the
-// "k8s.deployment.name" semantic conventions. It represents the name of the
-// Deployment.
-func K8SDeploymentName(val string) attribute.KeyValue {
- return K8SDeploymentNameKey.String(val)
-}
-
-// A Kubernetes StatefulSet object.
-const (
- // K8SStatefulSetUIDKey is the attribute Key conforming to the
- // "k8s.statefulset.uid" semantic conventions. It represents the UID of the
- // StatefulSet.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff'
- K8SStatefulSetUIDKey = attribute.Key("k8s.statefulset.uid")
-
- // K8SStatefulSetNameKey is the attribute Key conforming to the
- // "k8s.statefulset.name" semantic conventions. It represents the name of
- // the StatefulSet.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry'
- K8SStatefulSetNameKey = attribute.Key("k8s.statefulset.name")
-)
-
-// K8SStatefulSetUID returns an attribute KeyValue conforming to the
-// "k8s.statefulset.uid" semantic conventions. It represents the UID of the
-// StatefulSet.
-func K8SStatefulSetUID(val string) attribute.KeyValue {
- return K8SStatefulSetUIDKey.String(val)
-}
-
-// K8SStatefulSetName returns an attribute KeyValue conforming to the
-// "k8s.statefulset.name" semantic conventions. It represents the name of the
-// StatefulSet.
-func K8SStatefulSetName(val string) attribute.KeyValue {
- return K8SStatefulSetNameKey.String(val)
-}
-
-// A Kubernetes DaemonSet object.
-const (
- // K8SDaemonSetUIDKey is the attribute Key conforming to the
- // "k8s.daemonset.uid" semantic conventions. It represents the UID of the
- // DaemonSet.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff'
- K8SDaemonSetUIDKey = attribute.Key("k8s.daemonset.uid")
-
- // K8SDaemonSetNameKey is the attribute Key conforming to the
- // "k8s.daemonset.name" semantic conventions. It represents the name of the
- // DaemonSet.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry'
- K8SDaemonSetNameKey = attribute.Key("k8s.daemonset.name")
-)
-
-// K8SDaemonSetUID returns an attribute KeyValue conforming to the
-// "k8s.daemonset.uid" semantic conventions. It represents the UID of the
-// DaemonSet.
-func K8SDaemonSetUID(val string) attribute.KeyValue {
- return K8SDaemonSetUIDKey.String(val)
-}
-
-// K8SDaemonSetName returns an attribute KeyValue conforming to the
-// "k8s.daemonset.name" semantic conventions. It represents the name of the
-// DaemonSet.
-func K8SDaemonSetName(val string) attribute.KeyValue {
- return K8SDaemonSetNameKey.String(val)
-}
-
-// A Kubernetes Job object.
-const (
- // K8SJobUIDKey is the attribute Key conforming to the "k8s.job.uid"
- // semantic conventions. It represents the UID of the Job.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff'
- K8SJobUIDKey = attribute.Key("k8s.job.uid")
-
- // K8SJobNameKey is the attribute Key conforming to the "k8s.job.name"
- // semantic conventions. It represents the name of the Job.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry'
- K8SJobNameKey = attribute.Key("k8s.job.name")
-)
-
-// K8SJobUID returns an attribute KeyValue conforming to the "k8s.job.uid"
-// semantic conventions. It represents the UID of the Job.
-func K8SJobUID(val string) attribute.KeyValue {
- return K8SJobUIDKey.String(val)
-}
-
-// K8SJobName returns an attribute KeyValue conforming to the "k8s.job.name"
-// semantic conventions. It represents the name of the Job.
-func K8SJobName(val string) attribute.KeyValue {
- return K8SJobNameKey.String(val)
-}
-
-// A Kubernetes CronJob object.
-const (
- // K8SCronJobUIDKey is the attribute Key conforming to the
- // "k8s.cronjob.uid" semantic conventions. It represents the UID of the
- // CronJob.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff'
- K8SCronJobUIDKey = attribute.Key("k8s.cronjob.uid")
-
- // K8SCronJobNameKey is the attribute Key conforming to the
- // "k8s.cronjob.name" semantic conventions. It represents the name of the
- // CronJob.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry'
- K8SCronJobNameKey = attribute.Key("k8s.cronjob.name")
-)
-
-// K8SCronJobUID returns an attribute KeyValue conforming to the
-// "k8s.cronjob.uid" semantic conventions. It represents the UID of the
-// CronJob.
-func K8SCronJobUID(val string) attribute.KeyValue {
- return K8SCronJobUIDKey.String(val)
-}
-
-// K8SCronJobName returns an attribute KeyValue conforming to the
-// "k8s.cronjob.name" semantic conventions. It represents the name of the
-// CronJob.
-func K8SCronJobName(val string) attribute.KeyValue {
- return K8SCronJobNameKey.String(val)
-}
-
-// The operating system (OS) on which the process represented by this resource
-// is running.
-const (
- // OSTypeKey is the attribute Key conforming to the "os.type" semantic
- // conventions. It represents the operating system type.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- OSTypeKey = attribute.Key("os.type")
-
- // OSDescriptionKey is the attribute Key conforming to the "os.description"
- // semantic conventions. It represents the human readable (not intended to
- // be parsed) OS version information, like e.g. reported by `ver` or
- // `lsb_release -a` commands.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Microsoft Windows [Version 10.0.18363.778]', 'Ubuntu 18.04.1
- // LTS'
- OSDescriptionKey = attribute.Key("os.description")
-
- // OSNameKey is the attribute Key conforming to the "os.name" semantic
- // conventions. It represents the human readable operating system name.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'iOS', 'Android', 'Ubuntu'
- OSNameKey = attribute.Key("os.name")
-
- // OSVersionKey is the attribute Key conforming to the "os.version"
- // semantic conventions. It represents the version string of the operating
- // system as defined in [Version
- // Attributes](../../resource/semantic_conventions/README.md#version-attributes).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '14.2.1', '18.04.1'
- OSVersionKey = attribute.Key("os.version")
-)
-
-var (
- // Microsoft Windows
- OSTypeWindows = OSTypeKey.String("windows")
- // Linux
- OSTypeLinux = OSTypeKey.String("linux")
- // Apple Darwin
- OSTypeDarwin = OSTypeKey.String("darwin")
- // FreeBSD
- OSTypeFreeBSD = OSTypeKey.String("freebsd")
- // NetBSD
- OSTypeNetBSD = OSTypeKey.String("netbsd")
- // OpenBSD
- OSTypeOpenBSD = OSTypeKey.String("openbsd")
- // DragonFly BSD
- OSTypeDragonflyBSD = OSTypeKey.String("dragonflybsd")
- // HP-UX (Hewlett Packard Unix)
- OSTypeHPUX = OSTypeKey.String("hpux")
- // AIX (Advanced Interactive eXecutive)
- OSTypeAIX = OSTypeKey.String("aix")
- // SunOS, Oracle Solaris
- OSTypeSolaris = OSTypeKey.String("solaris")
- // IBM z/OS
- OSTypeZOS = OSTypeKey.String("z_os")
-)
-
-// OSDescription returns an attribute KeyValue conforming to the
-// "os.description" semantic conventions. It represents the human readable (not
-// intended to be parsed) OS version information, like e.g. reported by `ver`
-// or `lsb_release -a` commands.
-func OSDescription(val string) attribute.KeyValue {
- return OSDescriptionKey.String(val)
-}
-
-// OSName returns an attribute KeyValue conforming to the "os.name" semantic
-// conventions. It represents the human readable operating system name.
-func OSName(val string) attribute.KeyValue {
- return OSNameKey.String(val)
-}
-
-// OSVersion returns an attribute KeyValue conforming to the "os.version"
-// semantic conventions. It represents the version string of the operating
-// system as defined in [Version
-// Attributes](../../resource/semantic_conventions/README.md#version-attributes).
-func OSVersion(val string) attribute.KeyValue {
- return OSVersionKey.String(val)
-}
-
-// An operating system process.
-const (
- // ProcessPIDKey is the attribute Key conforming to the "process.pid"
- // semantic conventions. It represents the process identifier (PID).
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 1234
- ProcessPIDKey = attribute.Key("process.pid")
-
- // ProcessParentPIDKey is the attribute Key conforming to the
- // "process.parent_pid" semantic conventions. It represents the parent
- // Process identifier (PID).
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 111
- ProcessParentPIDKey = attribute.Key("process.parent_pid")
-
- // ProcessExecutableNameKey is the attribute Key conforming to the
- // "process.executable.name" semantic conventions. It represents the name
- // of the process executable. On Linux based systems, can be set to the
- // `Name` in `proc/[pid]/status`. On Windows, can be set to the base name
- // of `GetProcessImageFileNameW`.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (See alternative attributes
- // below.)
- // Stability: stable
- // Examples: 'otelcol'
- ProcessExecutableNameKey = attribute.Key("process.executable.name")
-
- // ProcessExecutablePathKey is the attribute Key conforming to the
- // "process.executable.path" semantic conventions. It represents the full
- // path to the process executable. On Linux based systems, can be set to
- // the target of `proc/[pid]/exe`. On Windows, can be set to the result of
- // `GetProcessImageFileNameW`.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (See alternative attributes
- // below.)
- // Stability: stable
- // Examples: '/usr/bin/cmd/otelcol'
- ProcessExecutablePathKey = attribute.Key("process.executable.path")
-
- // ProcessCommandKey is the attribute Key conforming to the
- // "process.command" semantic conventions. It represents the command used
- // to launch the process (i.e. the command name). On Linux based systems,
- // can be set to the zeroth string in `proc/[pid]/cmdline`. On Windows, can
- // be set to the first parameter extracted from `GetCommandLineW`.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (See alternative attributes
- // below.)
- // Stability: stable
- // Examples: 'cmd/otelcol'
- ProcessCommandKey = attribute.Key("process.command")
-
- // ProcessCommandLineKey is the attribute Key conforming to the
- // "process.command_line" semantic conventions. It represents the full
- // command used to launch the process as a single string representing the
- // full command. On Windows, can be set to the result of `GetCommandLineW`.
- // Do not set this if you have to assemble it just for monitoring; use
- // `process.command_args` instead.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (See alternative attributes
- // below.)
- // Stability: stable
- // Examples: 'C:\\cmd\\otecol --config="my directory\\config.yaml"'
- ProcessCommandLineKey = attribute.Key("process.command_line")
-
- // ProcessCommandArgsKey is the attribute Key conforming to the
- // "process.command_args" semantic conventions. It represents the all the
- // command arguments (including the command/executable itself) as received
- // by the process. On Linux-based systems (and some other Unixoid systems
- // supporting procfs), can be set according to the list of null-delimited
- // strings extracted from `proc/[pid]/cmdline`. For libc-based executables,
- // this would be the full argv vector passed to `main`.
- //
- // Type: string[]
- // RequirementLevel: ConditionallyRequired (See alternative attributes
- // below.)
- // Stability: stable
- // Examples: 'cmd/otecol', '--config=config.yaml'
- ProcessCommandArgsKey = attribute.Key("process.command_args")
-
- // ProcessOwnerKey is the attribute Key conforming to the "process.owner"
- // semantic conventions. It represents the username of the user that owns
- // the process.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'root'
- ProcessOwnerKey = attribute.Key("process.owner")
-)
-
-// ProcessPID returns an attribute KeyValue conforming to the "process.pid"
-// semantic conventions. It represents the process identifier (PID).
-func ProcessPID(val int) attribute.KeyValue {
- return ProcessPIDKey.Int(val)
-}
-
-// ProcessParentPID returns an attribute KeyValue conforming to the
-// "process.parent_pid" semantic conventions. It represents the parent Process
-// identifier (PID).
-func ProcessParentPID(val int) attribute.KeyValue {
- return ProcessParentPIDKey.Int(val)
-}
-
-// ProcessExecutableName returns an attribute KeyValue conforming to the
-// "process.executable.name" semantic conventions. It represents the name of
-// the process executable. On Linux based systems, can be set to the `Name` in
-// `proc/[pid]/status`. On Windows, can be set to the base name of
-// `GetProcessImageFileNameW`.
-func ProcessExecutableName(val string) attribute.KeyValue {
- return ProcessExecutableNameKey.String(val)
-}
-
-// ProcessExecutablePath returns an attribute KeyValue conforming to the
-// "process.executable.path" semantic conventions. It represents the full path
-// to the process executable. On Linux based systems, can be set to the target
-// of `proc/[pid]/exe`. On Windows, can be set to the result of
-// `GetProcessImageFileNameW`.
-func ProcessExecutablePath(val string) attribute.KeyValue {
- return ProcessExecutablePathKey.String(val)
-}
-
-// ProcessCommand returns an attribute KeyValue conforming to the
-// "process.command" semantic conventions. It represents the command used to
-// launch the process (i.e. the command name). On Linux based systems, can be
-// set to the zeroth string in `proc/[pid]/cmdline`. On Windows, can be set to
-// the first parameter extracted from `GetCommandLineW`.
-func ProcessCommand(val string) attribute.KeyValue {
- return ProcessCommandKey.String(val)
-}
-
-// ProcessCommandLine returns an attribute KeyValue conforming to the
-// "process.command_line" semantic conventions. It represents the full command
-// used to launch the process as a single string representing the full command.
-// On Windows, can be set to the result of `GetCommandLineW`. Do not set this
-// if you have to assemble it just for monitoring; use `process.command_args`
-// instead.
-func ProcessCommandLine(val string) attribute.KeyValue {
- return ProcessCommandLineKey.String(val)
-}
-
-// ProcessCommandArgs returns an attribute KeyValue conforming to the
-// "process.command_args" semantic conventions. It represents the all the
-// command arguments (including the command/executable itself) as received by
-// the process. On Linux-based systems (and some other Unixoid systems
-// supporting procfs), can be set according to the list of null-delimited
-// strings extracted from `proc/[pid]/cmdline`. For libc-based executables,
-// this would be the full argv vector passed to `main`.
-func ProcessCommandArgs(val ...string) attribute.KeyValue {
- return ProcessCommandArgsKey.StringSlice(val)
-}
-
-// ProcessOwner returns an attribute KeyValue conforming to the
-// "process.owner" semantic conventions. It represents the username of the user
-// that owns the process.
-func ProcessOwner(val string) attribute.KeyValue {
- return ProcessOwnerKey.String(val)
-}
-
-// The single (language) runtime instance which is monitored.
-const (
- // ProcessRuntimeNameKey is the attribute Key conforming to the
- // "process.runtime.name" semantic conventions. It represents the name of
- // the runtime of this process. For compiled native binaries, this SHOULD
- // be the name of the compiler.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'OpenJDK Runtime Environment'
- ProcessRuntimeNameKey = attribute.Key("process.runtime.name")
-
- // ProcessRuntimeVersionKey is the attribute Key conforming to the
- // "process.runtime.version" semantic conventions. It represents the
- // version of the runtime of this process, as returned by the runtime
- // without modification.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '14.0.2'
- ProcessRuntimeVersionKey = attribute.Key("process.runtime.version")
-
- // ProcessRuntimeDescriptionKey is the attribute Key conforming to the
- // "process.runtime.description" semantic conventions. It represents an
- // additional description about the runtime of the process, for example a
- // specific vendor customization of the runtime environment.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Eclipse OpenJ9 Eclipse OpenJ9 VM openj9-0.21.0'
- ProcessRuntimeDescriptionKey = attribute.Key("process.runtime.description")
-)
-
-// ProcessRuntimeName returns an attribute KeyValue conforming to the
-// "process.runtime.name" semantic conventions. It represents the name of the
-// runtime of this process. For compiled native binaries, this SHOULD be the
-// name of the compiler.
-func ProcessRuntimeName(val string) attribute.KeyValue {
- return ProcessRuntimeNameKey.String(val)
-}
-
-// ProcessRuntimeVersion returns an attribute KeyValue conforming to the
-// "process.runtime.version" semantic conventions. It represents the version of
-// the runtime of this process, as returned by the runtime without
-// modification.
-func ProcessRuntimeVersion(val string) attribute.KeyValue {
- return ProcessRuntimeVersionKey.String(val)
-}
-
-// ProcessRuntimeDescription returns an attribute KeyValue conforming to the
-// "process.runtime.description" semantic conventions. It represents an
-// additional description about the runtime of the process, for example a
-// specific vendor customization of the runtime environment.
-func ProcessRuntimeDescription(val string) attribute.KeyValue {
- return ProcessRuntimeDescriptionKey.String(val)
-}
-
-// A service instance.
-const (
- // ServiceNameKey is the attribute Key conforming to the "service.name"
- // semantic conventions. It represents the logical name of the service.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'shoppingcart'
- // Note: MUST be the same for all instances of horizontally scaled
- // services. If the value was not specified, SDKs MUST fallback to
- // `unknown_service:` concatenated with
- // [`process.executable.name`](process.md#process), e.g.
- // `unknown_service:bash`. If `process.executable.name` is not available,
- // the value MUST be set to `unknown_service`.
- ServiceNameKey = attribute.Key("service.name")
-
- // ServiceNamespaceKey is the attribute Key conforming to the
- // "service.namespace" semantic conventions. It represents a namespace for
- // `service.name`.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Shop'
- // Note: A string value having a meaning that helps to distinguish a group
- // of services, for example the team name that owns a group of services.
- // `service.name` is expected to be unique within the same namespace. If
- // `service.namespace` is not specified in the Resource then `service.name`
- // is expected to be unique for all services that have no explicit
- // namespace defined (so the empty/unspecified namespace is simply one more
- // valid namespace). Zero-length namespace string is assumed equal to
- // unspecified namespace.
- ServiceNamespaceKey = attribute.Key("service.namespace")
-
- // ServiceInstanceIDKey is the attribute Key conforming to the
- // "service.instance.id" semantic conventions. It represents the string ID
- // of the service instance.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '627cc493-f310-47de-96bd-71410b7dec09'
- // Note: MUST be unique for each instance of the same
- // `service.namespace,service.name` pair (in other words
- // `service.namespace,service.name,service.instance.id` triplet MUST be
- // globally unique). The ID helps to distinguish instances of the same
- // service that exist at the same time (e.g. instances of a horizontally
- // scaled service). It is preferable for the ID to be persistent and stay
- // the same for the lifetime of the service instance, however it is
- // acceptable that the ID is ephemeral and changes during important
- // lifetime events for the service (e.g. service restarts). If the service
- // has no inherent unique ID that can be used as the value of this
- // attribute it is recommended to generate a random Version 1 or Version 4
- // RFC 4122 UUID (services aiming for reproducible UUIDs may also use
- // Version 5, see RFC 4122 for more recommendations).
- ServiceInstanceIDKey = attribute.Key("service.instance.id")
-
- // ServiceVersionKey is the attribute Key conforming to the
- // "service.version" semantic conventions. It represents the version string
- // of the service API or implementation.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '2.0.0'
- ServiceVersionKey = attribute.Key("service.version")
-)
-
-// ServiceName returns an attribute KeyValue conforming to the
-// "service.name" semantic conventions. It represents the logical name of the
-// service.
-func ServiceName(val string) attribute.KeyValue {
- return ServiceNameKey.String(val)
-}
-
-// ServiceNamespace returns an attribute KeyValue conforming to the
-// "service.namespace" semantic conventions. It represents a namespace for
-// `service.name`.
-func ServiceNamespace(val string) attribute.KeyValue {
- return ServiceNamespaceKey.String(val)
-}
-
-// ServiceInstanceID returns an attribute KeyValue conforming to the
-// "service.instance.id" semantic conventions. It represents the string ID of
-// the service instance.
-func ServiceInstanceID(val string) attribute.KeyValue {
- return ServiceInstanceIDKey.String(val)
-}
-
-// ServiceVersion returns an attribute KeyValue conforming to the
-// "service.version" semantic conventions. It represents the version string of
-// the service API or implementation.
-func ServiceVersion(val string) attribute.KeyValue {
- return ServiceVersionKey.String(val)
-}
-
-// The telemetry SDK used to capture data recorded by the instrumentation
-// libraries.
-const (
- // TelemetrySDKNameKey is the attribute Key conforming to the
- // "telemetry.sdk.name" semantic conventions. It represents the name of the
- // telemetry SDK as defined above.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'opentelemetry'
- TelemetrySDKNameKey = attribute.Key("telemetry.sdk.name")
-
- // TelemetrySDKLanguageKey is the attribute Key conforming to the
- // "telemetry.sdk.language" semantic conventions. It represents the
- // language of the telemetry SDK.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- TelemetrySDKLanguageKey = attribute.Key("telemetry.sdk.language")
-
- // TelemetrySDKVersionKey is the attribute Key conforming to the
- // "telemetry.sdk.version" semantic conventions. It represents the version
- // string of the telemetry SDK.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '1.2.3'
- TelemetrySDKVersionKey = attribute.Key("telemetry.sdk.version")
-
- // TelemetryAutoVersionKey is the attribute Key conforming to the
- // "telemetry.auto.version" semantic conventions. It represents the version
- // string of the auto instrumentation agent, if used.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '1.2.3'
- TelemetryAutoVersionKey = attribute.Key("telemetry.auto.version")
-)
-
-var (
- // cpp
- TelemetrySDKLanguageCPP = TelemetrySDKLanguageKey.String("cpp")
- // dotnet
- TelemetrySDKLanguageDotnet = TelemetrySDKLanguageKey.String("dotnet")
- // erlang
- TelemetrySDKLanguageErlang = TelemetrySDKLanguageKey.String("erlang")
- // go
- TelemetrySDKLanguageGo = TelemetrySDKLanguageKey.String("go")
- // java
- TelemetrySDKLanguageJava = TelemetrySDKLanguageKey.String("java")
- // nodejs
- TelemetrySDKLanguageNodejs = TelemetrySDKLanguageKey.String("nodejs")
- // php
- TelemetrySDKLanguagePHP = TelemetrySDKLanguageKey.String("php")
- // python
- TelemetrySDKLanguagePython = TelemetrySDKLanguageKey.String("python")
- // ruby
- TelemetrySDKLanguageRuby = TelemetrySDKLanguageKey.String("ruby")
- // webjs
- TelemetrySDKLanguageWebjs = TelemetrySDKLanguageKey.String("webjs")
- // swift
- TelemetrySDKLanguageSwift = TelemetrySDKLanguageKey.String("swift")
-)
-
-// TelemetrySDKName returns an attribute KeyValue conforming to the
-// "telemetry.sdk.name" semantic conventions. It represents the name of the
-// telemetry SDK as defined above.
-func TelemetrySDKName(val string) attribute.KeyValue {
- return TelemetrySDKNameKey.String(val)
-}
-
-// TelemetrySDKVersion returns an attribute KeyValue conforming to the
-// "telemetry.sdk.version" semantic conventions. It represents the version
-// string of the telemetry SDK.
-func TelemetrySDKVersion(val string) attribute.KeyValue {
- return TelemetrySDKVersionKey.String(val)
-}
-
-// TelemetryAutoVersion returns an attribute KeyValue conforming to the
-// "telemetry.auto.version" semantic conventions. It represents the version
-// string of the auto instrumentation agent, if used.
-func TelemetryAutoVersion(val string) attribute.KeyValue {
- return TelemetryAutoVersionKey.String(val)
-}
-
-// Resource describing the packaged software running the application code. Web
-// engines are typically executed using process.runtime.
-const (
- // WebEngineNameKey is the attribute Key conforming to the "webengine.name"
- // semantic conventions. It represents the name of the web engine.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'WildFly'
- WebEngineNameKey = attribute.Key("webengine.name")
-
- // WebEngineVersionKey is the attribute Key conforming to the
- // "webengine.version" semantic conventions. It represents the version of
- // the web engine.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '21.0.0'
- WebEngineVersionKey = attribute.Key("webengine.version")
-
- // WebEngineDescriptionKey is the attribute Key conforming to the
- // "webengine.description" semantic conventions. It represents the
- // additional description of the web engine (e.g. detailed version and
- // edition information).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'WildFly Full 21.0.0.Final (WildFly Core 13.0.1.Final) -
- // 2.2.2.Final'
- WebEngineDescriptionKey = attribute.Key("webengine.description")
-)
-
-// WebEngineName returns an attribute KeyValue conforming to the
-// "webengine.name" semantic conventions. It represents the name of the web
-// engine.
-func WebEngineName(val string) attribute.KeyValue {
- return WebEngineNameKey.String(val)
-}
-
-// WebEngineVersion returns an attribute KeyValue conforming to the
-// "webengine.version" semantic conventions. It represents the version of the
-// web engine.
-func WebEngineVersion(val string) attribute.KeyValue {
- return WebEngineVersionKey.String(val)
-}
-
-// WebEngineDescription returns an attribute KeyValue conforming to the
-// "webengine.description" semantic conventions. It represents the additional
-// description of the web engine (e.g. detailed version and edition
-// information).
-func WebEngineDescription(val string) attribute.KeyValue {
- return WebEngineDescriptionKey.String(val)
-}
-
-// Attributes used by non-OTLP exporters to represent OpenTelemetry Scope's
-// concepts.
-const (
- // OtelScopeNameKey is the attribute Key conforming to the
- // "otel.scope.name" semantic conventions. It represents the name of the
- // instrumentation scope - (`InstrumentationScope.Name` in OTLP).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'io.opentelemetry.contrib.mongodb'
- OtelScopeNameKey = attribute.Key("otel.scope.name")
-
- // OtelScopeVersionKey is the attribute Key conforming to the
- // "otel.scope.version" semantic conventions. It represents the version of
- // the instrumentation scope - (`InstrumentationScope.Version` in OTLP).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '1.0.0'
- OtelScopeVersionKey = attribute.Key("otel.scope.version")
-)
-
-// OtelScopeName returns an attribute KeyValue conforming to the
-// "otel.scope.name" semantic conventions. It represents the name of the
-// instrumentation scope - (`InstrumentationScope.Name` in OTLP).
-func OtelScopeName(val string) attribute.KeyValue {
- return OtelScopeNameKey.String(val)
-}
-
-// OtelScopeVersion returns an attribute KeyValue conforming to the
-// "otel.scope.version" semantic conventions. It represents the version of the
-// instrumentation scope - (`InstrumentationScope.Version` in OTLP).
-func OtelScopeVersion(val string) attribute.KeyValue {
- return OtelScopeVersionKey.String(val)
-}
-
-// Span attributes used by non-OTLP exporters to represent OpenTelemetry
-// Scope's concepts.
-const (
- // OtelLibraryNameKey is the attribute Key conforming to the
- // "otel.library.name" semantic conventions. It represents the deprecated,
- // use the `otel.scope.name` attribute.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: deprecated
- // Examples: 'io.opentelemetry.contrib.mongodb'
- OtelLibraryNameKey = attribute.Key("otel.library.name")
-
- // OtelLibraryVersionKey is the attribute Key conforming to the
- // "otel.library.version" semantic conventions. It represents the
- // deprecated, use the `otel.scope.version` attribute.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: deprecated
- // Examples: '1.0.0'
- OtelLibraryVersionKey = attribute.Key("otel.library.version")
-)
-
-// OtelLibraryName returns an attribute KeyValue conforming to the
-// "otel.library.name" semantic conventions. It represents the deprecated, use
-// the `otel.scope.name` attribute.
-func OtelLibraryName(val string) attribute.KeyValue {
- return OtelLibraryNameKey.String(val)
-}
-
-// OtelLibraryVersion returns an attribute KeyValue conforming to the
-// "otel.library.version" semantic conventions. It represents the deprecated,
-// use the `otel.scope.version` attribute.
-func OtelLibraryVersion(val string) attribute.KeyValue {
- return OtelLibraryVersionKey.String(val)
-}
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/trace.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/trace.go
deleted file mode 100644
index 21497bb6b..000000000
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/trace.go
+++ /dev/null
@@ -1,3364 +0,0 @@
-// Copyright The OpenTelemetry Authors
-// SPDX-License-Identifier: Apache-2.0
-
-// Code generated from semantic convention specification. DO NOT EDIT.
-
-package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0"
-
-import "go.opentelemetry.io/otel/attribute"
-
-// The shared attributes used to report a single exception associated with a
-// span or log.
-const (
- // ExceptionTypeKey is the attribute Key conforming to the "exception.type"
- // semantic conventions. It represents the type of the exception (its
- // fully-qualified class name, if applicable). The dynamic type of the
- // exception should be preferred over the static type in languages that
- // support it.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'java.net.ConnectException', 'OSError'
- ExceptionTypeKey = attribute.Key("exception.type")
-
- // ExceptionMessageKey is the attribute Key conforming to the
- // "exception.message" semantic conventions. It represents the exception
- // message.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Division by zero', "Can't convert 'int' object to str
- // implicitly"
- ExceptionMessageKey = attribute.Key("exception.message")
-
- // ExceptionStacktraceKey is the attribute Key conforming to the
- // "exception.stacktrace" semantic conventions. It represents a stacktrace
- // as a string in the natural representation for the language runtime. The
- // representation is to be determined and documented by each language SIG.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Exception in thread "main" java.lang.RuntimeException: Test
- // exception\\n at '
- // 'com.example.GenerateTrace.methodB(GenerateTrace.java:13)\\n at '
- // 'com.example.GenerateTrace.methodA(GenerateTrace.java:9)\\n at '
- // 'com.example.GenerateTrace.main(GenerateTrace.java:5)'
- ExceptionStacktraceKey = attribute.Key("exception.stacktrace")
-)
-
-// ExceptionType returns an attribute KeyValue conforming to the
-// "exception.type" semantic conventions. It represents the type of the
-// exception (its fully-qualified class name, if applicable). The dynamic type
-// of the exception should be preferred over the static type in languages that
-// support it.
-func ExceptionType(val string) attribute.KeyValue {
- return ExceptionTypeKey.String(val)
-}
-
-// ExceptionMessage returns an attribute KeyValue conforming to the
-// "exception.message" semantic conventions. It represents the exception
-// message.
-func ExceptionMessage(val string) attribute.KeyValue {
- return ExceptionMessageKey.String(val)
-}
-
-// ExceptionStacktrace returns an attribute KeyValue conforming to the
-// "exception.stacktrace" semantic conventions. It represents a stacktrace as a
-// string in the natural representation for the language runtime. The
-// representation is to be determined and documented by each language SIG.
-func ExceptionStacktrace(val string) attribute.KeyValue {
- return ExceptionStacktraceKey.String(val)
-}
-
-// Attributes for Events represented using Log Records.
-const (
- // EventNameKey is the attribute Key conforming to the "event.name"
- // semantic conventions. It represents the name identifies the event.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'click', 'exception'
- EventNameKey = attribute.Key("event.name")
-
- // EventDomainKey is the attribute Key conforming to the "event.domain"
- // semantic conventions. It represents the domain identifies the business
- // context for the events.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- // Note: Events across different domains may have same `event.name`, yet be
- // unrelated events.
- EventDomainKey = attribute.Key("event.domain")
-)
-
-var (
- // Events from browser apps
- EventDomainBrowser = EventDomainKey.String("browser")
- // Events from mobile apps
- EventDomainDevice = EventDomainKey.String("device")
- // Events from Kubernetes
- EventDomainK8S = EventDomainKey.String("k8s")
-)
-
-// EventName returns an attribute KeyValue conforming to the "event.name"
-// semantic conventions. It represents the name identifies the event.
-func EventName(val string) attribute.KeyValue {
- return EventNameKey.String(val)
-}
-
-// Span attributes used by AWS Lambda (in addition to general `faas`
-// attributes).
-const (
- // AWSLambdaInvokedARNKey is the attribute Key conforming to the
- // "aws.lambda.invoked_arn" semantic conventions. It represents the full
- // invoked ARN as provided on the `Context` passed to the function
- // (`Lambda-Runtime-Invoked-Function-ARN` header on the
- // `/runtime/invocation/next` applicable).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'arn:aws:lambda:us-east-1:123456:function:myfunction:myalias'
- // Note: This may be different from `faas.id` if an alias is involved.
- AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn")
-)
-
-// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the
-// "aws.lambda.invoked_arn" semantic conventions. It represents the full
-// invoked ARN as provided on the `Context` passed to the function
-// (`Lambda-Runtime-Invoked-Function-ARN` header on the
-// `/runtime/invocation/next` applicable).
-func AWSLambdaInvokedARN(val string) attribute.KeyValue {
- return AWSLambdaInvokedARNKey.String(val)
-}
-
-// Attributes for CloudEvents. CloudEvents is a specification on how to define
-// event data in a standard way. These attributes can be attached to spans when
-// performing operations with CloudEvents, regardless of the protocol being
-// used.
-const (
- // CloudeventsEventIDKey is the attribute Key conforming to the
- // "cloudevents.event_id" semantic conventions. It represents the
- // [event_id](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id)
- // uniquely identifies the event.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: '123e4567-e89b-12d3-a456-426614174000', '0001'
- CloudeventsEventIDKey = attribute.Key("cloudevents.event_id")
-
- // CloudeventsEventSourceKey is the attribute Key conforming to the
- // "cloudevents.event_source" semantic conventions. It represents the
- // [source](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1)
- // identifies the context in which an event happened.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'https://github.com/cloudevents',
- // '/cloudevents/spec/pull/123', 'my-service'
- CloudeventsEventSourceKey = attribute.Key("cloudevents.event_source")
-
- // CloudeventsEventSpecVersionKey is the attribute Key conforming to the
- // "cloudevents.event_spec_version" semantic conventions. It represents the
- // [version of the CloudEvents
- // specification](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion)
- // which the event uses.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '1.0'
- CloudeventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version")
-
- // CloudeventsEventTypeKey is the attribute Key conforming to the
- // "cloudevents.event_type" semantic conventions. It represents the
- // [event_type](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type)
- // contains a value describing the type of event related to the originating
- // occurrence.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'com.github.pull_request.opened',
- // 'com.example.object.deleted.v2'
- CloudeventsEventTypeKey = attribute.Key("cloudevents.event_type")
-
- // CloudeventsEventSubjectKey is the attribute Key conforming to the
- // "cloudevents.event_subject" semantic conventions. It represents the
- // [subject](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject)
- // of the event in the context of the event producer (identified by
- // source).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'mynewfile.jpg'
- CloudeventsEventSubjectKey = attribute.Key("cloudevents.event_subject")
-)
-
-// CloudeventsEventID returns an attribute KeyValue conforming to the
-// "cloudevents.event_id" semantic conventions. It represents the
-// [event_id](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id)
-// uniquely identifies the event.
-func CloudeventsEventID(val string) attribute.KeyValue {
- return CloudeventsEventIDKey.String(val)
-}
-
-// CloudeventsEventSource returns an attribute KeyValue conforming to the
-// "cloudevents.event_source" semantic conventions. It represents the
-// [source](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1)
-// identifies the context in which an event happened.
-func CloudeventsEventSource(val string) attribute.KeyValue {
- return CloudeventsEventSourceKey.String(val)
-}
-
-// CloudeventsEventSpecVersion returns an attribute KeyValue conforming to
-// the "cloudevents.event_spec_version" semantic conventions. It represents the
-// [version of the CloudEvents
-// specification](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion)
-// which the event uses.
-func CloudeventsEventSpecVersion(val string) attribute.KeyValue {
- return CloudeventsEventSpecVersionKey.String(val)
-}
-
-// CloudeventsEventType returns an attribute KeyValue conforming to the
-// "cloudevents.event_type" semantic conventions. It represents the
-// [event_type](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type)
-// contains a value describing the type of event related to the originating
-// occurrence.
-func CloudeventsEventType(val string) attribute.KeyValue {
- return CloudeventsEventTypeKey.String(val)
-}
-
-// CloudeventsEventSubject returns an attribute KeyValue conforming to the
-// "cloudevents.event_subject" semantic conventions. It represents the
-// [subject](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject)
-// of the event in the context of the event producer (identified by source).
-func CloudeventsEventSubject(val string) attribute.KeyValue {
- return CloudeventsEventSubjectKey.String(val)
-}
-
-// Semantic conventions for the OpenTracing Shim
-const (
- // OpentracingRefTypeKey is the attribute Key conforming to the
- // "opentracing.ref_type" semantic conventions. It represents the
- // parent-child Reference type
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- // Note: The causal relationship between a child Span and a parent Span.
- OpentracingRefTypeKey = attribute.Key("opentracing.ref_type")
-)
-
-var (
- // The parent Span depends on the child Span in some capacity
- OpentracingRefTypeChildOf = OpentracingRefTypeKey.String("child_of")
- // The parent Span does not depend in any way on the result of the child Span
- OpentracingRefTypeFollowsFrom = OpentracingRefTypeKey.String("follows_from")
-)
-
-// The attributes used to perform database client calls.
-const (
- // DBSystemKey is the attribute Key conforming to the "db.system" semantic
- // conventions. It represents an identifier for the database management
- // system (DBMS) product being used. See below for a list of well-known
- // identifiers.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- DBSystemKey = attribute.Key("db.system")
-
- // DBConnectionStringKey is the attribute Key conforming to the
- // "db.connection_string" semantic conventions. It represents the
- // connection string used to connect to the database. It is recommended to
- // remove embedded credentials.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Server=(localdb)\\v11.0;Integrated Security=true;'
- DBConnectionStringKey = attribute.Key("db.connection_string")
-
- // DBUserKey is the attribute Key conforming to the "db.user" semantic
- // conventions. It represents the username for accessing the database.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'readonly_user', 'reporting_user'
- DBUserKey = attribute.Key("db.user")
-
- // DBJDBCDriverClassnameKey is the attribute Key conforming to the
- // "db.jdbc.driver_classname" semantic conventions. It represents the
- // fully-qualified class name of the [Java Database Connectivity
- // (JDBC)](https://docs.oracle.com/javase/8/docs/technotes/guides/jdbc/)
- // driver used to connect.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'org.postgresql.Driver',
- // 'com.microsoft.sqlserver.jdbc.SQLServerDriver'
- DBJDBCDriverClassnameKey = attribute.Key("db.jdbc.driver_classname")
-
- // DBNameKey is the attribute Key conforming to the "db.name" semantic
- // conventions. It represents the this attribute is used to report the name
- // of the database being accessed. For commands that switch the database,
- // this should be set to the target database (even if the command fails).
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (If applicable.)
- // Stability: stable
- // Examples: 'customers', 'main'
- // Note: In some SQL databases, the database name to be used is called
- // "schema name". In case there are multiple layers that could be
- // considered for database name (e.g. Oracle instance name and schema
- // name), the database name to be used is the more specific layer (e.g.
- // Oracle schema name).
- DBNameKey = attribute.Key("db.name")
-
- // DBStatementKey is the attribute Key conforming to the "db.statement"
- // semantic conventions. It represents the database statement being
- // executed.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (If applicable and not
- // explicitly disabled via instrumentation configuration.)
- // Stability: stable
- // Examples: 'SELECT * FROM wuser_table', 'SET mykey "WuValue"'
- // Note: The value may be sanitized to exclude sensitive information.
- DBStatementKey = attribute.Key("db.statement")
-
- // DBOperationKey is the attribute Key conforming to the "db.operation"
- // semantic conventions. It represents the name of the operation being
- // executed, e.g. the [MongoDB command
- // name](https://docs.mongodb.com/manual/reference/command/#database-operations)
- // such as `findAndModify`, or the SQL keyword.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (If `db.statement` is not
- // applicable.)
- // Stability: stable
- // Examples: 'findAndModify', 'HMSET', 'SELECT'
- // Note: When setting this to an SQL keyword, it is not recommended to
- // attempt any client-side parsing of `db.statement` just to get this
- // property, but it should be set if the operation name is provided by the
- // library being instrumented. If the SQL statement has an ambiguous
- // operation, or performs more than one operation, this value may be
- // omitted.
- DBOperationKey = attribute.Key("db.operation")
-)
-
-var (
- // Some other SQL database. Fallback only. See notes
- DBSystemOtherSQL = DBSystemKey.String("other_sql")
- // Microsoft SQL Server
- DBSystemMSSQL = DBSystemKey.String("mssql")
- // MySQL
- DBSystemMySQL = DBSystemKey.String("mysql")
- // Oracle Database
- DBSystemOracle = DBSystemKey.String("oracle")
- // IBM DB2
- DBSystemDB2 = DBSystemKey.String("db2")
- // PostgreSQL
- DBSystemPostgreSQL = DBSystemKey.String("postgresql")
- // Amazon Redshift
- DBSystemRedshift = DBSystemKey.String("redshift")
- // Apache Hive
- DBSystemHive = DBSystemKey.String("hive")
- // Cloudscape
- DBSystemCloudscape = DBSystemKey.String("cloudscape")
- // HyperSQL DataBase
- DBSystemHSQLDB = DBSystemKey.String("hsqldb")
- // Progress Database
- DBSystemProgress = DBSystemKey.String("progress")
- // SAP MaxDB
- DBSystemMaxDB = DBSystemKey.String("maxdb")
- // SAP HANA
- DBSystemHanaDB = DBSystemKey.String("hanadb")
- // Ingres
- DBSystemIngres = DBSystemKey.String("ingres")
- // FirstSQL
- DBSystemFirstSQL = DBSystemKey.String("firstsql")
- // EnterpriseDB
- DBSystemEDB = DBSystemKey.String("edb")
- // InterSystems Caché
- DBSystemCache = DBSystemKey.String("cache")
- // Adabas (Adaptable Database System)
- DBSystemAdabas = DBSystemKey.String("adabas")
- // Firebird
- DBSystemFirebird = DBSystemKey.String("firebird")
- // Apache Derby
- DBSystemDerby = DBSystemKey.String("derby")
- // FileMaker
- DBSystemFilemaker = DBSystemKey.String("filemaker")
- // Informix
- DBSystemInformix = DBSystemKey.String("informix")
- // InstantDB
- DBSystemInstantDB = DBSystemKey.String("instantdb")
- // InterBase
- DBSystemInterbase = DBSystemKey.String("interbase")
- // MariaDB
- DBSystemMariaDB = DBSystemKey.String("mariadb")
- // Netezza
- DBSystemNetezza = DBSystemKey.String("netezza")
- // Pervasive PSQL
- DBSystemPervasive = DBSystemKey.String("pervasive")
- // PointBase
- DBSystemPointbase = DBSystemKey.String("pointbase")
- // SQLite
- DBSystemSqlite = DBSystemKey.String("sqlite")
- // Sybase
- DBSystemSybase = DBSystemKey.String("sybase")
- // Teradata
- DBSystemTeradata = DBSystemKey.String("teradata")
- // Vertica
- DBSystemVertica = DBSystemKey.String("vertica")
- // H2
- DBSystemH2 = DBSystemKey.String("h2")
- // ColdFusion IMQ
- DBSystemColdfusion = DBSystemKey.String("coldfusion")
- // Apache Cassandra
- DBSystemCassandra = DBSystemKey.String("cassandra")
- // Apache HBase
- DBSystemHBase = DBSystemKey.String("hbase")
- // MongoDB
- DBSystemMongoDB = DBSystemKey.String("mongodb")
- // Redis
- DBSystemRedis = DBSystemKey.String("redis")
- // Couchbase
- DBSystemCouchbase = DBSystemKey.String("couchbase")
- // CouchDB
- DBSystemCouchDB = DBSystemKey.String("couchdb")
- // Microsoft Azure Cosmos DB
- DBSystemCosmosDB = DBSystemKey.String("cosmosdb")
- // Amazon DynamoDB
- DBSystemDynamoDB = DBSystemKey.String("dynamodb")
- // Neo4j
- DBSystemNeo4j = DBSystemKey.String("neo4j")
- // Apache Geode
- DBSystemGeode = DBSystemKey.String("geode")
- // Elasticsearch
- DBSystemElasticsearch = DBSystemKey.String("elasticsearch")
- // Memcached
- DBSystemMemcached = DBSystemKey.String("memcached")
- // CockroachDB
- DBSystemCockroachdb = DBSystemKey.String("cockroachdb")
- // OpenSearch
- DBSystemOpensearch = DBSystemKey.String("opensearch")
- // ClickHouse
- DBSystemClickhouse = DBSystemKey.String("clickhouse")
-)
-
-// DBConnectionString returns an attribute KeyValue conforming to the
-// "db.connection_string" semantic conventions. It represents the connection
-// string used to connect to the database. It is recommended to remove embedded
-// credentials.
-func DBConnectionString(val string) attribute.KeyValue {
- return DBConnectionStringKey.String(val)
-}
-
-// DBUser returns an attribute KeyValue conforming to the "db.user" semantic
-// conventions. It represents the username for accessing the database.
-func DBUser(val string) attribute.KeyValue {
- return DBUserKey.String(val)
-}
-
-// DBJDBCDriverClassname returns an attribute KeyValue conforming to the
-// "db.jdbc.driver_classname" semantic conventions. It represents the
-// fully-qualified class name of the [Java Database Connectivity
-// (JDBC)](https://docs.oracle.com/javase/8/docs/technotes/guides/jdbc/) driver
-// used to connect.
-func DBJDBCDriverClassname(val string) attribute.KeyValue {
- return DBJDBCDriverClassnameKey.String(val)
-}
-
-// DBName returns an attribute KeyValue conforming to the "db.name" semantic
-// conventions. It represents the this attribute is used to report the name of
-// the database being accessed. For commands that switch the database, this
-// should be set to the target database (even if the command fails).
-func DBName(val string) attribute.KeyValue {
- return DBNameKey.String(val)
-}
-
-// DBStatement returns an attribute KeyValue conforming to the
-// "db.statement" semantic conventions. It represents the database statement
-// being executed.
-func DBStatement(val string) attribute.KeyValue {
- return DBStatementKey.String(val)
-}
-
-// DBOperation returns an attribute KeyValue conforming to the
-// "db.operation" semantic conventions. It represents the name of the operation
-// being executed, e.g. the [MongoDB command
-// name](https://docs.mongodb.com/manual/reference/command/#database-operations)
-// such as `findAndModify`, or the SQL keyword.
-func DBOperation(val string) attribute.KeyValue {
- return DBOperationKey.String(val)
-}
-
-// Connection-level attributes for Microsoft SQL Server
-const (
- // DBMSSQLInstanceNameKey is the attribute Key conforming to the
- // "db.mssql.instance_name" semantic conventions. It represents the
- // Microsoft SQL Server [instance
- // name](https://docs.microsoft.com/en-us/sql/connect/jdbc/building-the-connection-url?view=sql-server-ver15)
- // connecting to. This name is used to determine the port of a named
- // instance.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'MSSQLSERVER'
- // Note: If setting a `db.mssql.instance_name`, `net.peer.port` is no
- // longer required (but still recommended if non-standard).
- DBMSSQLInstanceNameKey = attribute.Key("db.mssql.instance_name")
-)
-
-// DBMSSQLInstanceName returns an attribute KeyValue conforming to the
-// "db.mssql.instance_name" semantic conventions. It represents the Microsoft
-// SQL Server [instance
-// name](https://docs.microsoft.com/en-us/sql/connect/jdbc/building-the-connection-url?view=sql-server-ver15)
-// connecting to. This name is used to determine the port of a named instance.
-func DBMSSQLInstanceName(val string) attribute.KeyValue {
- return DBMSSQLInstanceNameKey.String(val)
-}
-
-// Call-level attributes for Cassandra
-const (
- // DBCassandraPageSizeKey is the attribute Key conforming to the
- // "db.cassandra.page_size" semantic conventions. It represents the fetch
- // size used for paging, i.e. how many rows will be returned at once.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 5000
- DBCassandraPageSizeKey = attribute.Key("db.cassandra.page_size")
-
- // DBCassandraConsistencyLevelKey is the attribute Key conforming to the
- // "db.cassandra.consistency_level" semantic conventions. It represents the
- // consistency level of the query. Based on consistency values from
- // [CQL](https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html).
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- DBCassandraConsistencyLevelKey = attribute.Key("db.cassandra.consistency_level")
-
- // DBCassandraTableKey is the attribute Key conforming to the
- // "db.cassandra.table" semantic conventions. It represents the name of the
- // primary table that the operation is acting upon, including the keyspace
- // name (if applicable).
- //
- // Type: string
- // RequirementLevel: Recommended
- // Stability: stable
- // Examples: 'mytable'
- // Note: This mirrors the db.sql.table attribute but references cassandra
- // rather than sql. It is not recommended to attempt any client-side
- // parsing of `db.statement` just to get this property, but it should be
- // set if it is provided by the library being instrumented. If the
- // operation is acting upon an anonymous table, or more than one table,
- // this value MUST NOT be set.
- DBCassandraTableKey = attribute.Key("db.cassandra.table")
-
- // DBCassandraIdempotenceKey is the attribute Key conforming to the
- // "db.cassandra.idempotence" semantic conventions. It represents the
- // whether or not the query is idempotent.
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- DBCassandraIdempotenceKey = attribute.Key("db.cassandra.idempotence")
-
- // DBCassandraSpeculativeExecutionCountKey is the attribute Key conforming
- // to the "db.cassandra.speculative_execution_count" semantic conventions.
- // It represents the number of times a query was speculatively executed.
- // Not set or `0` if the query was not executed speculatively.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 0, 2
- DBCassandraSpeculativeExecutionCountKey = attribute.Key("db.cassandra.speculative_execution_count")
-
- // DBCassandraCoordinatorIDKey is the attribute Key conforming to the
- // "db.cassandra.coordinator.id" semantic conventions. It represents the ID
- // of the coordinating node for a query.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'be13faa2-8574-4d71-926d-27f16cf8a7af'
- DBCassandraCoordinatorIDKey = attribute.Key("db.cassandra.coordinator.id")
-
- // DBCassandraCoordinatorDCKey is the attribute Key conforming to the
- // "db.cassandra.coordinator.dc" semantic conventions. It represents the
- // data center of the coordinating node for a query.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'us-west-2'
- DBCassandraCoordinatorDCKey = attribute.Key("db.cassandra.coordinator.dc")
-)
-
-var (
- // all
- DBCassandraConsistencyLevelAll = DBCassandraConsistencyLevelKey.String("all")
- // each_quorum
- DBCassandraConsistencyLevelEachQuorum = DBCassandraConsistencyLevelKey.String("each_quorum")
- // quorum
- DBCassandraConsistencyLevelQuorum = DBCassandraConsistencyLevelKey.String("quorum")
- // local_quorum
- DBCassandraConsistencyLevelLocalQuorum = DBCassandraConsistencyLevelKey.String("local_quorum")
- // one
- DBCassandraConsistencyLevelOne = DBCassandraConsistencyLevelKey.String("one")
- // two
- DBCassandraConsistencyLevelTwo = DBCassandraConsistencyLevelKey.String("two")
- // three
- DBCassandraConsistencyLevelThree = DBCassandraConsistencyLevelKey.String("three")
- // local_one
- DBCassandraConsistencyLevelLocalOne = DBCassandraConsistencyLevelKey.String("local_one")
- // any
- DBCassandraConsistencyLevelAny = DBCassandraConsistencyLevelKey.String("any")
- // serial
- DBCassandraConsistencyLevelSerial = DBCassandraConsistencyLevelKey.String("serial")
- // local_serial
- DBCassandraConsistencyLevelLocalSerial = DBCassandraConsistencyLevelKey.String("local_serial")
-)
-
-// DBCassandraPageSize returns an attribute KeyValue conforming to the
-// "db.cassandra.page_size" semantic conventions. It represents the fetch size
-// used for paging, i.e. how many rows will be returned at once.
-func DBCassandraPageSize(val int) attribute.KeyValue {
- return DBCassandraPageSizeKey.Int(val)
-}
-
-// DBCassandraTable returns an attribute KeyValue conforming to the
-// "db.cassandra.table" semantic conventions. It represents the name of the
-// primary table that the operation is acting upon, including the keyspace name
-// (if applicable).
-func DBCassandraTable(val string) attribute.KeyValue {
- return DBCassandraTableKey.String(val)
-}
-
-// DBCassandraIdempotence returns an attribute KeyValue conforming to the
-// "db.cassandra.idempotence" semantic conventions. It represents the whether
-// or not the query is idempotent.
-func DBCassandraIdempotence(val bool) attribute.KeyValue {
- return DBCassandraIdempotenceKey.Bool(val)
-}
-
-// DBCassandraSpeculativeExecutionCount returns an attribute KeyValue
-// conforming to the "db.cassandra.speculative_execution_count" semantic
-// conventions. It represents the number of times a query was speculatively
-// executed. Not set or `0` if the query was not executed speculatively.
-func DBCassandraSpeculativeExecutionCount(val int) attribute.KeyValue {
- return DBCassandraSpeculativeExecutionCountKey.Int(val)
-}
-
-// DBCassandraCoordinatorID returns an attribute KeyValue conforming to the
-// "db.cassandra.coordinator.id" semantic conventions. It represents the ID of
-// the coordinating node for a query.
-func DBCassandraCoordinatorID(val string) attribute.KeyValue {
- return DBCassandraCoordinatorIDKey.String(val)
-}
-
-// DBCassandraCoordinatorDC returns an attribute KeyValue conforming to the
-// "db.cassandra.coordinator.dc" semantic conventions. It represents the data
-// center of the coordinating node for a query.
-func DBCassandraCoordinatorDC(val string) attribute.KeyValue {
- return DBCassandraCoordinatorDCKey.String(val)
-}
-
-// Call-level attributes for Redis
-const (
- // DBRedisDBIndexKey is the attribute Key conforming to the
- // "db.redis.database_index" semantic conventions. It represents the index
- // of the database being accessed as used in the [`SELECT`
- // command](https://redis.io/commands/select), provided as an integer. To
- // be used instead of the generic `db.name` attribute.
- //
- // Type: int
- // RequirementLevel: ConditionallyRequired (If other than the default
- // database (`0`).)
- // Stability: stable
- // Examples: 0, 1, 15
- DBRedisDBIndexKey = attribute.Key("db.redis.database_index")
-)
-
-// DBRedisDBIndex returns an attribute KeyValue conforming to the
-// "db.redis.database_index" semantic conventions. It represents the index of
-// the database being accessed as used in the [`SELECT`
-// command](https://redis.io/commands/select), provided as an integer. To be
-// used instead of the generic `db.name` attribute.
-func DBRedisDBIndex(val int) attribute.KeyValue {
- return DBRedisDBIndexKey.Int(val)
-}
-
-// Call-level attributes for MongoDB
-const (
- // DBMongoDBCollectionKey is the attribute Key conforming to the
- // "db.mongodb.collection" semantic conventions. It represents the
- // collection being accessed within the database stated in `db.name`.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'customers', 'products'
- DBMongoDBCollectionKey = attribute.Key("db.mongodb.collection")
-)
-
-// DBMongoDBCollection returns an attribute KeyValue conforming to the
-// "db.mongodb.collection" semantic conventions. It represents the collection
-// being accessed within the database stated in `db.name`.
-func DBMongoDBCollection(val string) attribute.KeyValue {
- return DBMongoDBCollectionKey.String(val)
-}
-
-// Call-level attributes for SQL databases
-const (
- // DBSQLTableKey is the attribute Key conforming to the "db.sql.table"
- // semantic conventions. It represents the name of the primary table that
- // the operation is acting upon, including the database name (if
- // applicable).
- //
- // Type: string
- // RequirementLevel: Recommended
- // Stability: stable
- // Examples: 'public.users', 'customers'
- // Note: It is not recommended to attempt any client-side parsing of
- // `db.statement` just to get this property, but it should be set if it is
- // provided by the library being instrumented. If the operation is acting
- // upon an anonymous table, or more than one table, this value MUST NOT be
- // set.
- DBSQLTableKey = attribute.Key("db.sql.table")
-)
-
-// DBSQLTable returns an attribute KeyValue conforming to the "db.sql.table"
-// semantic conventions. It represents the name of the primary table that the
-// operation is acting upon, including the database name (if applicable).
-func DBSQLTable(val string) attribute.KeyValue {
- return DBSQLTableKey.String(val)
-}
-
-// Span attributes used by non-OTLP exporters to represent OpenTelemetry Span's
-// concepts.
-const (
- // OtelStatusCodeKey is the attribute Key conforming to the
- // "otel.status_code" semantic conventions. It represents the name of the
- // code, either "OK" or "ERROR". MUST NOT be set if the status code is
- // UNSET.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- OtelStatusCodeKey = attribute.Key("otel.status_code")
-
- // OtelStatusDescriptionKey is the attribute Key conforming to the
- // "otel.status_description" semantic conventions. It represents the
- // description of the Status if it has a value, otherwise not set.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'resource not found'
- OtelStatusDescriptionKey = attribute.Key("otel.status_description")
-)
-
-var (
- // The operation has been validated by an Application developer or Operator to have completed successfully
- OtelStatusCodeOk = OtelStatusCodeKey.String("OK")
- // The operation contains an error
- OtelStatusCodeError = OtelStatusCodeKey.String("ERROR")
-)
-
-// OtelStatusDescription returns an attribute KeyValue conforming to the
-// "otel.status_description" semantic conventions. It represents the
-// description of the Status if it has a value, otherwise not set.
-func OtelStatusDescription(val string) attribute.KeyValue {
- return OtelStatusDescriptionKey.String(val)
-}
-
-// This semantic convention describes an instance of a function that runs
-// without provisioning or managing of servers (also known as serverless
-// functions or Function as a Service (FaaS)) with spans.
-const (
- // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger"
- // semantic conventions. It represents the type of the trigger which caused
- // this function execution.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- // Note: For the server/consumer span on the incoming side,
- // `faas.trigger` MUST be set.
- //
- // Clients invoking FaaS instances usually cannot set `faas.trigger`,
- // since they would typically need to look in the payload to determine
- // the event type. If clients set it, it should be the same as the
- // trigger that corresponding incoming would have (i.e., this has
- // nothing to do with the underlying transport used to make the API
- // call to invoke the lambda, which is often HTTP).
- FaaSTriggerKey = attribute.Key("faas.trigger")
-
- // FaaSExecutionKey is the attribute Key conforming to the "faas.execution"
- // semantic conventions. It represents the execution ID of the current
- // function execution.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'af9d5aa4-a685-4c5f-a22b-444f80b3cc28'
- FaaSExecutionKey = attribute.Key("faas.execution")
-)
-
-var (
- // A response to some data source operation such as a database or filesystem read/write
- FaaSTriggerDatasource = FaaSTriggerKey.String("datasource")
- // To provide an answer to an inbound HTTP request
- FaaSTriggerHTTP = FaaSTriggerKey.String("http")
- // A function is set to be executed when messages are sent to a messaging system
- FaaSTriggerPubsub = FaaSTriggerKey.String("pubsub")
- // A function is scheduled to be executed regularly
- FaaSTriggerTimer = FaaSTriggerKey.String("timer")
- // If none of the others apply
- FaaSTriggerOther = FaaSTriggerKey.String("other")
-)
-
-// FaaSExecution returns an attribute KeyValue conforming to the
-// "faas.execution" semantic conventions. It represents the execution ID of the
-// current function execution.
-func FaaSExecution(val string) attribute.KeyValue {
- return FaaSExecutionKey.String(val)
-}
-
-// Semantic Convention for FaaS triggered as a response to some data source
-// operation such as a database or filesystem read/write.
-const (
- // FaaSDocumentCollectionKey is the attribute Key conforming to the
- // "faas.document.collection" semantic conventions. It represents the name
- // of the source on which the triggering operation was performed. For
- // example, in Cloud Storage or S3 corresponds to the bucket name, and in
- // Cosmos DB to the database name.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'myBucketName', 'myDBName'
- FaaSDocumentCollectionKey = attribute.Key("faas.document.collection")
-
- // FaaSDocumentOperationKey is the attribute Key conforming to the
- // "faas.document.operation" semantic conventions. It represents the
- // describes the type of the operation that was performed on the data.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- FaaSDocumentOperationKey = attribute.Key("faas.document.operation")
-
- // FaaSDocumentTimeKey is the attribute Key conforming to the
- // "faas.document.time" semantic conventions. It represents a string
- // containing the time when the data was accessed in the [ISO
- // 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
- // expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '2020-01-23T13:47:06Z'
- FaaSDocumentTimeKey = attribute.Key("faas.document.time")
-
- // FaaSDocumentNameKey is the attribute Key conforming to the
- // "faas.document.name" semantic conventions. It represents the document
- // name/table subjected to the operation. For example, in Cloud Storage or
- // S3 is the name of the file, and in Cosmos DB the table name.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'myFile.txt', 'myTableName'
- FaaSDocumentNameKey = attribute.Key("faas.document.name")
-)
-
-var (
- // When a new object is created
- FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert")
- // When an object is modified
- FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit")
- // When an object is deleted
- FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete")
-)
-
-// FaaSDocumentCollection returns an attribute KeyValue conforming to the
-// "faas.document.collection" semantic conventions. It represents the name of
-// the source on which the triggering operation was performed. For example, in
-// Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the
-// database name.
-func FaaSDocumentCollection(val string) attribute.KeyValue {
- return FaaSDocumentCollectionKey.String(val)
-}
-
-// FaaSDocumentTime returns an attribute KeyValue conforming to the
-// "faas.document.time" semantic conventions. It represents a string containing
-// the time when the data was accessed in the [ISO
-// 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
-// expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
-func FaaSDocumentTime(val string) attribute.KeyValue {
- return FaaSDocumentTimeKey.String(val)
-}
-
-// FaaSDocumentName returns an attribute KeyValue conforming to the
-// "faas.document.name" semantic conventions. It represents the document
-// name/table subjected to the operation. For example, in Cloud Storage or S3
-// is the name of the file, and in Cosmos DB the table name.
-func FaaSDocumentName(val string) attribute.KeyValue {
- return FaaSDocumentNameKey.String(val)
-}
-
-// Semantic Convention for FaaS scheduled to be executed regularly.
-const (
- // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic
- // conventions. It represents a string containing the function invocation
- // time in the [ISO
- // 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
- // expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '2020-01-23T13:47:06Z'
- FaaSTimeKey = attribute.Key("faas.time")
-
- // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic
- // conventions. It represents a string containing the schedule period as
- // [Cron
- // Expression](https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '0/5 * * * ? *'
- FaaSCronKey = attribute.Key("faas.cron")
-)
-
-// FaaSTime returns an attribute KeyValue conforming to the "faas.time"
-// semantic conventions. It represents a string containing the function
-// invocation time in the [ISO
-// 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format
-// expressed in [UTC](https://www.w3.org/TR/NOTE-datetime).
-func FaaSTime(val string) attribute.KeyValue {
- return FaaSTimeKey.String(val)
-}
-
-// FaaSCron returns an attribute KeyValue conforming to the "faas.cron"
-// semantic conventions. It represents a string containing the schedule period
-// as [Cron
-// Expression](https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm).
-func FaaSCron(val string) attribute.KeyValue {
- return FaaSCronKey.String(val)
-}
-
-// Contains additional attributes for incoming FaaS spans.
-const (
- // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart"
- // semantic conventions. It represents a boolean that is true if the
- // serverless function is executed for the first time (aka cold-start).
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- FaaSColdstartKey = attribute.Key("faas.coldstart")
-)
-
-// FaaSColdstart returns an attribute KeyValue conforming to the
-// "faas.coldstart" semantic conventions. It represents a boolean that is true
-// if the serverless function is executed for the first time (aka cold-start).
-func FaaSColdstart(val bool) attribute.KeyValue {
- return FaaSColdstartKey.Bool(val)
-}
-
-// Contains additional attributes for outgoing FaaS spans.
-const (
- // FaaSInvokedNameKey is the attribute Key conforming to the
- // "faas.invoked_name" semantic conventions. It represents the name of the
- // invoked function.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'my-function'
- // Note: SHOULD be equal to the `faas.name` resource attribute of the
- // invoked function.
- FaaSInvokedNameKey = attribute.Key("faas.invoked_name")
-
- // FaaSInvokedProviderKey is the attribute Key conforming to the
- // "faas.invoked_provider" semantic conventions. It represents the cloud
- // provider of the invoked function.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- // Note: SHOULD be equal to the `cloud.provider` resource attribute of the
- // invoked function.
- FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider")
-
- // FaaSInvokedRegionKey is the attribute Key conforming to the
- // "faas.invoked_region" semantic conventions. It represents the cloud
- // region of the invoked function.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (For some cloud providers, like
- // AWS or GCP, the region in which a function is hosted is essential to
- // uniquely identify the function and also part of its endpoint. Since it's
- // part of the endpoint being called, the region is always known to
- // clients. In these cases, `faas.invoked_region` MUST be set accordingly.
- // If the region is unknown to the client or not required for identifying
- // the invoked function, setting `faas.invoked_region` is optional.)
- // Stability: stable
- // Examples: 'eu-central-1'
- // Note: SHOULD be equal to the `cloud.region` resource attribute of the
- // invoked function.
- FaaSInvokedRegionKey = attribute.Key("faas.invoked_region")
-)
-
-var (
- // Alibaba Cloud
- FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud")
- // Amazon Web Services
- FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws")
- // Microsoft Azure
- FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure")
- // Google Cloud Platform
- FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp")
- // Tencent Cloud
- FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud")
-)
-
-// FaaSInvokedName returns an attribute KeyValue conforming to the
-// "faas.invoked_name" semantic conventions. It represents the name of the
-// invoked function.
-func FaaSInvokedName(val string) attribute.KeyValue {
- return FaaSInvokedNameKey.String(val)
-}
-
-// FaaSInvokedRegion returns an attribute KeyValue conforming to the
-// "faas.invoked_region" semantic conventions. It represents the cloud region
-// of the invoked function.
-func FaaSInvokedRegion(val string) attribute.KeyValue {
- return FaaSInvokedRegionKey.String(val)
-}
-
-// These attributes may be used for any network related operation.
-const (
- // NetTransportKey is the attribute Key conforming to the "net.transport"
- // semantic conventions. It represents the transport protocol used. See
- // note below.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- NetTransportKey = attribute.Key("net.transport")
-
- // NetAppProtocolNameKey is the attribute Key conforming to the
- // "net.app.protocol.name" semantic conventions. It represents the
- // application layer protocol used. The value SHOULD be normalized to
- // lowercase.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'amqp', 'http', 'mqtt'
- NetAppProtocolNameKey = attribute.Key("net.app.protocol.name")
-
- // NetAppProtocolVersionKey is the attribute Key conforming to the
- // "net.app.protocol.version" semantic conventions. It represents the
- // version of the application layer protocol used. See note below.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '3.1.1'
- // Note: `net.app.protocol.version` refers to the version of the protocol
- // used and might be different from the protocol client's version. If the
- // HTTP client used has a version of `0.27.2`, but sends HTTP version
- // `1.1`, this attribute should be set to `1.1`.
- NetAppProtocolVersionKey = attribute.Key("net.app.protocol.version")
-
- // NetSockPeerNameKey is the attribute Key conforming to the
- // "net.sock.peer.name" semantic conventions. It represents the remote
- // socket peer name.
- //
- // Type: string
- // RequirementLevel: Recommended (If available and different from
- // `net.peer.name` and if `net.sock.peer.addr` is set.)
- // Stability: stable
- // Examples: 'proxy.example.com'
- NetSockPeerNameKey = attribute.Key("net.sock.peer.name")
-
- // NetSockPeerAddrKey is the attribute Key conforming to the
- // "net.sock.peer.addr" semantic conventions. It represents the remote
- // socket peer address: IPv4 or IPv6 for internet protocols, path for local
- // communication,
- // [etc](https://man7.org/linux/man-pages/man7/address_families.7.html).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '127.0.0.1', '/tmp/mysql.sock'
- NetSockPeerAddrKey = attribute.Key("net.sock.peer.addr")
-
- // NetSockPeerPortKey is the attribute Key conforming to the
- // "net.sock.peer.port" semantic conventions. It represents the remote
- // socket peer port.
- //
- // Type: int
- // RequirementLevel: Recommended (If defined for the address family and if
- // different than `net.peer.port` and if `net.sock.peer.addr` is set.)
- // Stability: stable
- // Examples: 16456
- NetSockPeerPortKey = attribute.Key("net.sock.peer.port")
-
- // NetSockFamilyKey is the attribute Key conforming to the
- // "net.sock.family" semantic conventions. It represents the protocol
- // [address
- // family](https://man7.org/linux/man-pages/man7/address_families.7.html)
- // which is used for communication.
- //
- // Type: Enum
- // RequirementLevel: ConditionallyRequired (If different than `inet` and if
- // any of `net.sock.peer.addr` or `net.sock.host.addr` are set. Consumers
- // of telemetry SHOULD accept both IPv4 and IPv6 formats for the address in
- // `net.sock.peer.addr` if `net.sock.family` is not set. This is to support
- // instrumentations that follow previous versions of this document.)
- // Stability: stable
- // Examples: 'inet6', 'bluetooth'
- NetSockFamilyKey = attribute.Key("net.sock.family")
-
- // NetPeerNameKey is the attribute Key conforming to the "net.peer.name"
- // semantic conventions. It represents the logical remote hostname, see
- // note below.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'example.com'
- // Note: `net.peer.name` SHOULD NOT be set if capturing it would require an
- // extra DNS lookup.
- NetPeerNameKey = attribute.Key("net.peer.name")
-
- // NetPeerPortKey is the attribute Key conforming to the "net.peer.port"
- // semantic conventions. It represents the logical remote port number
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 80, 8080, 443
- NetPeerPortKey = attribute.Key("net.peer.port")
-
- // NetHostNameKey is the attribute Key conforming to the "net.host.name"
- // semantic conventions. It represents the logical local hostname or
- // similar, see note below.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'localhost'
- NetHostNameKey = attribute.Key("net.host.name")
-
- // NetHostPortKey is the attribute Key conforming to the "net.host.port"
- // semantic conventions. It represents the logical local port number,
- // preferably the one that the peer used to connect
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 8080
- NetHostPortKey = attribute.Key("net.host.port")
-
- // NetSockHostAddrKey is the attribute Key conforming to the
- // "net.sock.host.addr" semantic conventions. It represents the local
- // socket address. Useful in case of a multi-IP host.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '192.168.0.1'
- NetSockHostAddrKey = attribute.Key("net.sock.host.addr")
-
- // NetSockHostPortKey is the attribute Key conforming to the
- // "net.sock.host.port" semantic conventions. It represents the local
- // socket port number.
- //
- // Type: int
- // RequirementLevel: Recommended (If defined for the address family and if
- // different than `net.host.port` and if `net.sock.host.addr` is set.)
- // Stability: stable
- // Examples: 35555
- NetSockHostPortKey = attribute.Key("net.sock.host.port")
-
- // NetHostConnectionTypeKey is the attribute Key conforming to the
- // "net.host.connection.type" semantic conventions. It represents the
- // internet connection type currently being used by the host.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'wifi'
- NetHostConnectionTypeKey = attribute.Key("net.host.connection.type")
-
- // NetHostConnectionSubtypeKey is the attribute Key conforming to the
- // "net.host.connection.subtype" semantic conventions. It represents the
- // this describes more details regarding the connection.type. It may be the
- // type of cell technology connection, but it could be used for describing
- // details about a wifi connection.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'LTE'
- NetHostConnectionSubtypeKey = attribute.Key("net.host.connection.subtype")
-
- // NetHostCarrierNameKey is the attribute Key conforming to the
- // "net.host.carrier.name" semantic conventions. It represents the name of
- // the mobile carrier.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'sprint'
- NetHostCarrierNameKey = attribute.Key("net.host.carrier.name")
-
- // NetHostCarrierMccKey is the attribute Key conforming to the
- // "net.host.carrier.mcc" semantic conventions. It represents the mobile
- // carrier country code.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '310'
- NetHostCarrierMccKey = attribute.Key("net.host.carrier.mcc")
-
- // NetHostCarrierMncKey is the attribute Key conforming to the
- // "net.host.carrier.mnc" semantic conventions. It represents the mobile
- // carrier network code.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '001'
- NetHostCarrierMncKey = attribute.Key("net.host.carrier.mnc")
-
- // NetHostCarrierIccKey is the attribute Key conforming to the
- // "net.host.carrier.icc" semantic conventions. It represents the ISO
- // 3166-1 alpha-2 2-character country code associated with the mobile
- // carrier network.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'DE'
- NetHostCarrierIccKey = attribute.Key("net.host.carrier.icc")
-)
-
-var (
- // ip_tcp
- NetTransportTCP = NetTransportKey.String("ip_tcp")
- // ip_udp
- NetTransportUDP = NetTransportKey.String("ip_udp")
- // Named or anonymous pipe. See note below
- NetTransportPipe = NetTransportKey.String("pipe")
- // In-process communication
- NetTransportInProc = NetTransportKey.String("inproc")
- // Something else (non IP-based)
- NetTransportOther = NetTransportKey.String("other")
-)
-
-var (
- // IPv4 address
- NetSockFamilyInet = NetSockFamilyKey.String("inet")
- // IPv6 address
- NetSockFamilyInet6 = NetSockFamilyKey.String("inet6")
- // Unix domain socket path
- NetSockFamilyUnix = NetSockFamilyKey.String("unix")
-)
-
-var (
- // wifi
- NetHostConnectionTypeWifi = NetHostConnectionTypeKey.String("wifi")
- // wired
- NetHostConnectionTypeWired = NetHostConnectionTypeKey.String("wired")
- // cell
- NetHostConnectionTypeCell = NetHostConnectionTypeKey.String("cell")
- // unavailable
- NetHostConnectionTypeUnavailable = NetHostConnectionTypeKey.String("unavailable")
- // unknown
- NetHostConnectionTypeUnknown = NetHostConnectionTypeKey.String("unknown")
-)
-
-var (
- // GPRS
- NetHostConnectionSubtypeGprs = NetHostConnectionSubtypeKey.String("gprs")
- // EDGE
- NetHostConnectionSubtypeEdge = NetHostConnectionSubtypeKey.String("edge")
- // UMTS
- NetHostConnectionSubtypeUmts = NetHostConnectionSubtypeKey.String("umts")
- // CDMA
- NetHostConnectionSubtypeCdma = NetHostConnectionSubtypeKey.String("cdma")
- // EVDO Rel. 0
- NetHostConnectionSubtypeEvdo0 = NetHostConnectionSubtypeKey.String("evdo_0")
- // EVDO Rev. A
- NetHostConnectionSubtypeEvdoA = NetHostConnectionSubtypeKey.String("evdo_a")
- // CDMA2000 1XRTT
- NetHostConnectionSubtypeCdma20001xrtt = NetHostConnectionSubtypeKey.String("cdma2000_1xrtt")
- // HSDPA
- NetHostConnectionSubtypeHsdpa = NetHostConnectionSubtypeKey.String("hsdpa")
- // HSUPA
- NetHostConnectionSubtypeHsupa = NetHostConnectionSubtypeKey.String("hsupa")
- // HSPA
- NetHostConnectionSubtypeHspa = NetHostConnectionSubtypeKey.String("hspa")
- // IDEN
- NetHostConnectionSubtypeIden = NetHostConnectionSubtypeKey.String("iden")
- // EVDO Rev. B
- NetHostConnectionSubtypeEvdoB = NetHostConnectionSubtypeKey.String("evdo_b")
- // LTE
- NetHostConnectionSubtypeLte = NetHostConnectionSubtypeKey.String("lte")
- // EHRPD
- NetHostConnectionSubtypeEhrpd = NetHostConnectionSubtypeKey.String("ehrpd")
- // HSPAP
- NetHostConnectionSubtypeHspap = NetHostConnectionSubtypeKey.String("hspap")
- // GSM
- NetHostConnectionSubtypeGsm = NetHostConnectionSubtypeKey.String("gsm")
- // TD-SCDMA
- NetHostConnectionSubtypeTdScdma = NetHostConnectionSubtypeKey.String("td_scdma")
- // IWLAN
- NetHostConnectionSubtypeIwlan = NetHostConnectionSubtypeKey.String("iwlan")
- // 5G NR (New Radio)
- NetHostConnectionSubtypeNr = NetHostConnectionSubtypeKey.String("nr")
- // 5G NRNSA (New Radio Non-Standalone)
- NetHostConnectionSubtypeNrnsa = NetHostConnectionSubtypeKey.String("nrnsa")
- // LTE CA
- NetHostConnectionSubtypeLteCa = NetHostConnectionSubtypeKey.String("lte_ca")
-)
-
-// NetAppProtocolName returns an attribute KeyValue conforming to the
-// "net.app.protocol.name" semantic conventions. It represents the application
-// layer protocol used. The value SHOULD be normalized to lowercase.
-func NetAppProtocolName(val string) attribute.KeyValue {
- return NetAppProtocolNameKey.String(val)
-}
-
-// NetAppProtocolVersion returns an attribute KeyValue conforming to the
-// "net.app.protocol.version" semantic conventions. It represents the version
-// of the application layer protocol used. See note below.
-func NetAppProtocolVersion(val string) attribute.KeyValue {
- return NetAppProtocolVersionKey.String(val)
-}
-
-// NetSockPeerName returns an attribute KeyValue conforming to the
-// "net.sock.peer.name" semantic conventions. It represents the remote socket
-// peer name.
-func NetSockPeerName(val string) attribute.KeyValue {
- return NetSockPeerNameKey.String(val)
-}
-
-// NetSockPeerAddr returns an attribute KeyValue conforming to the
-// "net.sock.peer.addr" semantic conventions. It represents the remote socket
-// peer address: IPv4 or IPv6 for internet protocols, path for local
-// communication,
-// [etc](https://man7.org/linux/man-pages/man7/address_families.7.html).
-func NetSockPeerAddr(val string) attribute.KeyValue {
- return NetSockPeerAddrKey.String(val)
-}
-
-// NetSockPeerPort returns an attribute KeyValue conforming to the
-// "net.sock.peer.port" semantic conventions. It represents the remote socket
-// peer port.
-func NetSockPeerPort(val int) attribute.KeyValue {
- return NetSockPeerPortKey.Int(val)
-}
-
-// NetPeerName returns an attribute KeyValue conforming to the
-// "net.peer.name" semantic conventions. It represents the logical remote
-// hostname, see note below.
-func NetPeerName(val string) attribute.KeyValue {
- return NetPeerNameKey.String(val)
-}
-
-// NetPeerPort returns an attribute KeyValue conforming to the
-// "net.peer.port" semantic conventions. It represents the logical remote port
-// number
-func NetPeerPort(val int) attribute.KeyValue {
- return NetPeerPortKey.Int(val)
-}
-
-// NetHostName returns an attribute KeyValue conforming to the
-// "net.host.name" semantic conventions. It represents the logical local
-// hostname or similar, see note below.
-func NetHostName(val string) attribute.KeyValue {
- return NetHostNameKey.String(val)
-}
-
-// NetHostPort returns an attribute KeyValue conforming to the
-// "net.host.port" semantic conventions. It represents the logical local port
-// number, preferably the one that the peer used to connect
-func NetHostPort(val int) attribute.KeyValue {
- return NetHostPortKey.Int(val)
-}
-
-// NetSockHostAddr returns an attribute KeyValue conforming to the
-// "net.sock.host.addr" semantic conventions. It represents the local socket
-// address. Useful in case of a multi-IP host.
-func NetSockHostAddr(val string) attribute.KeyValue {
- return NetSockHostAddrKey.String(val)
-}
-
-// NetSockHostPort returns an attribute KeyValue conforming to the
-// "net.sock.host.port" semantic conventions. It represents the local socket
-// port number.
-func NetSockHostPort(val int) attribute.KeyValue {
- return NetSockHostPortKey.Int(val)
-}
-
-// NetHostCarrierName returns an attribute KeyValue conforming to the
-// "net.host.carrier.name" semantic conventions. It represents the name of the
-// mobile carrier.
-func NetHostCarrierName(val string) attribute.KeyValue {
- return NetHostCarrierNameKey.String(val)
-}
-
-// NetHostCarrierMcc returns an attribute KeyValue conforming to the
-// "net.host.carrier.mcc" semantic conventions. It represents the mobile
-// carrier country code.
-func NetHostCarrierMcc(val string) attribute.KeyValue {
- return NetHostCarrierMccKey.String(val)
-}
-
-// NetHostCarrierMnc returns an attribute KeyValue conforming to the
-// "net.host.carrier.mnc" semantic conventions. It represents the mobile
-// carrier network code.
-func NetHostCarrierMnc(val string) attribute.KeyValue {
- return NetHostCarrierMncKey.String(val)
-}
-
-// NetHostCarrierIcc returns an attribute KeyValue conforming to the
-// "net.host.carrier.icc" semantic conventions. It represents the ISO 3166-1
-// alpha-2 2-character country code associated with the mobile carrier network.
-func NetHostCarrierIcc(val string) attribute.KeyValue {
- return NetHostCarrierIccKey.String(val)
-}
-
-// Operations that access some remote service.
-const (
- // PeerServiceKey is the attribute Key conforming to the "peer.service"
- // semantic conventions. It represents the
- // [`service.name`](../../resource/semantic_conventions/README.md#service)
- // of the remote service. SHOULD be equal to the actual `service.name`
- // resource attribute of the remote service if any.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'AuthTokenCache'
- PeerServiceKey = attribute.Key("peer.service")
-)
-
-// PeerService returns an attribute KeyValue conforming to the
-// "peer.service" semantic conventions. It represents the
-// [`service.name`](../../resource/semantic_conventions/README.md#service) of
-// the remote service. SHOULD be equal to the actual `service.name` resource
-// attribute of the remote service if any.
-func PeerService(val string) attribute.KeyValue {
- return PeerServiceKey.String(val)
-}
-
-// These attributes may be used for any operation with an authenticated and/or
-// authorized enduser.
-const (
- // EnduserIDKey is the attribute Key conforming to the "enduser.id"
- // semantic conventions. It represents the username or client_id extracted
- // from the access token or
- // [Authorization](https://tools.ietf.org/html/rfc7235#section-4.2) header
- // in the inbound request from outside the system.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'username'
- EnduserIDKey = attribute.Key("enduser.id")
-
- // EnduserRoleKey is the attribute Key conforming to the "enduser.role"
- // semantic conventions. It represents the actual/assumed role the client
- // is making the request under extracted from token or application security
- // context.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'admin'
- EnduserRoleKey = attribute.Key("enduser.role")
-
- // EnduserScopeKey is the attribute Key conforming to the "enduser.scope"
- // semantic conventions. It represents the scopes or granted authorities
- // the client currently possesses extracted from token or application
- // security context. The value would come from the scope associated with an
- // [OAuth 2.0 Access
- // Token](https://tools.ietf.org/html/rfc6749#section-3.3) or an attribute
- // value in a [SAML 2.0
- // Assertion](http://docs.oasis-open.org/security/saml/Post2.0/sstc-saml-tech-overview-2.0.html).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'read:message, write:files'
- EnduserScopeKey = attribute.Key("enduser.scope")
-)
-
-// EnduserID returns an attribute KeyValue conforming to the "enduser.id"
-// semantic conventions. It represents the username or client_id extracted from
-// the access token or
-// [Authorization](https://tools.ietf.org/html/rfc7235#section-4.2) header in
-// the inbound request from outside the system.
-func EnduserID(val string) attribute.KeyValue {
- return EnduserIDKey.String(val)
-}
-
-// EnduserRole returns an attribute KeyValue conforming to the
-// "enduser.role" semantic conventions. It represents the actual/assumed role
-// the client is making the request under extracted from token or application
-// security context.
-func EnduserRole(val string) attribute.KeyValue {
- return EnduserRoleKey.String(val)
-}
-
-// EnduserScope returns an attribute KeyValue conforming to the
-// "enduser.scope" semantic conventions. It represents the scopes or granted
-// authorities the client currently possesses extracted from token or
-// application security context. The value would come from the scope associated
-// with an [OAuth 2.0 Access
-// Token](https://tools.ietf.org/html/rfc6749#section-3.3) or an attribute
-// value in a [SAML 2.0
-// Assertion](http://docs.oasis-open.org/security/saml/Post2.0/sstc-saml-tech-overview-2.0.html).
-func EnduserScope(val string) attribute.KeyValue {
- return EnduserScopeKey.String(val)
-}
-
-// These attributes may be used for any operation to store information about a
-// thread that started a span.
-const (
- // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic
- // conventions. It represents the current "managed" thread ID (as opposed
- // to OS thread ID).
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 42
- ThreadIDKey = attribute.Key("thread.id")
-
- // ThreadNameKey is the attribute Key conforming to the "thread.name"
- // semantic conventions. It represents the current thread name.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'main'
- ThreadNameKey = attribute.Key("thread.name")
-)
-
-// ThreadID returns an attribute KeyValue conforming to the "thread.id"
-// semantic conventions. It represents the current "managed" thread ID (as
-// opposed to OS thread ID).
-func ThreadID(val int) attribute.KeyValue {
- return ThreadIDKey.Int(val)
-}
-
-// ThreadName returns an attribute KeyValue conforming to the "thread.name"
-// semantic conventions. It represents the current thread name.
-func ThreadName(val string) attribute.KeyValue {
- return ThreadNameKey.String(val)
-}
-
-// These attributes allow to report this unit of code and therefore to provide
-// more context about the span.
-const (
- // CodeFunctionKey is the attribute Key conforming to the "code.function"
- // semantic conventions. It represents the method or function name, or
- // equivalent (usually rightmost part of the code unit's name).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'serveRequest'
- CodeFunctionKey = attribute.Key("code.function")
-
- // CodeNamespaceKey is the attribute Key conforming to the "code.namespace"
- // semantic conventions. It represents the "namespace" within which
- // `code.function` is defined. Usually the qualified class or module name,
- // such that `code.namespace` + some separator + `code.function` form a
- // unique identifier for the code unit.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'com.example.MyHTTPService'
- CodeNamespaceKey = attribute.Key("code.namespace")
-
- // CodeFilepathKey is the attribute Key conforming to the "code.filepath"
- // semantic conventions. It represents the source code file name that
- // identifies the code unit as uniquely as possible (preferably an absolute
- // file path).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '/usr/local/MyApplication/content_root/app/index.php'
- CodeFilepathKey = attribute.Key("code.filepath")
-
- // CodeLineNumberKey is the attribute Key conforming to the "code.lineno"
- // semantic conventions. It represents the line number in `code.filepath`
- // best representing the operation. It SHOULD point within the code unit
- // named in `code.function`.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 42
- CodeLineNumberKey = attribute.Key("code.lineno")
-
- // CodeColumnKey is the attribute Key conforming to the "code.column"
- // semantic conventions. It represents the column number in `code.filepath`
- // best representing the operation. It SHOULD point within the code unit
- // named in `code.function`.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 16
- CodeColumnKey = attribute.Key("code.column")
-)
-
-// CodeFunction returns an attribute KeyValue conforming to the
-// "code.function" semantic conventions. It represents the method or function
-// name, or equivalent (usually rightmost part of the code unit's name).
-func CodeFunction(val string) attribute.KeyValue {
- return CodeFunctionKey.String(val)
-}
-
-// CodeNamespace returns an attribute KeyValue conforming to the
-// "code.namespace" semantic conventions. It represents the "namespace" within
-// which `code.function` is defined. Usually the qualified class or module
-// name, such that `code.namespace` + some separator + `code.function` form a
-// unique identifier for the code unit.
-func CodeNamespace(val string) attribute.KeyValue {
- return CodeNamespaceKey.String(val)
-}
-
-// CodeFilepath returns an attribute KeyValue conforming to the
-// "code.filepath" semantic conventions. It represents the source code file
-// name that identifies the code unit as uniquely as possible (preferably an
-// absolute file path).
-func CodeFilepath(val string) attribute.KeyValue {
- return CodeFilepathKey.String(val)
-}
-
-// CodeLineNumber returns an attribute KeyValue conforming to the "code.lineno"
-// semantic conventions. It represents the line number in `code.filepath` best
-// representing the operation. It SHOULD point within the code unit named in
-// `code.function`.
-func CodeLineNumber(val int) attribute.KeyValue {
- return CodeLineNumberKey.Int(val)
-}
-
-// CodeColumn returns an attribute KeyValue conforming to the "code.column"
-// semantic conventions. It represents the column number in `code.filepath`
-// best representing the operation. It SHOULD point within the code unit named
-// in `code.function`.
-func CodeColumn(val int) attribute.KeyValue {
- return CodeColumnKey.Int(val)
-}
-
-// Semantic conventions for HTTP client and server Spans.
-const (
- // HTTPMethodKey is the attribute Key conforming to the "http.method"
- // semantic conventions. It represents the hTTP request method.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'GET', 'POST', 'HEAD'
- HTTPMethodKey = attribute.Key("http.method")
-
- // HTTPStatusCodeKey is the attribute Key conforming to the
- // "http.status_code" semantic conventions. It represents the [HTTP
- // response status code](https://tools.ietf.org/html/rfc7231#section-6).
- //
- // Type: int
- // RequirementLevel: ConditionallyRequired (If and only if one was
- // received/sent.)
- // Stability: stable
- // Examples: 200
- HTTPStatusCodeKey = attribute.Key("http.status_code")
-
- // HTTPFlavorKey is the attribute Key conforming to the "http.flavor"
- // semantic conventions. It represents the kind of HTTP protocol used.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- // Note: If `net.transport` is not specified, it can be assumed to be
- // `IP.TCP` except if `http.flavor` is `QUIC`, in which case `IP.UDP` is
- // assumed.
- HTTPFlavorKey = attribute.Key("http.flavor")
-
- // HTTPUserAgentKey is the attribute Key conforming to the
- // "http.user_agent" semantic conventions. It represents the value of the
- // [HTTP
- // User-Agent](https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent)
- // header sent by the client.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'CERN-LineMode/2.15 libwww/2.17b3'
- HTTPUserAgentKey = attribute.Key("http.user_agent")
-
- // HTTPRequestContentLengthKey is the attribute Key conforming to the
- // "http.request_content_length" semantic conventions. It represents the
- // size of the request payload body in bytes. This is the number of bytes
- // transferred excluding headers and is often, but not always, present as
- // the
- // [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length)
- // header. For requests using transport encoding, this should be the
- // compressed size.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 3495
- HTTPRequestContentLengthKey = attribute.Key("http.request_content_length")
-
- // HTTPResponseContentLengthKey is the attribute Key conforming to the
- // "http.response_content_length" semantic conventions. It represents the
- // size of the response payload body in bytes. This is the number of bytes
- // transferred excluding headers and is often, but not always, present as
- // the
- // [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length)
- // header. For requests using transport encoding, this should be the
- // compressed size.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 3495
- HTTPResponseContentLengthKey = attribute.Key("http.response_content_length")
-)
-
-var (
- // HTTP/1.0
- HTTPFlavorHTTP10 = HTTPFlavorKey.String("1.0")
- // HTTP/1.1
- HTTPFlavorHTTP11 = HTTPFlavorKey.String("1.1")
- // HTTP/2
- HTTPFlavorHTTP20 = HTTPFlavorKey.String("2.0")
- // HTTP/3
- HTTPFlavorHTTP30 = HTTPFlavorKey.String("3.0")
- // SPDY protocol
- HTTPFlavorSPDY = HTTPFlavorKey.String("SPDY")
- // QUIC protocol
- HTTPFlavorQUIC = HTTPFlavorKey.String("QUIC")
-)
-
-// HTTPMethod returns an attribute KeyValue conforming to the "http.method"
-// semantic conventions. It represents the hTTP request method.
-func HTTPMethod(val string) attribute.KeyValue {
- return HTTPMethodKey.String(val)
-}
-
-// HTTPStatusCode returns an attribute KeyValue conforming to the
-// "http.status_code" semantic conventions. It represents the [HTTP response
-// status code](https://tools.ietf.org/html/rfc7231#section-6).
-func HTTPStatusCode(val int) attribute.KeyValue {
- return HTTPStatusCodeKey.Int(val)
-}
-
-// HTTPUserAgent returns an attribute KeyValue conforming to the
-// "http.user_agent" semantic conventions. It represents the value of the [HTTP
-// User-Agent](https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent)
-// header sent by the client.
-func HTTPUserAgent(val string) attribute.KeyValue {
- return HTTPUserAgentKey.String(val)
-}
-
-// HTTPRequestContentLength returns an attribute KeyValue conforming to the
-// "http.request_content_length" semantic conventions. It represents the size
-// of the request payload body in bytes. This is the number of bytes
-// transferred excluding headers and is often, but not always, present as the
-// [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length)
-// header. For requests using transport encoding, this should be the compressed
-// size.
-func HTTPRequestContentLength(val int) attribute.KeyValue {
- return HTTPRequestContentLengthKey.Int(val)
-}
-
-// HTTPResponseContentLength returns an attribute KeyValue conforming to the
-// "http.response_content_length" semantic conventions. It represents the size
-// of the response payload body in bytes. This is the number of bytes
-// transferred excluding headers and is often, but not always, present as the
-// [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length)
-// header. For requests using transport encoding, this should be the compressed
-// size.
-func HTTPResponseContentLength(val int) attribute.KeyValue {
- return HTTPResponseContentLengthKey.Int(val)
-}
-
-// Semantic Convention for HTTP Client
-const (
- // HTTPURLKey is the attribute Key conforming to the "http.url" semantic
- // conventions. It represents the full HTTP request URL in the form
- // `scheme://host[:port]/path?query[#fragment]`. Usually the fragment is
- // not transmitted over HTTP, but if it is known, it should be included
- // nevertheless.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'https://www.foo.bar/search?q=OpenTelemetry#SemConv'
- // Note: `http.url` MUST NOT contain credentials passed via URL in form of
- // `https://username:password@www.example.com/`. In such case the
- // attribute's value should be `https://www.example.com/`.
- HTTPURLKey = attribute.Key("http.url")
-
- // HTTPResendCountKey is the attribute Key conforming to the
- // "http.resend_count" semantic conventions. It represents the ordinal
- // number of request resending attempt (for any reason, including
- // redirects).
- //
- // Type: int
- // RequirementLevel: Recommended (if and only if request was retried.)
- // Stability: stable
- // Examples: 3
- // Note: The resend count SHOULD be updated each time an HTTP request gets
- // resent by the client, regardless of what was the cause of the resending
- // (e.g. redirection, authorization failure, 503 Server Unavailable,
- // network issues, or any other).
- HTTPResendCountKey = attribute.Key("http.resend_count")
-)
-
-// HTTPURL returns an attribute KeyValue conforming to the "http.url"
-// semantic conventions. It represents the full HTTP request URL in the form
-// `scheme://host[:port]/path?query[#fragment]`. Usually the fragment is not
-// transmitted over HTTP, but if it is known, it should be included
-// nevertheless.
-func HTTPURL(val string) attribute.KeyValue {
- return HTTPURLKey.String(val)
-}
-
-// HTTPResendCount returns an attribute KeyValue conforming to the
-// "http.resend_count" semantic conventions. It represents the ordinal number
-// of request resending attempt (for any reason, including redirects).
-func HTTPResendCount(val int) attribute.KeyValue {
- return HTTPResendCountKey.Int(val)
-}
-
-// Semantic Convention for HTTP Server
-const (
- // HTTPSchemeKey is the attribute Key conforming to the "http.scheme"
- // semantic conventions. It represents the URI scheme identifying the used
- // protocol.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'http', 'https'
- HTTPSchemeKey = attribute.Key("http.scheme")
-
- // HTTPTargetKey is the attribute Key conforming to the "http.target"
- // semantic conventions. It represents the full request target as passed in
- // a HTTP request line or equivalent.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: '/path/12314/?q=ddds'
- HTTPTargetKey = attribute.Key("http.target")
-
- // HTTPRouteKey is the attribute Key conforming to the "http.route"
- // semantic conventions. It represents the matched route (path template in
- // the format used by the respective server framework). See note below
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (If and only if it's available)
- // Stability: stable
- // Examples: '/users/:userID?', '{controller}/{action}/{id?}'
- // Note: 'http.route' MUST NOT be populated when this is not supported by
- // the HTTP server framework as the route attribute should have
- // low-cardinality and the URI path can NOT substitute it.
- HTTPRouteKey = attribute.Key("http.route")
-
- // HTTPClientIPKey is the attribute Key conforming to the "http.client_ip"
- // semantic conventions. It represents the IP address of the original
- // client behind all proxies, if known (e.g. from
- // [X-Forwarded-For](https://developer.mozilla.org/en-US/docs/Web/HTTP/Headers/X-Forwarded-For)).
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '83.164.160.102'
- // Note: This is not necessarily the same as `net.sock.peer.addr`, which
- // would
- // identify the network-level peer, which may be a proxy.
- //
- // This attribute should be set when a source of information different
- // from the one used for `net.sock.peer.addr`, is available even if that
- // other
- // source just confirms the same value as `net.sock.peer.addr`.
- // Rationale: For `net.sock.peer.addr`, one typically does not know if it
- // comes from a proxy, reverse proxy, or the actual client. Setting
- // `http.client_ip` when it's the same as `net.sock.peer.addr` means that
- // one is at least somewhat confident that the address is not that of
- // the closest proxy.
- HTTPClientIPKey = attribute.Key("http.client_ip")
-)
-
-// HTTPScheme returns an attribute KeyValue conforming to the "http.scheme"
-// semantic conventions. It represents the URI scheme identifying the used
-// protocol.
-func HTTPScheme(val string) attribute.KeyValue {
- return HTTPSchemeKey.String(val)
-}
-
-// HTTPTarget returns an attribute KeyValue conforming to the "http.target"
-// semantic conventions. It represents the full request target as passed in a
-// HTTP request line or equivalent.
-func HTTPTarget(val string) attribute.KeyValue {
- return HTTPTargetKey.String(val)
-}
-
-// HTTPRoute returns an attribute KeyValue conforming to the "http.route"
-// semantic conventions. It represents the matched route (path template in the
-// format used by the respective server framework). See note below
-func HTTPRoute(val string) attribute.KeyValue {
- return HTTPRouteKey.String(val)
-}
-
-// HTTPClientIP returns an attribute KeyValue conforming to the
-// "http.client_ip" semantic conventions. It represents the IP address of the
-// original client behind all proxies, if known (e.g. from
-// [X-Forwarded-For](https://developer.mozilla.org/en-US/docs/Web/HTTP/Headers/X-Forwarded-For)).
-func HTTPClientIP(val string) attribute.KeyValue {
- return HTTPClientIPKey.String(val)
-}
-
-// Attributes that exist for multiple DynamoDB request types.
-const (
- // AWSDynamoDBTableNamesKey is the attribute Key conforming to the
- // "aws.dynamodb.table_names" semantic conventions. It represents the keys
- // in the `RequestItems` object field.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Users', 'Cats'
- AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names")
-
- // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the
- // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
- // JSON-serialized value of each item in the `ConsumedCapacity` response
- // field.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '{ "CapacityUnits": number, "GlobalSecondaryIndexes": {
- // "string" : { "CapacityUnits": number, "ReadCapacityUnits": number,
- // "WriteCapacityUnits": number } }, "LocalSecondaryIndexes": { "string" :
- // { "CapacityUnits": number, "ReadCapacityUnits": number,
- // "WriteCapacityUnits": number } }, "ReadCapacityUnits": number, "Table":
- // { "CapacityUnits": number, "ReadCapacityUnits": number,
- // "WriteCapacityUnits": number }, "TableName": "string",
- // "WriteCapacityUnits": number }'
- AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity")
-
- // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to
- // the "aws.dynamodb.item_collection_metrics" semantic conventions. It
- // represents the JSON-serialized value of the `ItemCollectionMetrics`
- // response field.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '{ "string" : [ { "ItemCollectionKey": { "string" : { "B":
- // blob, "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": {
- // "string" : "AttributeValue" }, "N": "string", "NS": [ "string" ],
- // "NULL": boolean, "S": "string", "SS": [ "string" ] } },
- // "SizeEstimateRangeGB": [ number ] } ] }'
- AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics")
-
- // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to
- // the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It
- // represents the value of the `ProvisionedThroughput.ReadCapacityUnits`
- // request parameter.
- //
- // Type: double
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 1.0, 2.0
- AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity")
-
- // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming
- // to the "aws.dynamodb.provisioned_write_capacity" semantic conventions.
- // It represents the value of the
- // `ProvisionedThroughput.WriteCapacityUnits` request parameter.
- //
- // Type: double
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 1.0, 2.0
- AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity")
-
- // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the
- // "aws.dynamodb.consistent_read" semantic conventions. It represents the
- // value of the `ConsistentRead` request parameter.
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read")
-
- // AWSDynamoDBProjectionKey is the attribute Key conforming to the
- // "aws.dynamodb.projection" semantic conventions. It represents the value
- // of the `ProjectionExpression` request parameter.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Title', 'Title, Price, Color', 'Title, Description,
- // RelatedItems, ProductReviews'
- AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection")
-
- // AWSDynamoDBLimitKey is the attribute Key conforming to the
- // "aws.dynamodb.limit" semantic conventions. It represents the value of
- // the `Limit` request parameter.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 10
- AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit")
-
- // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the
- // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the
- // value of the `AttributesToGet` request parameter.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'lives', 'id'
- AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get")
-
- // AWSDynamoDBIndexNameKey is the attribute Key conforming to the
- // "aws.dynamodb.index_name" semantic conventions. It represents the value
- // of the `IndexName` request parameter.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'name_to_group'
- AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name")
-
- // AWSDynamoDBSelectKey is the attribute Key conforming to the
- // "aws.dynamodb.select" semantic conventions. It represents the value of
- // the `Select` request parameter.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'ALL_ATTRIBUTES', 'COUNT'
- AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select")
-)
-
-// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the
-// "aws.dynamodb.table_names" semantic conventions. It represents the keys in
-// the `RequestItems` object field.
-func AWSDynamoDBTableNames(val ...string) attribute.KeyValue {
- return AWSDynamoDBTableNamesKey.StringSlice(val)
-}
-
-// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to
-// the "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
-// JSON-serialized value of each item in the `ConsumedCapacity` response field.
-func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue {
- return AWSDynamoDBConsumedCapacityKey.StringSlice(val)
-}
-
-// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming
-// to the "aws.dynamodb.item_collection_metrics" semantic conventions. It
-// represents the JSON-serialized value of the `ItemCollectionMetrics` response
-// field.
-func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue {
- return AWSDynamoDBItemCollectionMetricsKey.String(val)
-}
-
-// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue
-// conforming to the "aws.dynamodb.provisioned_read_capacity" semantic
-// conventions. It represents the value of the
-// `ProvisionedThroughput.ReadCapacityUnits` request parameter.
-func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue {
- return AWSDynamoDBProvisionedReadCapacityKey.Float64(val)
-}
-
-// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue
-// conforming to the "aws.dynamodb.provisioned_write_capacity" semantic
-// conventions. It represents the value of the
-// `ProvisionedThroughput.WriteCapacityUnits` request parameter.
-func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue {
- return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val)
-}
-
-// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the
-// "aws.dynamodb.consistent_read" semantic conventions. It represents the value
-// of the `ConsistentRead` request parameter.
-func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue {
- return AWSDynamoDBConsistentReadKey.Bool(val)
-}
-
-// AWSDynamoDBProjection returns an attribute KeyValue conforming to the
-// "aws.dynamodb.projection" semantic conventions. It represents the value of
-// the `ProjectionExpression` request parameter.
-func AWSDynamoDBProjection(val string) attribute.KeyValue {
- return AWSDynamoDBProjectionKey.String(val)
-}
-
-// AWSDynamoDBLimit returns an attribute KeyValue conforming to the
-// "aws.dynamodb.limit" semantic conventions. It represents the value of the
-// `Limit` request parameter.
-func AWSDynamoDBLimit(val int) attribute.KeyValue {
- return AWSDynamoDBLimitKey.Int(val)
-}
-
-// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to
-// the "aws.dynamodb.attributes_to_get" semantic conventions. It represents the
-// value of the `AttributesToGet` request parameter.
-func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue {
- return AWSDynamoDBAttributesToGetKey.StringSlice(val)
-}
-
-// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the
-// "aws.dynamodb.index_name" semantic conventions. It represents the value of
-// the `IndexName` request parameter.
-func AWSDynamoDBIndexName(val string) attribute.KeyValue {
- return AWSDynamoDBIndexNameKey.String(val)
-}
-
-// AWSDynamoDBSelect returns an attribute KeyValue conforming to the
-// "aws.dynamodb.select" semantic conventions. It represents the value of the
-// `Select` request parameter.
-func AWSDynamoDBSelect(val string) attribute.KeyValue {
- return AWSDynamoDBSelectKey.String(val)
-}
-
-// DynamoDB.CreateTable
-const (
- // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to
- // the "aws.dynamodb.global_secondary_indexes" semantic conventions. It
- // represents the JSON-serialized value of each item of the
- // `GlobalSecondaryIndexes` request field
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '{ "IndexName": "string", "KeySchema": [ { "AttributeName":
- // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [
- // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": {
- // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }'
- AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes")
-
- // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to
- // the "aws.dynamodb.local_secondary_indexes" semantic conventions. It
- // represents the JSON-serialized value of each item of the
- // `LocalSecondaryIndexes` request field.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '{ "IndexARN": "string", "IndexName": "string",
- // "IndexSizeBytes": number, "ItemCount": number, "KeySchema": [ {
- // "AttributeName": "string", "KeyType": "string" } ], "Projection": {
- // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" } }'
- AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes")
-)
-
-// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue
-// conforming to the "aws.dynamodb.global_secondary_indexes" semantic
-// conventions. It represents the JSON-serialized value of each item of the
-// `GlobalSecondaryIndexes` request field
-func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue {
- return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val)
-}
-
-// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming
-// to the "aws.dynamodb.local_secondary_indexes" semantic conventions. It
-// represents the JSON-serialized value of each item of the
-// `LocalSecondaryIndexes` request field.
-func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue {
- return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val)
-}
-
-// DynamoDB.ListTables
-const (
- // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the
- // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents
- // the value of the `ExclusiveStartTableName` request parameter.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Users', 'CatsTable'
- AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table")
-
- // AWSDynamoDBTableCountKey is the attribute Key conforming to the
- // "aws.dynamodb.table_count" semantic conventions. It represents the the
- // number of items in the `TableNames` response parameter.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 20
- AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count")
-)
-
-// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming
-// to the "aws.dynamodb.exclusive_start_table" semantic conventions. It
-// represents the value of the `ExclusiveStartTableName` request parameter.
-func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue {
- return AWSDynamoDBExclusiveStartTableKey.String(val)
-}
-
-// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the
-// "aws.dynamodb.table_count" semantic conventions. It represents the the
-// number of items in the `TableNames` response parameter.
-func AWSDynamoDBTableCount(val int) attribute.KeyValue {
- return AWSDynamoDBTableCountKey.Int(val)
-}
-
-// DynamoDB.Query
-const (
- // AWSDynamoDBScanForwardKey is the attribute Key conforming to the
- // "aws.dynamodb.scan_forward" semantic conventions. It represents the
- // value of the `ScanIndexForward` request parameter.
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward")
-)
-
-// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the
-// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of
-// the `ScanIndexForward` request parameter.
-func AWSDynamoDBScanForward(val bool) attribute.KeyValue {
- return AWSDynamoDBScanForwardKey.Bool(val)
-}
-
-// DynamoDB.Scan
-const (
- // AWSDynamoDBSegmentKey is the attribute Key conforming to the
- // "aws.dynamodb.segment" semantic conventions. It represents the value of
- // the `Segment` request parameter.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 10
- AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment")
-
- // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the
- // "aws.dynamodb.total_segments" semantic conventions. It represents the
- // value of the `TotalSegments` request parameter.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 100
- AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments")
-
- // AWSDynamoDBCountKey is the attribute Key conforming to the
- // "aws.dynamodb.count" semantic conventions. It represents the value of
- // the `Count` response parameter.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 10
- AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count")
-
- // AWSDynamoDBScannedCountKey is the attribute Key conforming to the
- // "aws.dynamodb.scanned_count" semantic conventions. It represents the
- // value of the `ScannedCount` response parameter.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 50
- AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count")
-)
-
-// AWSDynamoDBSegment returns an attribute KeyValue conforming to the
-// "aws.dynamodb.segment" semantic conventions. It represents the value of the
-// `Segment` request parameter.
-func AWSDynamoDBSegment(val int) attribute.KeyValue {
- return AWSDynamoDBSegmentKey.Int(val)
-}
-
-// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the
-// "aws.dynamodb.total_segments" semantic conventions. It represents the value
-// of the `TotalSegments` request parameter.
-func AWSDynamoDBTotalSegments(val int) attribute.KeyValue {
- return AWSDynamoDBTotalSegmentsKey.Int(val)
-}
-
-// AWSDynamoDBCount returns an attribute KeyValue conforming to the
-// "aws.dynamodb.count" semantic conventions. It represents the value of the
-// `Count` response parameter.
-func AWSDynamoDBCount(val int) attribute.KeyValue {
- return AWSDynamoDBCountKey.Int(val)
-}
-
-// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the
-// "aws.dynamodb.scanned_count" semantic conventions. It represents the value
-// of the `ScannedCount` response parameter.
-func AWSDynamoDBScannedCount(val int) attribute.KeyValue {
- return AWSDynamoDBScannedCountKey.Int(val)
-}
-
-// DynamoDB.UpdateTable
-const (
- // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to
- // the "aws.dynamodb.attribute_definitions" semantic conventions. It
- // represents the JSON-serialized value of each item in the
- // `AttributeDefinitions` request field.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '{ "AttributeName": "string", "AttributeType": "string" }'
- AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions")
-
- // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key
- // conforming to the "aws.dynamodb.global_secondary_index_updates" semantic
- // conventions. It represents the JSON-serialized value of each item in the
- // the `GlobalSecondaryIndexUpdates` request field.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '{ "Create": { "IndexName": "string", "KeySchema": [ {
- // "AttributeName": "string", "KeyType": "string" } ], "Projection": {
- // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" },
- // "ProvisionedThroughput": { "ReadCapacityUnits": number,
- // "WriteCapacityUnits": number } }'
- AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates")
-)
-
-// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming
-// to the "aws.dynamodb.attribute_definitions" semantic conventions. It
-// represents the JSON-serialized value of each item in the
-// `AttributeDefinitions` request field.
-func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue {
- return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val)
-}
-
-// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue
-// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic
-// conventions. It represents the JSON-serialized value of each item in the the
-// `GlobalSecondaryIndexUpdates` request field.
-func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue {
- return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val)
-}
-
-// Semantic conventions to apply when instrumenting the GraphQL implementation.
-// They map GraphQL operations to attributes on a Span.
-const (
- // GraphqlOperationNameKey is the attribute Key conforming to the
- // "graphql.operation.name" semantic conventions. It represents the name of
- // the operation being executed.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'findBookByID'
- GraphqlOperationNameKey = attribute.Key("graphql.operation.name")
-
- // GraphqlOperationTypeKey is the attribute Key conforming to the
- // "graphql.operation.type" semantic conventions. It represents the type of
- // the operation being executed.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'query', 'mutation', 'subscription'
- GraphqlOperationTypeKey = attribute.Key("graphql.operation.type")
-
- // GraphqlDocumentKey is the attribute Key conforming to the
- // "graphql.document" semantic conventions. It represents the GraphQL
- // document being executed.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'query findBookByID { bookByID(id: ?) { name } }'
- // Note: The value may be sanitized to exclude sensitive information.
- GraphqlDocumentKey = attribute.Key("graphql.document")
-)
-
-var (
- // GraphQL query
- GraphqlOperationTypeQuery = GraphqlOperationTypeKey.String("query")
- // GraphQL mutation
- GraphqlOperationTypeMutation = GraphqlOperationTypeKey.String("mutation")
- // GraphQL subscription
- GraphqlOperationTypeSubscription = GraphqlOperationTypeKey.String("subscription")
-)
-
-// GraphqlOperationName returns an attribute KeyValue conforming to the
-// "graphql.operation.name" semantic conventions. It represents the name of the
-// operation being executed.
-func GraphqlOperationName(val string) attribute.KeyValue {
- return GraphqlOperationNameKey.String(val)
-}
-
-// GraphqlDocument returns an attribute KeyValue conforming to the
-// "graphql.document" semantic conventions. It represents the GraphQL document
-// being executed.
-func GraphqlDocument(val string) attribute.KeyValue {
- return GraphqlDocumentKey.String(val)
-}
-
-// Semantic convention describing per-message attributes populated on messaging
-// spans or links.
-const (
- // MessagingMessageIDKey is the attribute Key conforming to the
- // "messaging.message.id" semantic conventions. It represents a value used
- // by the messaging system as an identifier for the message, represented as
- // a string.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '452a7c7c7c7048c2f887f61572b18fc2'
- MessagingMessageIDKey = attribute.Key("messaging.message.id")
-
- // MessagingMessageConversationIDKey is the attribute Key conforming to the
- // "messaging.message.conversation_id" semantic conventions. It represents
- // the [conversation ID](#conversations) identifying the conversation to
- // which the message belongs, represented as a string. Sometimes called
- // "Correlation ID".
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'MyConversationID'
- MessagingMessageConversationIDKey = attribute.Key("messaging.message.conversation_id")
-
- // MessagingMessagePayloadSizeBytesKey is the attribute Key conforming to
- // the "messaging.message.payload_size_bytes" semantic conventions. It
- // represents the (uncompressed) size of the message payload in bytes. Also
- // use this attribute if it is unknown whether the compressed or
- // uncompressed payload size is reported.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 2738
- MessagingMessagePayloadSizeBytesKey = attribute.Key("messaging.message.payload_size_bytes")
-
- // MessagingMessagePayloadCompressedSizeBytesKey is the attribute Key
- // conforming to the "messaging.message.payload_compressed_size_bytes"
- // semantic conventions. It represents the compressed size of the message
- // payload in bytes.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 2048
- MessagingMessagePayloadCompressedSizeBytesKey = attribute.Key("messaging.message.payload_compressed_size_bytes")
-)
-
-// MessagingMessageID returns an attribute KeyValue conforming to the
-// "messaging.message.id" semantic conventions. It represents a value used by
-// the messaging system as an identifier for the message, represented as a
-// string.
-func MessagingMessageID(val string) attribute.KeyValue {
- return MessagingMessageIDKey.String(val)
-}
-
-// MessagingMessageConversationID returns an attribute KeyValue conforming
-// to the "messaging.message.conversation_id" semantic conventions. It
-// represents the [conversation ID](#conversations) identifying the
-// conversation to which the message belongs, represented as a string.
-// Sometimes called "Correlation ID".
-func MessagingMessageConversationID(val string) attribute.KeyValue {
- return MessagingMessageConversationIDKey.String(val)
-}
-
-// MessagingMessagePayloadSizeBytes returns an attribute KeyValue conforming
-// to the "messaging.message.payload_size_bytes" semantic conventions. It
-// represents the (uncompressed) size of the message payload in bytes. Also use
-// this attribute if it is unknown whether the compressed or uncompressed
-// payload size is reported.
-func MessagingMessagePayloadSizeBytes(val int) attribute.KeyValue {
- return MessagingMessagePayloadSizeBytesKey.Int(val)
-}
-
-// MessagingMessagePayloadCompressedSizeBytes returns an attribute KeyValue
-// conforming to the "messaging.message.payload_compressed_size_bytes" semantic
-// conventions. It represents the compressed size of the message payload in
-// bytes.
-func MessagingMessagePayloadCompressedSizeBytes(val int) attribute.KeyValue {
- return MessagingMessagePayloadCompressedSizeBytesKey.Int(val)
-}
-
-// Semantic convention for attributes that describe messaging destination on
-// broker
-const (
- // MessagingDestinationNameKey is the attribute Key conforming to the
- // "messaging.destination.name" semantic conventions. It represents the
- // message destination name
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'MyQueue', 'MyTopic'
- // Note: Destination name SHOULD uniquely identify a specific queue, topic
- // or other entity within the broker. If
- // the broker does not have such notion, the destination name SHOULD
- // uniquely identify the broker.
- MessagingDestinationNameKey = attribute.Key("messaging.destination.name")
-
- // MessagingDestinationKindKey is the attribute Key conforming to the
- // "messaging.destination.kind" semantic conventions. It represents the
- // kind of message destination
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- MessagingDestinationKindKey = attribute.Key("messaging.destination.kind")
-
- // MessagingDestinationTemplateKey is the attribute Key conforming to the
- // "messaging.destination.template" semantic conventions. It represents the
- // low cardinality representation of the messaging destination name
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '/customers/{customerID}'
- // Note: Destination names could be constructed from templates. An example
- // would be a destination name involving a user name or product id.
- // Although the destination name in this case is of high cardinality, the
- // underlying template is of low cardinality and can be effectively used
- // for grouping and aggregation.
- MessagingDestinationTemplateKey = attribute.Key("messaging.destination.template")
-
- // MessagingDestinationTemporaryKey is the attribute Key conforming to the
- // "messaging.destination.temporary" semantic conventions. It represents a
- // boolean that is true if the message destination is temporary and might
- // not exist anymore after messages are processed.
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- MessagingDestinationTemporaryKey = attribute.Key("messaging.destination.temporary")
-
- // MessagingDestinationAnonymousKey is the attribute Key conforming to the
- // "messaging.destination.anonymous" semantic conventions. It represents a
- // boolean that is true if the message destination is anonymous (could be
- // unnamed or have auto-generated name).
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- MessagingDestinationAnonymousKey = attribute.Key("messaging.destination.anonymous")
-)
-
-var (
- // A message sent to a queue
- MessagingDestinationKindQueue = MessagingDestinationKindKey.String("queue")
- // A message sent to a topic
- MessagingDestinationKindTopic = MessagingDestinationKindKey.String("topic")
-)
-
-// MessagingDestinationName returns an attribute KeyValue conforming to the
-// "messaging.destination.name" semantic conventions. It represents the message
-// destination name
-func MessagingDestinationName(val string) attribute.KeyValue {
- return MessagingDestinationNameKey.String(val)
-}
-
-// MessagingDestinationTemplate returns an attribute KeyValue conforming to
-// the "messaging.destination.template" semantic conventions. It represents the
-// low cardinality representation of the messaging destination name
-func MessagingDestinationTemplate(val string) attribute.KeyValue {
- return MessagingDestinationTemplateKey.String(val)
-}
-
-// MessagingDestinationTemporary returns an attribute KeyValue conforming to
-// the "messaging.destination.temporary" semantic conventions. It represents a
-// boolean that is true if the message destination is temporary and might not
-// exist anymore after messages are processed.
-func MessagingDestinationTemporary(val bool) attribute.KeyValue {
- return MessagingDestinationTemporaryKey.Bool(val)
-}
-
-// MessagingDestinationAnonymous returns an attribute KeyValue conforming to
-// the "messaging.destination.anonymous" semantic conventions. It represents a
-// boolean that is true if the message destination is anonymous (could be
-// unnamed or have auto-generated name).
-func MessagingDestinationAnonymous(val bool) attribute.KeyValue {
- return MessagingDestinationAnonymousKey.Bool(val)
-}
-
-// Semantic convention for attributes that describe messaging source on broker
-const (
- // MessagingSourceNameKey is the attribute Key conforming to the
- // "messaging.source.name" semantic conventions. It represents the message
- // source name
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'MyQueue', 'MyTopic'
- // Note: Source name SHOULD uniquely identify a specific queue, topic, or
- // other entity within the broker. If
- // the broker does not have such notion, the source name SHOULD uniquely
- // identify the broker.
- MessagingSourceNameKey = attribute.Key("messaging.source.name")
-
- // MessagingSourceKindKey is the attribute Key conforming to the
- // "messaging.source.kind" semantic conventions. It represents the kind of
- // message source
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- MessagingSourceKindKey = attribute.Key("messaging.source.kind")
-
- // MessagingSourceTemplateKey is the attribute Key conforming to the
- // "messaging.source.template" semantic conventions. It represents the low
- // cardinality representation of the messaging source name
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '/customers/{customerID}'
- // Note: Source names could be constructed from templates. An example would
- // be a source name involving a user name or product id. Although the
- // source name in this case is of high cardinality, the underlying template
- // is of low cardinality and can be effectively used for grouping and
- // aggregation.
- MessagingSourceTemplateKey = attribute.Key("messaging.source.template")
-
- // MessagingSourceTemporaryKey is the attribute Key conforming to the
- // "messaging.source.temporary" semantic conventions. It represents a
- // boolean that is true if the message source is temporary and might not
- // exist anymore after messages are processed.
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- MessagingSourceTemporaryKey = attribute.Key("messaging.source.temporary")
-
- // MessagingSourceAnonymousKey is the attribute Key conforming to the
- // "messaging.source.anonymous" semantic conventions. It represents a
- // boolean that is true if the message source is anonymous (could be
- // unnamed or have auto-generated name).
- //
- // Type: boolean
- // RequirementLevel: Optional
- // Stability: stable
- MessagingSourceAnonymousKey = attribute.Key("messaging.source.anonymous")
-)
-
-var (
- // A message received from a queue
- MessagingSourceKindQueue = MessagingSourceKindKey.String("queue")
- // A message received from a topic
- MessagingSourceKindTopic = MessagingSourceKindKey.String("topic")
-)
-
-// MessagingSourceName returns an attribute KeyValue conforming to the
-// "messaging.source.name" semantic conventions. It represents the message
-// source name
-func MessagingSourceName(val string) attribute.KeyValue {
- return MessagingSourceNameKey.String(val)
-}
-
-// MessagingSourceTemplate returns an attribute KeyValue conforming to the
-// "messaging.source.template" semantic conventions. It represents the low
-// cardinality representation of the messaging source name
-func MessagingSourceTemplate(val string) attribute.KeyValue {
- return MessagingSourceTemplateKey.String(val)
-}
-
-// MessagingSourceTemporary returns an attribute KeyValue conforming to the
-// "messaging.source.temporary" semantic conventions. It represents a boolean
-// that is true if the message source is temporary and might not exist anymore
-// after messages are processed.
-func MessagingSourceTemporary(val bool) attribute.KeyValue {
- return MessagingSourceTemporaryKey.Bool(val)
-}
-
-// MessagingSourceAnonymous returns an attribute KeyValue conforming to the
-// "messaging.source.anonymous" semantic conventions. It represents a boolean
-// that is true if the message source is anonymous (could be unnamed or have
-// auto-generated name).
-func MessagingSourceAnonymous(val bool) attribute.KeyValue {
- return MessagingSourceAnonymousKey.Bool(val)
-}
-
-// General attributes used in messaging systems.
-const (
- // MessagingSystemKey is the attribute Key conforming to the
- // "messaging.system" semantic conventions. It represents a string
- // identifying the messaging system.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'kafka', 'rabbitmq', 'rocketmq', 'activemq', 'AmazonSQS'
- MessagingSystemKey = attribute.Key("messaging.system")
-
- // MessagingOperationKey is the attribute Key conforming to the
- // "messaging.operation" semantic conventions. It represents a string
- // identifying the kind of messaging operation as defined in the [Operation
- // names](#operation-names) section above.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- // Note: If a custom value is used, it MUST be of low cardinality.
- MessagingOperationKey = attribute.Key("messaging.operation")
-
- // MessagingBatchMessageCountKey is the attribute Key conforming to the
- // "messaging.batch.message_count" semantic conventions. It represents the
- // number of messages sent, received, or processed in the scope of the
- // batching operation.
- //
- // Type: int
- // RequirementLevel: ConditionallyRequired (If the span describes an
- // operation on a batch of messages.)
- // Stability: stable
- // Examples: 0, 1, 2
- // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on
- // spans that operate with a single message. When a messaging client
- // library supports both batch and single-message API for the same
- // operation, instrumentations SHOULD use `messaging.batch.message_count`
- // for batching APIs and SHOULD NOT use it for single-message APIs.
- MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count")
-)
-
-var (
- // publish
- MessagingOperationPublish = MessagingOperationKey.String("publish")
- // receive
- MessagingOperationReceive = MessagingOperationKey.String("receive")
- // process
- MessagingOperationProcess = MessagingOperationKey.String("process")
-)
-
-// MessagingSystem returns an attribute KeyValue conforming to the
-// "messaging.system" semantic conventions. It represents a string identifying
-// the messaging system.
-func MessagingSystem(val string) attribute.KeyValue {
- return MessagingSystemKey.String(val)
-}
-
-// MessagingBatchMessageCount returns an attribute KeyValue conforming to
-// the "messaging.batch.message_count" semantic conventions. It represents the
-// number of messages sent, received, or processed in the scope of the batching
-// operation.
-func MessagingBatchMessageCount(val int) attribute.KeyValue {
- return MessagingBatchMessageCountKey.Int(val)
-}
-
-// Semantic convention for a consumer of messages received from a messaging
-// system
-const (
- // MessagingConsumerIDKey is the attribute Key conforming to the
- // "messaging.consumer.id" semantic conventions. It represents the
- // identifier for the consumer receiving a message. For Kafka, set it to
- // `{messaging.kafka.consumer.group} - {messaging.kafka.client_id}`, if
- // both are present, or only `messaging.kafka.consumer.group`. For brokers,
- // such as RabbitMQ and Artemis, set it to the `client_id` of the client
- // consuming the message.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'mygroup - client-6'
- MessagingConsumerIDKey = attribute.Key("messaging.consumer.id")
-)
-
-// MessagingConsumerID returns an attribute KeyValue conforming to the
-// "messaging.consumer.id" semantic conventions. It represents the identifier
-// for the consumer receiving a message. For Kafka, set it to
-// `{messaging.kafka.consumer.group} - {messaging.kafka.client_id}`, if both
-// are present, or only `messaging.kafka.consumer.group`. For brokers, such as
-// RabbitMQ and Artemis, set it to the `client_id` of the client consuming the
-// message.
-func MessagingConsumerID(val string) attribute.KeyValue {
- return MessagingConsumerIDKey.String(val)
-}
-
-// Attributes for RabbitMQ
-const (
- // MessagingRabbitmqDestinationRoutingKeyKey is the attribute Key
- // conforming to the "messaging.rabbitmq.destination.routing_key" semantic
- // conventions. It represents the rabbitMQ message routing key.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (If not empty.)
- // Stability: stable
- // Examples: 'myKey'
- MessagingRabbitmqDestinationRoutingKeyKey = attribute.Key("messaging.rabbitmq.destination.routing_key")
-)
-
-// MessagingRabbitmqDestinationRoutingKey returns an attribute KeyValue
-// conforming to the "messaging.rabbitmq.destination.routing_key" semantic
-// conventions. It represents the rabbitMQ message routing key.
-func MessagingRabbitmqDestinationRoutingKey(val string) attribute.KeyValue {
- return MessagingRabbitmqDestinationRoutingKeyKey.String(val)
-}
-
-// Attributes for Apache Kafka
-const (
- // MessagingKafkaMessageKeyKey is the attribute Key conforming to the
- // "messaging.kafka.message.key" semantic conventions. It represents the
- // message keys in Kafka are used for grouping alike messages to ensure
- // they're processed on the same partition. They differ from
- // `messaging.message.id` in that they're not unique. If the key is `null`,
- // the attribute MUST NOT be set.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'myKey'
- // Note: If the key type is not string, it's string representation has to
- // be supplied for the attribute. If the key has no unambiguous, canonical
- // string form, don't include its value.
- MessagingKafkaMessageKeyKey = attribute.Key("messaging.kafka.message.key")
-
- // MessagingKafkaConsumerGroupKey is the attribute Key conforming to the
- // "messaging.kafka.consumer.group" semantic conventions. It represents the
- // name of the Kafka Consumer Group that is handling the message. Only
- // applies to consumers, not producers.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'my-group'
- MessagingKafkaConsumerGroupKey = attribute.Key("messaging.kafka.consumer.group")
-
- // MessagingKafkaClientIDKey is the attribute Key conforming to the
- // "messaging.kafka.client_id" semantic conventions. It represents the
- // client ID for the Consumer or Producer that is handling the message.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'client-5'
- MessagingKafkaClientIDKey = attribute.Key("messaging.kafka.client_id")
-
- // MessagingKafkaDestinationPartitionKey is the attribute Key conforming to
- // the "messaging.kafka.destination.partition" semantic conventions. It
- // represents the partition the message is sent to.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 2
- MessagingKafkaDestinationPartitionKey = attribute.Key("messaging.kafka.destination.partition")
-
- // MessagingKafkaSourcePartitionKey is the attribute Key conforming to the
- // "messaging.kafka.source.partition" semantic conventions. It represents
- // the partition the message is received from.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 2
- MessagingKafkaSourcePartitionKey = attribute.Key("messaging.kafka.source.partition")
-
- // MessagingKafkaMessageOffsetKey is the attribute Key conforming to the
- // "messaging.kafka.message.offset" semantic conventions. It represents the
- // offset of a record in the corresponding Kafka partition.
- //
- // Type: int
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 42
- MessagingKafkaMessageOffsetKey = attribute.Key("messaging.kafka.message.offset")
-
- // MessagingKafkaMessageTombstoneKey is the attribute Key conforming to the
- // "messaging.kafka.message.tombstone" semantic conventions. It represents
- // a boolean that is true if the message is a tombstone.
- //
- // Type: boolean
- // RequirementLevel: ConditionallyRequired (If value is `true`. When
- // missing, the value is assumed to be `false`.)
- // Stability: stable
- MessagingKafkaMessageTombstoneKey = attribute.Key("messaging.kafka.message.tombstone")
-)
-
-// MessagingKafkaMessageKey returns an attribute KeyValue conforming to the
-// "messaging.kafka.message.key" semantic conventions. It represents the
-// message keys in Kafka are used for grouping alike messages to ensure they're
-// processed on the same partition. They differ from `messaging.message.id` in
-// that they're not unique. If the key is `null`, the attribute MUST NOT be
-// set.
-func MessagingKafkaMessageKey(val string) attribute.KeyValue {
- return MessagingKafkaMessageKeyKey.String(val)
-}
-
-// MessagingKafkaConsumerGroup returns an attribute KeyValue conforming to
-// the "messaging.kafka.consumer.group" semantic conventions. It represents the
-// name of the Kafka Consumer Group that is handling the message. Only applies
-// to consumers, not producers.
-func MessagingKafkaConsumerGroup(val string) attribute.KeyValue {
- return MessagingKafkaConsumerGroupKey.String(val)
-}
-
-// MessagingKafkaClientID returns an attribute KeyValue conforming to the
-// "messaging.kafka.client_id" semantic conventions. It represents the client
-// ID for the Consumer or Producer that is handling the message.
-func MessagingKafkaClientID(val string) attribute.KeyValue {
- return MessagingKafkaClientIDKey.String(val)
-}
-
-// MessagingKafkaDestinationPartition returns an attribute KeyValue
-// conforming to the "messaging.kafka.destination.partition" semantic
-// conventions. It represents the partition the message is sent to.
-func MessagingKafkaDestinationPartition(val int) attribute.KeyValue {
- return MessagingKafkaDestinationPartitionKey.Int(val)
-}
-
-// MessagingKafkaSourcePartition returns an attribute KeyValue conforming to
-// the "messaging.kafka.source.partition" semantic conventions. It represents
-// the partition the message is received from.
-func MessagingKafkaSourcePartition(val int) attribute.KeyValue {
- return MessagingKafkaSourcePartitionKey.Int(val)
-}
-
-// MessagingKafkaMessageOffset returns an attribute KeyValue conforming to
-// the "messaging.kafka.message.offset" semantic conventions. It represents the
-// offset of a record in the corresponding Kafka partition.
-func MessagingKafkaMessageOffset(val int) attribute.KeyValue {
- return MessagingKafkaMessageOffsetKey.Int(val)
-}
-
-// MessagingKafkaMessageTombstone returns an attribute KeyValue conforming
-// to the "messaging.kafka.message.tombstone" semantic conventions. It
-// represents a boolean that is true if the message is a tombstone.
-func MessagingKafkaMessageTombstone(val bool) attribute.KeyValue {
- return MessagingKafkaMessageTombstoneKey.Bool(val)
-}
-
-// Attributes for Apache RocketMQ
-const (
- // MessagingRocketmqNamespaceKey is the attribute Key conforming to the
- // "messaging.rocketmq.namespace" semantic conventions. It represents the
- // namespace of RocketMQ resources, resources in different namespaces are
- // individual.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'myNamespace'
- MessagingRocketmqNamespaceKey = attribute.Key("messaging.rocketmq.namespace")
-
- // MessagingRocketmqClientGroupKey is the attribute Key conforming to the
- // "messaging.rocketmq.client_group" semantic conventions. It represents
- // the name of the RocketMQ producer/consumer group that is handling the
- // message. The client type is identified by the SpanKind.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'myConsumerGroup'
- MessagingRocketmqClientGroupKey = attribute.Key("messaging.rocketmq.client_group")
-
- // MessagingRocketmqClientIDKey is the attribute Key conforming to the
- // "messaging.rocketmq.client_id" semantic conventions. It represents the
- // unique identifier for each client.
- //
- // Type: string
- // RequirementLevel: Required
- // Stability: stable
- // Examples: 'myhost@8742@s8083jm'
- MessagingRocketmqClientIDKey = attribute.Key("messaging.rocketmq.client_id")
-
- // MessagingRocketmqMessageDeliveryTimestampKey is the attribute Key
- // conforming to the "messaging.rocketmq.message.delivery_timestamp"
- // semantic conventions. It represents the timestamp in milliseconds that
- // the delay message is expected to be delivered to consumer.
- //
- // Type: int
- // RequirementLevel: ConditionallyRequired (If the message type is delay
- // and delay time level is not specified.)
- // Stability: stable
- // Examples: 1665987217045
- MessagingRocketmqMessageDeliveryTimestampKey = attribute.Key("messaging.rocketmq.message.delivery_timestamp")
-
- // MessagingRocketmqMessageDelayTimeLevelKey is the attribute Key
- // conforming to the "messaging.rocketmq.message.delay_time_level" semantic
- // conventions. It represents the delay time level for delay message, which
- // determines the message delay time.
- //
- // Type: int
- // RequirementLevel: ConditionallyRequired (If the message type is delay
- // and delivery timestamp is not specified.)
- // Stability: stable
- // Examples: 3
- MessagingRocketmqMessageDelayTimeLevelKey = attribute.Key("messaging.rocketmq.message.delay_time_level")
-
- // MessagingRocketmqMessageGroupKey is the attribute Key conforming to the
- // "messaging.rocketmq.message.group" semantic conventions. It represents
- // the it is essential for FIFO message. Messages that belong to the same
- // message group are always processed one by one within the same consumer
- // group.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (If the message type is FIFO.)
- // Stability: stable
- // Examples: 'myMessageGroup'
- MessagingRocketmqMessageGroupKey = attribute.Key("messaging.rocketmq.message.group")
-
- // MessagingRocketmqMessageTypeKey is the attribute Key conforming to the
- // "messaging.rocketmq.message.type" semantic conventions. It represents
- // the type of message.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- MessagingRocketmqMessageTypeKey = attribute.Key("messaging.rocketmq.message.type")
-
- // MessagingRocketmqMessageTagKey is the attribute Key conforming to the
- // "messaging.rocketmq.message.tag" semantic conventions. It represents the
- // secondary classifier of message besides topic.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'tagA'
- MessagingRocketmqMessageTagKey = attribute.Key("messaging.rocketmq.message.tag")
-
- // MessagingRocketmqMessageKeysKey is the attribute Key conforming to the
- // "messaging.rocketmq.message.keys" semantic conventions. It represents
- // the key(s) of message, another way to mark message besides message id.
- //
- // Type: string[]
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'keyA', 'keyB'
- MessagingRocketmqMessageKeysKey = attribute.Key("messaging.rocketmq.message.keys")
-
- // MessagingRocketmqConsumptionModelKey is the attribute Key conforming to
- // the "messaging.rocketmq.consumption_model" semantic conventions. It
- // represents the model of message consumption. This only applies to
- // consumer spans.
- //
- // Type: Enum
- // RequirementLevel: Optional
- // Stability: stable
- MessagingRocketmqConsumptionModelKey = attribute.Key("messaging.rocketmq.consumption_model")
-)
-
-var (
- // Normal message
- MessagingRocketmqMessageTypeNormal = MessagingRocketmqMessageTypeKey.String("normal")
- // FIFO message
- MessagingRocketmqMessageTypeFifo = MessagingRocketmqMessageTypeKey.String("fifo")
- // Delay message
- MessagingRocketmqMessageTypeDelay = MessagingRocketmqMessageTypeKey.String("delay")
- // Transaction message
- MessagingRocketmqMessageTypeTransaction = MessagingRocketmqMessageTypeKey.String("transaction")
-)
-
-var (
- // Clustering consumption model
- MessagingRocketmqConsumptionModelClustering = MessagingRocketmqConsumptionModelKey.String("clustering")
- // Broadcasting consumption model
- MessagingRocketmqConsumptionModelBroadcasting = MessagingRocketmqConsumptionModelKey.String("broadcasting")
-)
-
-// MessagingRocketmqNamespace returns an attribute KeyValue conforming to
-// the "messaging.rocketmq.namespace" semantic conventions. It represents the
-// namespace of RocketMQ resources, resources in different namespaces are
-// individual.
-func MessagingRocketmqNamespace(val string) attribute.KeyValue {
- return MessagingRocketmqNamespaceKey.String(val)
-}
-
-// MessagingRocketmqClientGroup returns an attribute KeyValue conforming to
-// the "messaging.rocketmq.client_group" semantic conventions. It represents
-// the name of the RocketMQ producer/consumer group that is handling the
-// message. The client type is identified by the SpanKind.
-func MessagingRocketmqClientGroup(val string) attribute.KeyValue {
- return MessagingRocketmqClientGroupKey.String(val)
-}
-
-// MessagingRocketmqClientID returns an attribute KeyValue conforming to the
-// "messaging.rocketmq.client_id" semantic conventions. It represents the
-// unique identifier for each client.
-func MessagingRocketmqClientID(val string) attribute.KeyValue {
- return MessagingRocketmqClientIDKey.String(val)
-}
-
-// MessagingRocketmqMessageDeliveryTimestamp returns an attribute KeyValue
-// conforming to the "messaging.rocketmq.message.delivery_timestamp" semantic
-// conventions. It represents the timestamp in milliseconds that the delay
-// message is expected to be delivered to consumer.
-func MessagingRocketmqMessageDeliveryTimestamp(val int) attribute.KeyValue {
- return MessagingRocketmqMessageDeliveryTimestampKey.Int(val)
-}
-
-// MessagingRocketmqMessageDelayTimeLevel returns an attribute KeyValue
-// conforming to the "messaging.rocketmq.message.delay_time_level" semantic
-// conventions. It represents the delay time level for delay message, which
-// determines the message delay time.
-func MessagingRocketmqMessageDelayTimeLevel(val int) attribute.KeyValue {
- return MessagingRocketmqMessageDelayTimeLevelKey.Int(val)
-}
-
-// MessagingRocketmqMessageGroup returns an attribute KeyValue conforming to
-// the "messaging.rocketmq.message.group" semantic conventions. It represents
-// the it is essential for FIFO message. Messages that belong to the same
-// message group are always processed one by one within the same consumer
-// group.
-func MessagingRocketmqMessageGroup(val string) attribute.KeyValue {
- return MessagingRocketmqMessageGroupKey.String(val)
-}
-
-// MessagingRocketmqMessageTag returns an attribute KeyValue conforming to
-// the "messaging.rocketmq.message.tag" semantic conventions. It represents the
-// secondary classifier of message besides topic.
-func MessagingRocketmqMessageTag(val string) attribute.KeyValue {
- return MessagingRocketmqMessageTagKey.String(val)
-}
-
-// MessagingRocketmqMessageKeys returns an attribute KeyValue conforming to
-// the "messaging.rocketmq.message.keys" semantic conventions. It represents
-// the key(s) of message, another way to mark message besides message id.
-func MessagingRocketmqMessageKeys(val ...string) attribute.KeyValue {
- return MessagingRocketmqMessageKeysKey.StringSlice(val)
-}
-
-// Semantic conventions for remote procedure calls.
-const (
- // RPCSystemKey is the attribute Key conforming to the "rpc.system"
- // semantic conventions. It represents a string identifying the remoting
- // system. See below for a list of well-known identifiers.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- RPCSystemKey = attribute.Key("rpc.system")
-
- // RPCServiceKey is the attribute Key conforming to the "rpc.service"
- // semantic conventions. It represents the full (logical) name of the
- // service being called, including its package name, if applicable.
- //
- // Type: string
- // RequirementLevel: Recommended
- // Stability: stable
- // Examples: 'myservice.EchoService'
- // Note: This is the logical name of the service from the RPC interface
- // perspective, which can be different from the name of any implementing
- // class. The `code.namespace` attribute may be used to store the latter
- // (despite the attribute name, it may include a class name; e.g., class
- // with method actually executing the call on the server side, RPC client
- // stub class on the client side).
- RPCServiceKey = attribute.Key("rpc.service")
-
- // RPCMethodKey is the attribute Key conforming to the "rpc.method"
- // semantic conventions. It represents the name of the (logical) method
- // being called, must be equal to the $method part in the span name.
- //
- // Type: string
- // RequirementLevel: Recommended
- // Stability: stable
- // Examples: 'exampleMethod'
- // Note: This is the logical name of the method from the RPC interface
- // perspective, which can be different from the name of any implementing
- // method/function. The `code.function` attribute may be used to store the
- // latter (e.g., method actually executing the call on the server side, RPC
- // client stub method on the client side).
- RPCMethodKey = attribute.Key("rpc.method")
-)
-
-var (
- // gRPC
- RPCSystemGRPC = RPCSystemKey.String("grpc")
- // Java RMI
- RPCSystemJavaRmi = RPCSystemKey.String("java_rmi")
- // .NET WCF
- RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf")
- // Apache Dubbo
- RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo")
-)
-
-// RPCService returns an attribute KeyValue conforming to the "rpc.service"
-// semantic conventions. It represents the full (logical) name of the service
-// being called, including its package name, if applicable.
-func RPCService(val string) attribute.KeyValue {
- return RPCServiceKey.String(val)
-}
-
-// RPCMethod returns an attribute KeyValue conforming to the "rpc.method"
-// semantic conventions. It represents the name of the (logical) method being
-// called, must be equal to the $method part in the span name.
-func RPCMethod(val string) attribute.KeyValue {
- return RPCMethodKey.String(val)
-}
-
-// Tech-specific attributes for gRPC.
-const (
- // RPCGRPCStatusCodeKey is the attribute Key conforming to the
- // "rpc.grpc.status_code" semantic conventions. It represents the [numeric
- // status
- // code](https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md) of
- // the gRPC request.
- //
- // Type: Enum
- // RequirementLevel: Required
- // Stability: stable
- RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code")
-)
-
-var (
- // OK
- RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0)
- // CANCELLED
- RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1)
- // UNKNOWN
- RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2)
- // INVALID_ARGUMENT
- RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3)
- // DEADLINE_EXCEEDED
- RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4)
- // NOT_FOUND
- RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5)
- // ALREADY_EXISTS
- RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6)
- // PERMISSION_DENIED
- RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7)
- // RESOURCE_EXHAUSTED
- RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8)
- // FAILED_PRECONDITION
- RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9)
- // ABORTED
- RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10)
- // OUT_OF_RANGE
- RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11)
- // UNIMPLEMENTED
- RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12)
- // INTERNAL
- RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13)
- // UNAVAILABLE
- RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14)
- // DATA_LOSS
- RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15)
- // UNAUTHENTICATED
- RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16)
-)
-
-// Tech-specific attributes for [JSON RPC](https://www.jsonrpc.org/).
-const (
- // RPCJsonrpcVersionKey is the attribute Key conforming to the
- // "rpc.jsonrpc.version" semantic conventions. It represents the protocol
- // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0
- // does not specify this, the value can be omitted.
- //
- // Type: string
- // RequirementLevel: ConditionallyRequired (If other than the default
- // version (`1.0`))
- // Stability: stable
- // Examples: '2.0', '1.0'
- RPCJsonrpcVersionKey = attribute.Key("rpc.jsonrpc.version")
-
- // RPCJsonrpcRequestIDKey is the attribute Key conforming to the
- // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id`
- // property of request or response. Since protocol allows id to be int,
- // string, `null` or missing (for notifications), value is expected to be
- // cast to string for simplicity. Use empty string in case of `null` value.
- // Omit entirely if this is a notification.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: '10', 'request-7', ''
- RPCJsonrpcRequestIDKey = attribute.Key("rpc.jsonrpc.request_id")
-
- // RPCJsonrpcErrorCodeKey is the attribute Key conforming to the
- // "rpc.jsonrpc.error_code" semantic conventions. It represents the
- // `error.code` property of response if it is an error response.
- //
- // Type: int
- // RequirementLevel: ConditionallyRequired (If response is not successful.)
- // Stability: stable
- // Examples: -32700, 100
- RPCJsonrpcErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code")
-
- // RPCJsonrpcErrorMessageKey is the attribute Key conforming to the
- // "rpc.jsonrpc.error_message" semantic conventions. It represents the
- // `error.message` property of response if it is an error response.
- //
- // Type: string
- // RequirementLevel: Optional
- // Stability: stable
- // Examples: 'Parse error', 'User already exists'
- RPCJsonrpcErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message")
-)
-
-// RPCJsonrpcVersion returns an attribute KeyValue conforming to the
-// "rpc.jsonrpc.version" semantic conventions. It represents the protocol
-// version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0
-// does not specify this, the value can be omitted.
-func RPCJsonrpcVersion(val string) attribute.KeyValue {
- return RPCJsonrpcVersionKey.String(val)
-}
-
-// RPCJsonrpcRequestID returns an attribute KeyValue conforming to the
-// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id`
-// property of request or response. Since protocol allows id to be int, string,
-// `null` or missing (for notifications), value is expected to be cast to
-// string for simplicity. Use empty string in case of `null` value. Omit
-// entirely if this is a notification.
-func RPCJsonrpcRequestID(val string) attribute.KeyValue {
- return RPCJsonrpcRequestIDKey.String(val)
-}
-
-// RPCJsonrpcErrorCode returns an attribute KeyValue conforming to the
-// "rpc.jsonrpc.error_code" semantic conventions. It represents the
-// `error.code` property of response if it is an error response.
-func RPCJsonrpcErrorCode(val int) attribute.KeyValue {
- return RPCJsonrpcErrorCodeKey.Int(val)
-}
-
-// RPCJsonrpcErrorMessage returns an attribute KeyValue conforming to the
-// "rpc.jsonrpc.error_message" semantic conventions. It represents the
-// `error.message` property of response if it is an error response.
-func RPCJsonrpcErrorMessage(val string) attribute.KeyValue {
- return RPCJsonrpcErrorMessageKey.String(val)
-}
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/MIGRATION.md b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/MIGRATION.md
new file mode 100644
index 000000000..8a11ea28d
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/MIGRATION.md
@@ -0,0 +1,155 @@
+# Semantic Convention Changes
+
+The `go.opentelemetry.io/otel/semconv/v1.30.0` should be a drop-in replacement for `go.opentelemetry.io/otel/semconv/v1.28.0` with the following exceptions.
+
+Note: `go.opentelemetry.io/otel/semconv/v1.29.0` does not exist due to bugs from the upstream [OpenTelemetry Semantic Conventions].
+
+## Dropped deprecations
+
+The following declarations have been deprecated in the [OpenTelemetry Semantic Conventions].
+Refer to the respective documentation in that repository for deprecation instructions for each type.
+
+- `CodeColumn`
+- `CodeColumnKey`
+- `CodeFunction`
+- `CodeFunctionKey`
+- `DBCassandraConsistencyLevelAll`
+- `DBCassandraConsistencyLevelAny`
+- `DBCassandraConsistencyLevelEachQuorum`
+- `DBCassandraConsistencyLevelKey`
+- `DBCassandraConsistencyLevelLocalOne`
+- `DBCassandraConsistencyLevelLocalQuorum`
+- `DBCassandraConsistencyLevelLocalSerial`
+- `DBCassandraConsistencyLevelOne`
+- `DBCassandraConsistencyLevelQuorum`
+- `DBCassandraConsistencyLevelSerial`
+- `DBCassandraConsistencyLevelThree`
+- `DBCassandraConsistencyLevelTwo`
+- `DBCassandraCoordinatorDC`
+- `DBCassandraCoordinatorDCKey`
+- `DBCassandraCoordinatorID`
+- `DBCassandraCoordinatorIDKey`
+- `DBCassandraIdempotence`
+- `DBCassandraIdempotenceKey`
+- `DBCassandraPageSize`
+- `DBCassandraPageSizeKey`
+- `DBCassandraSpeculativeExecutionCount`
+- `DBCassandraSpeculativeExecutionCountKey`
+- `DBCosmosDBClientID`
+- `DBCosmosDBClientIDKey`
+- `DBCosmosDBConnectionModeDirect`
+- `DBCosmosDBConnectionModeGateway`
+- `DBCosmosDBConnectionModeKey`
+- `DBCosmosDBOperationTypeBatch`
+- `DBCosmosDBOperationTypeCreate`
+- `DBCosmosDBOperationTypeDelete`
+- `DBCosmosDBOperationTypeExecute`
+- `DBCosmosDBOperationTypeExecuteJavascript`
+- `DBCosmosDBOperationTypeHead`
+- `DBCosmosDBOperationTypeHeadFeed`
+- `DBCosmosDBOperationTypeInvalid`
+- `DBCosmosDBOperationTypeKey`
+- `DBCosmosDBOperationTypePatch`
+- `DBCosmosDBOperationTypeQuery`
+- `DBCosmosDBOperationTypeQueryPlan`
+- `DBCosmosDBOperationTypeRead`
+- `DBCosmosDBOperationTypeReadFeed`
+- `DBCosmosDBOperationTypeReplace`
+- `DBCosmosDBOperationTypeUpsert`
+- `DBCosmosDBRequestCharge`
+- `DBCosmosDBRequestChargeKey`
+- `DBCosmosDBRequestContentLength`
+- `DBCosmosDBRequestContentLengthKey`
+- `DBCosmosDBSubStatusCode`
+- `DBCosmosDBSubStatusCodeKey`
+- `DBElasticsearchNodeName`
+- `DBElasticsearchNodeNameKey`
+- `DBSystemAdabas`
+- `DBSystemCache`
+- `DBSystemCassandra`
+- `DBSystemClickhouse`
+- `DBSystemCloudscape`
+- `DBSystemCockroachdb`
+- `DBSystemColdfusion`
+- `DBSystemCosmosDB`
+- `DBSystemCouchDB`
+- `DBSystemCouchbase`
+- `DBSystemDb2`
+- `DBSystemDerby`
+- `DBSystemDynamoDB`
+- `DBSystemEDB`
+- `DBSystemElasticsearch`
+- `DBSystemFilemaker`
+- `DBSystemFirebird`
+- `DBSystemFirstSQL`
+- `DBSystemGeode`
+- `DBSystemH2`
+- `DBSystemHBase`
+- `DBSystemHSQLDB`
+- `DBSystemHanaDB`
+- `DBSystemHive`
+- `DBSystemInfluxdb`
+- `DBSystemInformix`
+- `DBSystemIngres`
+- `DBSystemInstantDB`
+- `DBSystemInterbase`
+- `DBSystemIntersystemsCache`
+- `DBSystemKey`
+- `DBSystemMSSQL`
+- `DBSystemMariaDB`
+- `DBSystemMaxDB`
+- `DBSystemMemcached`
+- `DBSystemMongoDB`
+- `DBSystemMssqlcompact`
+- `DBSystemMySQL`
+- `DBSystemNeo4j`
+- `DBSystemNetezza`
+- `DBSystemOpensearch`
+- `DBSystemOracle`
+- `DBSystemOtherSQL`
+- `DBSystemPervasive`
+- `DBSystemPointbase`
+- `DBSystemPostgreSQL`
+- `DBSystemProgress`
+- `DBSystemRedis`
+- `DBSystemRedshift`
+- `DBSystemSpanner`
+- `DBSystemSqlite`
+- `DBSystemSybase`
+- `DBSystemTeradata`
+- `DBSystemTrino`
+- `DBSystemVertica`
+- `EventName`
+- `EventNameKey`
+- `ExceptionEscaped`
+- `ExceptionEscapedKey`
+- `GenAIOpenaiRequestSeed`
+- `GenAIOpenaiRequestSeedKey`
+- `ProcessExecutableBuildIDProfiling`
+- `ProcessExecutableBuildIDProfilingKey`
+- `SystemNetworkStateClose`
+- `SystemNetworkStateCloseWait`
+- `SystemNetworkStateClosing`
+- `SystemNetworkStateDelete`
+- `SystemNetworkStateEstablished`
+- `SystemNetworkStateFinWait1`
+- `SystemNetworkStateFinWait2`
+- `SystemNetworkStateKey`
+- `SystemNetworkStateLastAck`
+- `SystemNetworkStateListen`
+- `SystemNetworkStateSynRecv`
+- `SystemNetworkStateSynSent`
+- `SystemNetworkStateTimeWait`
+- `VCSRepositoryChangeID`
+- `VCSRepositoryChangeIDKey`
+- `VCSRepositoryChangeTitle`
+- `VCSRepositoryChangeTitleKey`
+- `VCSRepositoryRefName`
+- `VCSRepositoryRefNameKey`
+- `VCSRepositoryRefRevision`
+- `VCSRepositoryRefRevisionKey`
+- `VCSRepositoryRefTypeBranch`
+- `VCSRepositoryRefTypeKey`
+- `VCSRepositoryRefTypeTag`
+
+[OpenTelemetry Semantic Conventions]: https://github.com/open-telemetry/semantic-conventions
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/README.md b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/README.md
new file mode 100644
index 000000000..072ea6928
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/README.md
@@ -0,0 +1,3 @@
+# Semconv v1.30.0
+
+[](https://pkg.go.dev/go.opentelemetry.io/otel/semconv/v1.30.0)
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/attribute_group.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/attribute_group.go
new file mode 100644
index 000000000..60f3df0db
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/attribute_group.go
@@ -0,0 +1,12333 @@
+// Copyright The OpenTelemetry Authors
+// SPDX-License-Identifier: Apache-2.0
+
+// Code generated from semantic convention specification. DO NOT EDIT.
+
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0"
+
+import "go.opentelemetry.io/otel/attribute"
+
+// Namespace: android
+const (
+ // AndroidOSAPILevelKey is the attribute Key conforming to the
+ // "android.os.api_level" semantic conventions. It represents the uniquely
+ // identifies the framework API revision offered by a version (`os.version`) of
+ // the android operating system. More information can be found [here].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "33", "32"
+ //
+ // [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels
+ AndroidOSAPILevelKey = attribute.Key("android.os.api_level")
+)
+
+// AndroidOSAPILevel returns an attribute KeyValue conforming to the
+// "android.os.api_level" semantic conventions. It represents the uniquely
+// identifies the framework API revision offered by a version (`os.version`) of
+// the android operating system. More information can be found [here].
+//
+// [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels
+func AndroidOSAPILevel(val string) attribute.KeyValue {
+ return AndroidOSAPILevelKey.String(val)
+}
+
+// Namespace: artifact
+const (
+ // ArtifactAttestationFilenameKey is the attribute Key conforming to the
+ // "artifact.attestation.filename" semantic conventions. It represents the
+ // provenance filename of the built attestation which directly relates to the
+ // build artifact filename. This filename SHOULD accompany the artifact at
+ // publish time. See the [SLSA Relationship] specification for more information.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "golang-binary-amd64-v0.1.0.attestation",
+ // "docker-image-amd64-v0.1.0.intoto.json1", "release-1.tar.gz.attestation",
+ // "file-name-package.tar.gz.intoto.json1"
+ //
+ // [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations
+ ArtifactAttestationFilenameKey = attribute.Key("artifact.attestation.filename")
+
+ // ArtifactAttestationHashKey is the attribute Key conforming to the
+ // "artifact.attestation.hash" semantic conventions. It represents the full
+ // [hash value (see glossary)], of the built attestation. Some envelopes in the
+ // [software attestation space] also refer to this as the **digest**.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1b31dfcd5b7f9267bf2ff47651df1cfb9147b9e4df1f335accf65b4cda498408"
+ //
+ // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ // [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec
+ ArtifactAttestationHashKey = attribute.Key("artifact.attestation.hash")
+
+ // ArtifactAttestationIDKey is the attribute Key conforming to the
+ // "artifact.attestation.id" semantic conventions. It represents the id of the
+ // build [software attestation].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "123"
+ //
+ // [software attestation]: https://slsa.dev/attestation-model
+ ArtifactAttestationIDKey = attribute.Key("artifact.attestation.id")
+
+ // ArtifactFilenameKey is the attribute Key conforming to the
+ // "artifact.filename" semantic conventions. It represents the human readable
+ // file name of the artifact, typically generated during build and release
+ // processes. Often includes the package name and version in the file name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "golang-binary-amd64-v0.1.0", "docker-image-amd64-v0.1.0",
+ // "release-1.tar.gz", "file-name-package.tar.gz"
+ // Note: This file name can also act as the [Package Name]
+ // in cases where the package ecosystem maps accordingly.
+ // Additionally, the artifact [can be published]
+ // for others, but that is not a guarantee.
+ //
+ // [Package Name]: https://slsa.dev/spec/v1.0/terminology#package-model
+ // [can be published]: https://slsa.dev/spec/v1.0/terminology#software-supply-chain
+ ArtifactFilenameKey = attribute.Key("artifact.filename")
+
+ // ArtifactHashKey is the attribute Key conforming to the "artifact.hash"
+ // semantic conventions. It represents the full [hash value (see glossary)],
+ // often found in checksum.txt on a release of the artifact and used to verify
+ // package integrity.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9ff4c52759e2c4ac70b7d517bc7fcdc1cda631ca0045271ddd1b192544f8a3e9"
+ // Note: The specific algorithm used to create the cryptographic hash value is
+ // not defined. In situations where an artifact has multiple
+ // cryptographic hashes, it is up to the implementer to choose which
+ // hash value to set here; this should be the most secure hash algorithm
+ // that is suitable for the situation and consistent with the
+ // corresponding attestation. The implementer can then provide the other
+ // hash values through an additional set of attribute extensions as they
+ // deem necessary.
+ //
+ // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ ArtifactHashKey = attribute.Key("artifact.hash")
+
+ // ArtifactPurlKey is the attribute Key conforming to the "artifact.purl"
+ // semantic conventions. It represents the [Package URL] of the
+ // [package artifact] provides a standard way to identify and locate the
+ // packaged artifact.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pkg:github/package-url/purl-spec@1209109710924",
+ // "pkg:npm/foo@12.12.3"
+ //
+ // [Package URL]: https://github.com/package-url/purl-spec
+ // [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model
+ ArtifactPurlKey = attribute.Key("artifact.purl")
+
+ // ArtifactVersionKey is the attribute Key conforming to the "artifact.version"
+ // semantic conventions. It represents the version of the artifact.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "v0.1.0", "1.2.1", "122691-build"
+ ArtifactVersionKey = attribute.Key("artifact.version")
+)
+
+// ArtifactAttestationFilename returns an attribute KeyValue conforming to the
+// "artifact.attestation.filename" semantic conventions. It represents the
+// provenance filename of the built attestation which directly relates to the
+// build artifact filename. This filename SHOULD accompany the artifact at
+// publish time. See the [SLSA Relationship] specification for more information.
+//
+// [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations
+func ArtifactAttestationFilename(val string) attribute.KeyValue {
+ return ArtifactAttestationFilenameKey.String(val)
+}
+
+// ArtifactAttestationHash returns an attribute KeyValue conforming to the
+// "artifact.attestation.hash" semantic conventions. It represents the full
+// [hash value (see glossary)], of the built attestation. Some envelopes in the
+// [software attestation space] also refer to this as the **digest**.
+//
+// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+// [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec
+func ArtifactAttestationHash(val string) attribute.KeyValue {
+ return ArtifactAttestationHashKey.String(val)
+}
+
+// ArtifactAttestationID returns an attribute KeyValue conforming to the
+// "artifact.attestation.id" semantic conventions. It represents the id of the
+// build [software attestation].
+//
+// [software attestation]: https://slsa.dev/attestation-model
+func ArtifactAttestationID(val string) attribute.KeyValue {
+ return ArtifactAttestationIDKey.String(val)
+}
+
+// ArtifactFilename returns an attribute KeyValue conforming to the
+// "artifact.filename" semantic conventions. It represents the human readable
+// file name of the artifact, typically generated during build and release
+// processes. Often includes the package name and version in the file name.
+func ArtifactFilename(val string) attribute.KeyValue {
+ return ArtifactFilenameKey.String(val)
+}
+
+// ArtifactHash returns an attribute KeyValue conforming to the "artifact.hash"
+// semantic conventions. It represents the full [hash value (see glossary)],
+// often found in checksum.txt on a release of the artifact and used to verify
+// package integrity.
+//
+// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+func ArtifactHash(val string) attribute.KeyValue {
+ return ArtifactHashKey.String(val)
+}
+
+// ArtifactPurl returns an attribute KeyValue conforming to the "artifact.purl"
+// semantic conventions. It represents the [Package URL] of the
+// [package artifact] provides a standard way to identify and locate the packaged
+// artifact.
+//
+// [Package URL]: https://github.com/package-url/purl-spec
+// [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model
+func ArtifactPurl(val string) attribute.KeyValue {
+ return ArtifactPurlKey.String(val)
+}
+
+// ArtifactVersion returns an attribute KeyValue conforming to the
+// "artifact.version" semantic conventions. It represents the version of the
+// artifact.
+func ArtifactVersion(val string) attribute.KeyValue {
+ return ArtifactVersionKey.String(val)
+}
+
+// Namespace: aws
+const (
+ // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to the
+ // "aws.dynamodb.attribute_definitions" semantic conventions. It represents the
+ // JSON-serialized value of each item in the `AttributeDefinitions` request
+ // field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "AttributeName": "string", "AttributeType": "string" }"
+ AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions")
+
+ // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the
+ // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the
+ // value of the `AttributesToGet` request parameter.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "lives", "id"
+ AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get")
+
+ // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the
+ // "aws.dynamodb.consistent_read" semantic conventions. It represents the value
+ // of the `ConsistentRead` request parameter.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read")
+
+ // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the
+ // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
+ // JSON-serialized value of each item in the `ConsumedCapacity` response field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "CapacityUnits": number, "GlobalSecondaryIndexes": { "string" :
+ // { "CapacityUnits": number, "ReadCapacityUnits": number, "WriteCapacityUnits":
+ // number } }, "LocalSecondaryIndexes": { "string" : { "CapacityUnits": number,
+ // "ReadCapacityUnits": number, "WriteCapacityUnits": number } },
+ // "ReadCapacityUnits": number, "Table": { "CapacityUnits": number,
+ // "ReadCapacityUnits": number, "WriteCapacityUnits": number }, "TableName":
+ // "string", "WriteCapacityUnits": number }"
+ AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity")
+
+ // AWSDynamoDBCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.count" semantic conventions. It represents the value of the
+ // `Count` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10
+ AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count")
+
+ // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the
+ // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the
+ // value of the `ExclusiveStartTableName` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Users", "CatsTable"
+ AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table")
+
+ // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key conforming to
+ // the "aws.dynamodb.global_secondary_index_updates" semantic conventions. It
+ // represents the JSON-serialized value of each item in the
+ // `GlobalSecondaryIndexUpdates` request field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "Create": { "IndexName": "string", "KeySchema": [ {
+ // "AttributeName": "string", "KeyType": "string" } ], "Projection": {
+ // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" },
+ // "ProvisionedThroughput": { "ReadCapacityUnits": number, "WriteCapacityUnits":
+ // number } }"
+ AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates")
+
+ // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to the
+ // "aws.dynamodb.global_secondary_indexes" semantic conventions. It represents
+ // the JSON-serialized value of each item of the `GlobalSecondaryIndexes`
+ // request field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "IndexName": "string", "KeySchema": [ { "AttributeName":
+ // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [
+ // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": {
+ // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }"
+ AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes")
+
+ // AWSDynamoDBIndexNameKey is the attribute Key conforming to the
+ // "aws.dynamodb.index_name" semantic conventions. It represents the value of
+ // the `IndexName` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "name_to_group"
+ AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name")
+
+ // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to the
+ // "aws.dynamodb.item_collection_metrics" semantic conventions. It represents
+ // the JSON-serialized value of the `ItemCollectionMetrics` response field.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "string" : [ { "ItemCollectionKey": { "string" : { "B": blob,
+ // "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": { "string" :
+ // "AttributeValue" }, "N": "string", "NS": [ "string" ], "NULL": boolean, "S":
+ // "string", "SS": [ "string" ] } }, "SizeEstimateRangeGB": [ number ] } ] }"
+ AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics")
+
+ // AWSDynamoDBLimitKey is the attribute Key conforming to the
+ // "aws.dynamodb.limit" semantic conventions. It represents the value of the
+ // `Limit` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10
+ AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit")
+
+ // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to the
+ // "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents
+ // the JSON-serialized value of each item of the `LocalSecondaryIndexes` request
+ // field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "IndexArn": "string", "IndexName": "string", "IndexSizeBytes":
+ // number, "ItemCount": number, "KeySchema": [ { "AttributeName": "string",
+ // "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ "string" ],
+ // "ProjectionType": "string" } }"
+ AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes")
+
+ // AWSDynamoDBProjectionKey is the attribute Key conforming to the
+ // "aws.dynamodb.projection" semantic conventions. It represents the value of
+ // the `ProjectionExpression` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Title", "Title, Price, Color", "Title, Description, RelatedItems,
+ // ProductReviews"
+ AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection")
+
+ // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to the
+ // "aws.dynamodb.provisioned_read_capacity" semantic conventions. It represents
+ // the value of the `ProvisionedThroughput.ReadCapacityUnits` request parameter.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0, 2.0
+ AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity")
+
+ // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming to the
+ // "aws.dynamodb.provisioned_write_capacity" semantic conventions. It represents
+ // the value of the `ProvisionedThroughput.WriteCapacityUnits` request
+ // parameter.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0, 2.0
+ AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity")
+
+ // AWSDynamoDBScanForwardKey is the attribute Key conforming to the
+ // "aws.dynamodb.scan_forward" semantic conventions. It represents the value of
+ // the `ScanIndexForward` request parameter.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward")
+
+ // AWSDynamoDBScannedCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.scanned_count" semantic conventions. It represents the value of
+ // the `ScannedCount` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 50
+ AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count")
+
+ // AWSDynamoDBSegmentKey is the attribute Key conforming to the
+ // "aws.dynamodb.segment" semantic conventions. It represents the value of the
+ // `Segment` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10
+ AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment")
+
+ // AWSDynamoDBSelectKey is the attribute Key conforming to the
+ // "aws.dynamodb.select" semantic conventions. It represents the value of the
+ // `Select` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ALL_ATTRIBUTES", "COUNT"
+ AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select")
+
+ // AWSDynamoDBTableCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.table_count" semantic conventions. It represents the number of
+ // items in the `TableNames` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 20
+ AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count")
+
+ // AWSDynamoDBTableNamesKey is the attribute Key conforming to the
+ // "aws.dynamodb.table_names" semantic conventions. It represents the keys in
+ // the `RequestItems` object field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Users", "Cats"
+ AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names")
+
+ // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the
+ // "aws.dynamodb.total_segments" semantic conventions. It represents the value
+ // of the `TotalSegments` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments")
+
+ // AWSECSClusterARNKey is the attribute Key conforming to the
+ // "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an
+ // [ECS cluster].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster"
+ //
+ // [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html
+ AWSECSClusterARNKey = attribute.Key("aws.ecs.cluster.arn")
+
+ // AWSECSContainerARNKey is the attribute Key conforming to the
+ // "aws.ecs.container.arn" semantic conventions. It represents the Amazon
+ // Resource Name (ARN) of an [ECS container instance].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:ecs:us-west-1:123456789123:container/32624152-9086-4f0e-acae-1a75b14fe4d9"
+ //
+ // [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html
+ AWSECSContainerARNKey = attribute.Key("aws.ecs.container.arn")
+
+ // AWSECSLaunchtypeKey is the attribute Key conforming to the
+ // "aws.ecs.launchtype" semantic conventions. It represents the [launch type]
+ // for an ECS task.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [launch type]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/launch_types.html
+ AWSECSLaunchtypeKey = attribute.Key("aws.ecs.launchtype")
+
+ // AWSECSTaskARNKey is the attribute Key conforming to the "aws.ecs.task.arn"
+ // semantic conventions. It represents the ARN of a running [ECS task].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:ecs:us-west-1:123456789123:task/10838bed-421f-43ef-870a-f43feacbbb5b",
+ // "arn:aws:ecs:us-west-1:123456789123:task/my-cluster/task-id/23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd"
+ //
+ // [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids
+ AWSECSTaskARNKey = attribute.Key("aws.ecs.task.arn")
+
+ // AWSECSTaskFamilyKey is the attribute Key conforming to the
+ // "aws.ecs.task.family" semantic conventions. It represents the family name of
+ // the [ECS task definition] used to create the ECS task.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-family"
+ //
+ // [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html
+ AWSECSTaskFamilyKey = attribute.Key("aws.ecs.task.family")
+
+ // AWSECSTaskIDKey is the attribute Key conforming to the "aws.ecs.task.id"
+ // semantic conventions. It represents the ID of a running ECS task. The ID MUST
+ // be extracted from `task.arn`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "10838bed-421f-43ef-870a-f43feacbbb5b",
+ // "23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd"
+ AWSECSTaskIDKey = attribute.Key("aws.ecs.task.id")
+
+ // AWSECSTaskRevisionKey is the attribute Key conforming to the
+ // "aws.ecs.task.revision" semantic conventions. It represents the revision for
+ // the task definition used to create the ECS task.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "8", "26"
+ AWSECSTaskRevisionKey = attribute.Key("aws.ecs.task.revision")
+
+ // AWSEKSClusterARNKey is the attribute Key conforming to the
+ // "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS
+ // cluster.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster"
+ AWSEKSClusterARNKey = attribute.Key("aws.eks.cluster.arn")
+
+ // AWSExtendedRequestIDKey is the attribute Key conforming to the
+ // "aws.extended_request_id" semantic conventions. It represents the AWS
+ // extended request ID as returned in the response header `x-amz-id-2`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "wzHcyEWfmOGDIE5QOhTAqFDoDWP3y8IUvpNINCwL9N4TEHbUw0/gZJ+VZTmCNCWR7fezEN3eCiQ="
+ AWSExtendedRequestIDKey = attribute.Key("aws.extended_request_id")
+
+ // AWSLambdaInvokedARNKey is the attribute Key conforming to the
+ // "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked
+ // ARN as provided on the `Context` passed to the function (
+ // `Lambda-Runtime-Invoked-Function-Arn` header on the
+ // `/runtime/invocation/next` applicable).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:lambda:us-east-1:123456:function:myfunction:myalias"
+ // Note: This may be different from `cloud.resource_id` if an alias is involved.
+ AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn")
+
+ // AWSLogGroupARNsKey is the attribute Key conforming to the
+ // "aws.log.group.arns" semantic conventions. It represents the Amazon Resource
+ // Name(s) (ARN) of the AWS log group(s).
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:*"
+ // Note: See the [log group ARN format documentation].
+ //
+ // [log group ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format
+ AWSLogGroupARNsKey = attribute.Key("aws.log.group.arns")
+
+ // AWSLogGroupNamesKey is the attribute Key conforming to the
+ // "aws.log.group.names" semantic conventions. It represents the name(s) of the
+ // AWS log group(s) an application is writing to.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/aws/lambda/my-function", "opentelemetry-service"
+ // Note: Multiple log groups must be supported for cases like multi-container
+ // applications, where a single application has sidecar containers, and each
+ // write to their own log group.
+ AWSLogGroupNamesKey = attribute.Key("aws.log.group.names")
+
+ // AWSLogStreamARNsKey is the attribute Key conforming to the
+ // "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the
+ // AWS log stream(s).
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:log-stream:logs/main/10838bed-421f-43ef-870a-f43feacbbb5b"
+ // Note: See the [log stream ARN format documentation]. One log group can
+ // contain several log streams, so these ARNs necessarily identify both a log
+ // group and a log stream.
+ //
+ // [log stream ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format
+ AWSLogStreamARNsKey = attribute.Key("aws.log.stream.arns")
+
+ // AWSLogStreamNamesKey is the attribute Key conforming to the
+ // "aws.log.stream.names" semantic conventions. It represents the name(s) of the
+ // AWS log stream(s) an application is writing to.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "logs/main/10838bed-421f-43ef-870a-f43feacbbb5b"
+ AWSLogStreamNamesKey = attribute.Key("aws.log.stream.names")
+
+ // AWSRequestIDKey is the attribute Key conforming to the "aws.request_id"
+ // semantic conventions. It represents the AWS request ID as returned in the
+ // response headers `x-amzn-requestid`, `x-amzn-request-id` or
+ // `x-amz-request-id`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "79b9da39-b7ae-508a-a6bc-864b2829c622", "C9ER4AJX75574TDJ"
+ AWSRequestIDKey = attribute.Key("aws.request_id")
+
+ // AWSS3BucketKey is the attribute Key conforming to the "aws.s3.bucket"
+ // semantic conventions. It represents the S3 bucket name the request refers to.
+ // Corresponds to the `--bucket` parameter of the [S3 API] operations.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "some-bucket-name"
+ // Note: The `bucket` attribute is applicable to all S3 operations that
+ // reference a bucket, i.e. that require the bucket name as a mandatory
+ // parameter.
+ // This applies to almost all S3 operations except `list-buckets`.
+ //
+ // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+ AWSS3BucketKey = attribute.Key("aws.s3.bucket")
+
+ // AWSS3CopySourceKey is the attribute Key conforming to the
+ // "aws.s3.copy_source" semantic conventions. It represents the source object
+ // (in the form `bucket`/`key`) for the copy operation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "someFile.yml"
+ // Note: The `copy_source` attribute applies to S3 copy operations and
+ // corresponds to the `--copy-source` parameter
+ // of the [copy-object operation within the S3 API].
+ // This applies in particular to the following operations:
+ //
+ // - [copy-object]
+ // - [upload-part-copy]
+ //
+ //
+ // [copy-object operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html
+ // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ AWSS3CopySourceKey = attribute.Key("aws.s3.copy_source")
+
+ // AWSS3DeleteKey is the attribute Key conforming to the "aws.s3.delete"
+ // semantic conventions. It represents the delete request container that
+ // specifies the objects to be deleted.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "Objects=[{Key=string,VersionId=string},{Key=string,VersionId=string}],Quiet=boolean"
+ // Note: The `delete` attribute is only applicable to the [delete-object]
+ // operation.
+ // The `delete` attribute corresponds to the `--delete` parameter of the
+ // [delete-objects operation within the S3 API].
+ //
+ // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html
+ // [delete-objects operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-objects.html
+ AWSS3DeleteKey = attribute.Key("aws.s3.delete")
+
+ // AWSS3KeyKey is the attribute Key conforming to the "aws.s3.key" semantic
+ // conventions. It represents the S3 object key the request refers to.
+ // Corresponds to the `--key` parameter of the [S3 API] operations.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "someFile.yml"
+ // Note: The `key` attribute is applicable to all object-related S3 operations,
+ // i.e. that require the object key as a mandatory parameter.
+ // This applies in particular to the following operations:
+ //
+ // - [copy-object]
+ // - [delete-object]
+ // - [get-object]
+ // - [head-object]
+ // - [put-object]
+ // - [restore-object]
+ // - [select-object-content]
+ // - [abort-multipart-upload]
+ // - [complete-multipart-upload]
+ // - [create-multipart-upload]
+ // - [list-parts]
+ // - [upload-part]
+ // - [upload-part-copy]
+ //
+ //
+ // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+ // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html
+ // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html
+ // [get-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/get-object.html
+ // [head-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/head-object.html
+ // [put-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/put-object.html
+ // [restore-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/restore-object.html
+ // [select-object-content]: https://docs.aws.amazon.com/cli/latest/reference/s3api/select-object-content.html
+ // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html
+ // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html
+ // [create-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/create-multipart-upload.html
+ // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html
+ // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ AWSS3KeyKey = attribute.Key("aws.s3.key")
+
+ // AWSS3PartNumberKey is the attribute Key conforming to the
+ // "aws.s3.part_number" semantic conventions. It represents the part number of
+ // the part being uploaded in a multipart-upload operation. This is a positive
+ // integer between 1 and 10,000.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 3456
+ // Note: The `part_number` attribute is only applicable to the [upload-part]
+ // and [upload-part-copy] operations.
+ // The `part_number` attribute corresponds to the `--part-number` parameter of
+ // the
+ // [upload-part operation within the S3 API].
+ //
+ // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ // [upload-part operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ AWSS3PartNumberKey = attribute.Key("aws.s3.part_number")
+
+ // AWSS3UploadIDKey is the attribute Key conforming to the "aws.s3.upload_id"
+ // semantic conventions. It represents the upload ID that identifies the
+ // multipart upload.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "dfRtDYWFbkRONycy.Yxwh66Yjlx.cph0gtNBtJ"
+ // Note: The `upload_id` attribute applies to S3 multipart-upload operations and
+ // corresponds to the `--upload-id` parameter
+ // of the [S3 API] multipart operations.
+ // This applies in particular to the following operations:
+ //
+ // - [abort-multipart-upload]
+ // - [complete-multipart-upload]
+ // - [list-parts]
+ // - [upload-part]
+ // - [upload-part-copy]
+ //
+ //
+ // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+ // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html
+ // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html
+ // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html
+ // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ AWSS3UploadIDKey = attribute.Key("aws.s3.upload_id")
+)
+
+// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming to
+// the "aws.dynamodb.attribute_definitions" semantic conventions. It represents
+// the JSON-serialized value of each item in the `AttributeDefinitions` request
+// field.
+func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue {
+ return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val)
+}
+
+// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to the
+// "aws.dynamodb.attributes_to_get" semantic conventions. It represents the value
+// of the `AttributesToGet` request parameter.
+func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue {
+ return AWSDynamoDBAttributesToGetKey.StringSlice(val)
+}
+
+// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the
+// "aws.dynamodb.consistent_read" semantic conventions. It represents the value
+// of the `ConsistentRead` request parameter.
+func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue {
+ return AWSDynamoDBConsistentReadKey.Bool(val)
+}
+
+// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to the
+// "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
+// JSON-serialized value of each item in the `ConsumedCapacity` response field.
+func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue {
+ return AWSDynamoDBConsumedCapacityKey.StringSlice(val)
+}
+
+// AWSDynamoDBCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.count" semantic conventions. It represents the value of the
+// `Count` response parameter.
+func AWSDynamoDBCount(val int) attribute.KeyValue {
+ return AWSDynamoDBCountKey.Int(val)
+}
+
+// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming to the
+// "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the
+// value of the `ExclusiveStartTableName` request parameter.
+func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue {
+ return AWSDynamoDBExclusiveStartTableKey.String(val)
+}
+
+// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue
+// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic
+// conventions. It represents the JSON-serialized value of each item in the
+// `GlobalSecondaryIndexUpdates` request field.
+func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue {
+ return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val)
+}
+
+// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue conforming to
+// the "aws.dynamodb.global_secondary_indexes" semantic conventions. It
+// represents the JSON-serialized value of each item of the
+// `GlobalSecondaryIndexes` request field.
+func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue {
+ return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val)
+}
+
+// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the
+// "aws.dynamodb.index_name" semantic conventions. It represents the value of the
+// `IndexName` request parameter.
+func AWSDynamoDBIndexName(val string) attribute.KeyValue {
+ return AWSDynamoDBIndexNameKey.String(val)
+}
+
+// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming to
+// the "aws.dynamodb.item_collection_metrics" semantic conventions. It represents
+// the JSON-serialized value of the `ItemCollectionMetrics` response field.
+func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue {
+ return AWSDynamoDBItemCollectionMetricsKey.String(val)
+}
+
+// AWSDynamoDBLimit returns an attribute KeyValue conforming to the
+// "aws.dynamodb.limit" semantic conventions. It represents the value of the
+// `Limit` request parameter.
+func AWSDynamoDBLimit(val int) attribute.KeyValue {
+ return AWSDynamoDBLimitKey.Int(val)
+}
+
+// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming to
+// the "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents
+// the JSON-serialized value of each item of the `LocalSecondaryIndexes` request
+// field.
+func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue {
+ return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val)
+}
+
+// AWSDynamoDBProjection returns an attribute KeyValue conforming to the
+// "aws.dynamodb.projection" semantic conventions. It represents the value of the
+// `ProjectionExpression` request parameter.
+func AWSDynamoDBProjection(val string) attribute.KeyValue {
+ return AWSDynamoDBProjectionKey.String(val)
+}
+
+// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue conforming to
+// the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It
+// represents the value of the `ProvisionedThroughput.ReadCapacityUnits` request
+// parameter.
+func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue {
+ return AWSDynamoDBProvisionedReadCapacityKey.Float64(val)
+}
+
+// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue conforming
+// to the "aws.dynamodb.provisioned_write_capacity" semantic conventions. It
+// represents the value of the `ProvisionedThroughput.WriteCapacityUnits` request
+// parameter.
+func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue {
+ return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val)
+}
+
+// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the
+// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of
+// the `ScanIndexForward` request parameter.
+func AWSDynamoDBScanForward(val bool) attribute.KeyValue {
+ return AWSDynamoDBScanForwardKey.Bool(val)
+}
+
+// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.scanned_count" semantic conventions. It represents the value of
+// the `ScannedCount` response parameter.
+func AWSDynamoDBScannedCount(val int) attribute.KeyValue {
+ return AWSDynamoDBScannedCountKey.Int(val)
+}
+
+// AWSDynamoDBSegment returns an attribute KeyValue conforming to the
+// "aws.dynamodb.segment" semantic conventions. It represents the value of the
+// `Segment` request parameter.
+func AWSDynamoDBSegment(val int) attribute.KeyValue {
+ return AWSDynamoDBSegmentKey.Int(val)
+}
+
+// AWSDynamoDBSelect returns an attribute KeyValue conforming to the
+// "aws.dynamodb.select" semantic conventions. It represents the value of the
+// `Select` request parameter.
+func AWSDynamoDBSelect(val string) attribute.KeyValue {
+ return AWSDynamoDBSelectKey.String(val)
+}
+
+// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.table_count" semantic conventions. It represents the number of
+// items in the `TableNames` response parameter.
+func AWSDynamoDBTableCount(val int) attribute.KeyValue {
+ return AWSDynamoDBTableCountKey.Int(val)
+}
+
+// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the
+// "aws.dynamodb.table_names" semantic conventions. It represents the keys in the
+// `RequestItems` object field.
+func AWSDynamoDBTableNames(val ...string) attribute.KeyValue {
+ return AWSDynamoDBTableNamesKey.StringSlice(val)
+}
+
+// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the
+// "aws.dynamodb.total_segments" semantic conventions. It represents the value of
+// the `TotalSegments` request parameter.
+func AWSDynamoDBTotalSegments(val int) attribute.KeyValue {
+ return AWSDynamoDBTotalSegmentsKey.Int(val)
+}
+
+// AWSECSClusterARN returns an attribute KeyValue conforming to the
+// "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an
+// [ECS cluster].
+//
+// [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html
+func AWSECSClusterARN(val string) attribute.KeyValue {
+ return AWSECSClusterARNKey.String(val)
+}
+
+// AWSECSContainerARN returns an attribute KeyValue conforming to the
+// "aws.ecs.container.arn" semantic conventions. It represents the Amazon
+// Resource Name (ARN) of an [ECS container instance].
+//
+// [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html
+func AWSECSContainerARN(val string) attribute.KeyValue {
+ return AWSECSContainerARNKey.String(val)
+}
+
+// AWSECSTaskARN returns an attribute KeyValue conforming to the
+// "aws.ecs.task.arn" semantic conventions. It represents the ARN of a running
+// [ECS task].
+//
+// [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids
+func AWSECSTaskARN(val string) attribute.KeyValue {
+ return AWSECSTaskARNKey.String(val)
+}
+
+// AWSECSTaskFamily returns an attribute KeyValue conforming to the
+// "aws.ecs.task.family" semantic conventions. It represents the family name of
+// the [ECS task definition] used to create the ECS task.
+//
+// [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html
+func AWSECSTaskFamily(val string) attribute.KeyValue {
+ return AWSECSTaskFamilyKey.String(val)
+}
+
+// AWSECSTaskID returns an attribute KeyValue conforming to the "aws.ecs.task.id"
+// semantic conventions. It represents the ID of a running ECS task. The ID MUST
+// be extracted from `task.arn`.
+func AWSECSTaskID(val string) attribute.KeyValue {
+ return AWSECSTaskIDKey.String(val)
+}
+
+// AWSECSTaskRevision returns an attribute KeyValue conforming to the
+// "aws.ecs.task.revision" semantic conventions. It represents the revision for
+// the task definition used to create the ECS task.
+func AWSECSTaskRevision(val string) attribute.KeyValue {
+ return AWSECSTaskRevisionKey.String(val)
+}
+
+// AWSEKSClusterARN returns an attribute KeyValue conforming to the
+// "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS
+// cluster.
+func AWSEKSClusterARN(val string) attribute.KeyValue {
+ return AWSEKSClusterARNKey.String(val)
+}
+
+// AWSExtendedRequestID returns an attribute KeyValue conforming to the
+// "aws.extended_request_id" semantic conventions. It represents the AWS extended
+// request ID as returned in the response header `x-amz-id-2`.
+func AWSExtendedRequestID(val string) attribute.KeyValue {
+ return AWSExtendedRequestIDKey.String(val)
+}
+
+// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the
+// "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked
+// ARN as provided on the `Context` passed to the function (
+// `Lambda-Runtime-Invoked-Function-Arn` header on the `/runtime/invocation/next`
+// applicable).
+func AWSLambdaInvokedARN(val string) attribute.KeyValue {
+ return AWSLambdaInvokedARNKey.String(val)
+}
+
+// AWSLogGroupARNs returns an attribute KeyValue conforming to the
+// "aws.log.group.arns" semantic conventions. It represents the Amazon Resource
+// Name(s) (ARN) of the AWS log group(s).
+func AWSLogGroupARNs(val ...string) attribute.KeyValue {
+ return AWSLogGroupARNsKey.StringSlice(val)
+}
+
+// AWSLogGroupNames returns an attribute KeyValue conforming to the
+// "aws.log.group.names" semantic conventions. It represents the name(s) of the
+// AWS log group(s) an application is writing to.
+func AWSLogGroupNames(val ...string) attribute.KeyValue {
+ return AWSLogGroupNamesKey.StringSlice(val)
+}
+
+// AWSLogStreamARNs returns an attribute KeyValue conforming to the
+// "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the
+// AWS log stream(s).
+func AWSLogStreamARNs(val ...string) attribute.KeyValue {
+ return AWSLogStreamARNsKey.StringSlice(val)
+}
+
+// AWSLogStreamNames returns an attribute KeyValue conforming to the
+// "aws.log.stream.names" semantic conventions. It represents the name(s) of the
+// AWS log stream(s) an application is writing to.
+func AWSLogStreamNames(val ...string) attribute.KeyValue {
+ return AWSLogStreamNamesKey.StringSlice(val)
+}
+
+// AWSRequestID returns an attribute KeyValue conforming to the "aws.request_id"
+// semantic conventions. It represents the AWS request ID as returned in the
+// response headers `x-amzn-requestid`, `x-amzn-request-id` or `x-amz-request-id`
+// .
+func AWSRequestID(val string) attribute.KeyValue {
+ return AWSRequestIDKey.String(val)
+}
+
+// AWSS3Bucket returns an attribute KeyValue conforming to the "aws.s3.bucket"
+// semantic conventions. It represents the S3 bucket name the request refers to.
+// Corresponds to the `--bucket` parameter of the [S3 API] operations.
+//
+// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+func AWSS3Bucket(val string) attribute.KeyValue {
+ return AWSS3BucketKey.String(val)
+}
+
+// AWSS3CopySource returns an attribute KeyValue conforming to the
+// "aws.s3.copy_source" semantic conventions. It represents the source object (in
+// the form `bucket`/`key`) for the copy operation.
+func AWSS3CopySource(val string) attribute.KeyValue {
+ return AWSS3CopySourceKey.String(val)
+}
+
+// AWSS3Delete returns an attribute KeyValue conforming to the "aws.s3.delete"
+// semantic conventions. It represents the delete request container that
+// specifies the objects to be deleted.
+func AWSS3Delete(val string) attribute.KeyValue {
+ return AWSS3DeleteKey.String(val)
+}
+
+// AWSS3Key returns an attribute KeyValue conforming to the "aws.s3.key" semantic
+// conventions. It represents the S3 object key the request refers to.
+// Corresponds to the `--key` parameter of the [S3 API] operations.
+//
+// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+func AWSS3Key(val string) attribute.KeyValue {
+ return AWSS3KeyKey.String(val)
+}
+
+// AWSS3PartNumber returns an attribute KeyValue conforming to the
+// "aws.s3.part_number" semantic conventions. It represents the part number of
+// the part being uploaded in a multipart-upload operation. This is a positive
+// integer between 1 and 10,000.
+func AWSS3PartNumber(val int) attribute.KeyValue {
+ return AWSS3PartNumberKey.Int(val)
+}
+
+// AWSS3UploadID returns an attribute KeyValue conforming to the
+// "aws.s3.upload_id" semantic conventions. It represents the upload ID that
+// identifies the multipart upload.
+func AWSS3UploadID(val string) attribute.KeyValue {
+ return AWSS3UploadIDKey.String(val)
+}
+
+// Enum values for aws.ecs.launchtype
+var (
+ // ec2
+ // Stability: development
+ AWSECSLaunchtypeEC2 = AWSECSLaunchtypeKey.String("ec2")
+ // fargate
+ // Stability: development
+ AWSECSLaunchtypeFargate = AWSECSLaunchtypeKey.String("fargate")
+)
+
+// Namespace: az
+const (
+ // AzNamespaceKey is the attribute Key conforming to the "az.namespace" semantic
+ // conventions. It represents the [Azure Resource Provider Namespace] as
+ // recognized by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Microsoft.Storage", "Microsoft.KeyVault", "Microsoft.ServiceBus"
+ //
+ // [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers
+ AzNamespaceKey = attribute.Key("az.namespace")
+
+ // AzServiceRequestIDKey is the attribute Key conforming to the
+ // "az.service_request_id" semantic conventions. It represents the unique
+ // identifier of the service request. It's generated by the Azure service and
+ // returned with the response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "00000000-0000-0000-0000-000000000000"
+ AzServiceRequestIDKey = attribute.Key("az.service_request_id")
+)
+
+// AzNamespace returns an attribute KeyValue conforming to the "az.namespace"
+// semantic conventions. It represents the [Azure Resource Provider Namespace] as
+// recognized by the client.
+//
+// [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers
+func AzNamespace(val string) attribute.KeyValue {
+ return AzNamespaceKey.String(val)
+}
+
+// AzServiceRequestID returns an attribute KeyValue conforming to the
+// "az.service_request_id" semantic conventions. It represents the unique
+// identifier of the service request. It's generated by the Azure service and
+// returned with the response.
+func AzServiceRequestID(val string) attribute.KeyValue {
+ return AzServiceRequestIDKey.String(val)
+}
+
+// Namespace: azure
+const (
+ // AzureClientIDKey is the attribute Key conforming to the "azure.client.id"
+ // semantic conventions. It represents the unique identifier of the client
+ // instance.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "3ba4827d-4422-483f-b59f-85b74211c11d", "storage-client-1"
+ AzureClientIDKey = attribute.Key("azure.client.id")
+
+ // AzureCosmosDBConnectionModeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.connection.mode" semantic conventions. It represents the
+ // cosmos client connection mode.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AzureCosmosDBConnectionModeKey = attribute.Key("azure.cosmosdb.connection.mode")
+
+ // AzureCosmosDBConsistencyLevelKey is the attribute Key conforming to the
+ // "azure.cosmosdb.consistency.level" semantic conventions. It represents the
+ // account or request [consistency level].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Eventual", "ConsistentPrefix", "BoundedStaleness", "Strong",
+ // "Session"
+ //
+ // [consistency level]: https://learn.microsoft.com/azure/cosmos-db/consistency-levels
+ AzureCosmosDBConsistencyLevelKey = attribute.Key("azure.cosmosdb.consistency.level")
+
+ // AzureCosmosDBOperationContactedRegionsKey is the attribute Key conforming to
+ // the "azure.cosmosdb.operation.contacted_regions" semantic conventions. It
+ // represents the list of regions contacted during operation in the order that
+ // they were contacted. If there is more than one region listed, it indicates
+ // that the operation was performed on multiple regions i.e. cross-regional
+ // call.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "North Central US", "Australia East", "Australia Southeast"
+ // Note: Region name matches the format of `displayName` in [Azure Location API]
+ //
+ // [Azure Location API]: https://learn.microsoft.com/rest/api/subscription/subscriptions/list-locations?view=rest-subscription-2021-10-01&tabs=HTTP#location
+ AzureCosmosDBOperationContactedRegionsKey = attribute.Key("azure.cosmosdb.operation.contacted_regions")
+
+ // AzureCosmosDBOperationRequestChargeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.operation.request_charge" semantic conventions. It represents
+ // the number of request units consumed by the operation.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 46.18, 1.0
+ AzureCosmosDBOperationRequestChargeKey = attribute.Key("azure.cosmosdb.operation.request_charge")
+
+ // AzureCosmosDBRequestBodySizeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.request.body.size" semantic conventions. It represents the
+ // request payload size in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AzureCosmosDBRequestBodySizeKey = attribute.Key("azure.cosmosdb.request.body.size")
+
+ // AzureCosmosDBResponseSubStatusCodeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.response.sub_status_code" semantic conventions. It represents
+ // the cosmos DB sub status code.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1000, 1002
+ AzureCosmosDBResponseSubStatusCodeKey = attribute.Key("azure.cosmosdb.response.sub_status_code")
+)
+
+// AzureClientID returns an attribute KeyValue conforming to the
+// "azure.client.id" semantic conventions. It represents the unique identifier of
+// the client instance.
+func AzureClientID(val string) attribute.KeyValue {
+ return AzureClientIDKey.String(val)
+}
+
+// AzureCosmosDBOperationContactedRegions returns an attribute KeyValue
+// conforming to the "azure.cosmosdb.operation.contacted_regions" semantic
+// conventions. It represents the list of regions contacted during operation in
+// the order that they were contacted. If there is more than one region listed,
+// it indicates that the operation was performed on multiple regions i.e.
+// cross-regional call.
+func AzureCosmosDBOperationContactedRegions(val ...string) attribute.KeyValue {
+ return AzureCosmosDBOperationContactedRegionsKey.StringSlice(val)
+}
+
+// AzureCosmosDBOperationRequestCharge returns an attribute KeyValue conforming
+// to the "azure.cosmosdb.operation.request_charge" semantic conventions. It
+// represents the number of request units consumed by the operation.
+func AzureCosmosDBOperationRequestCharge(val float64) attribute.KeyValue {
+ return AzureCosmosDBOperationRequestChargeKey.Float64(val)
+}
+
+// AzureCosmosDBRequestBodySize returns an attribute KeyValue conforming to the
+// "azure.cosmosdb.request.body.size" semantic conventions. It represents the
+// request payload size in bytes.
+func AzureCosmosDBRequestBodySize(val int) attribute.KeyValue {
+ return AzureCosmosDBRequestBodySizeKey.Int(val)
+}
+
+// AzureCosmosDBResponseSubStatusCode returns an attribute KeyValue conforming to
+// the "azure.cosmosdb.response.sub_status_code" semantic conventions. It
+// represents the cosmos DB sub status code.
+func AzureCosmosDBResponseSubStatusCode(val int) attribute.KeyValue {
+ return AzureCosmosDBResponseSubStatusCodeKey.Int(val)
+}
+
+// Enum values for azure.cosmosdb.connection.mode
+var (
+ // Gateway (HTTP) connection.
+ // Stability: development
+ AzureCosmosDBConnectionModeGateway = AzureCosmosDBConnectionModeKey.String("gateway")
+ // Direct connection.
+ // Stability: development
+ AzureCosmosDBConnectionModeDirect = AzureCosmosDBConnectionModeKey.String("direct")
+)
+
+// Enum values for azure.cosmosdb.consistency.level
+var (
+ // strong
+ // Stability: development
+ AzureCosmosDBConsistencyLevelStrong = AzureCosmosDBConsistencyLevelKey.String("Strong")
+ // bounded_staleness
+ // Stability: development
+ AzureCosmosDBConsistencyLevelBoundedStaleness = AzureCosmosDBConsistencyLevelKey.String("BoundedStaleness")
+ // session
+ // Stability: development
+ AzureCosmosDBConsistencyLevelSession = AzureCosmosDBConsistencyLevelKey.String("Session")
+ // eventual
+ // Stability: development
+ AzureCosmosDBConsistencyLevelEventual = AzureCosmosDBConsistencyLevelKey.String("Eventual")
+ // consistent_prefix
+ // Stability: development
+ AzureCosmosDBConsistencyLevelConsistentPrefix = AzureCosmosDBConsistencyLevelKey.String("ConsistentPrefix")
+)
+
+// Namespace: browser
+const (
+ // BrowserBrandsKey is the attribute Key conforming to the "browser.brands"
+ // semantic conventions. It represents the array of brand name and version
+ // separated by a space.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: " Not A;Brand 99", "Chromium 99", "Chrome 99"
+ // Note: This value is intended to be taken from the [UA client hints API] (
+ // `navigator.userAgentData.brands`).
+ //
+ // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface
+ BrowserBrandsKey = attribute.Key("browser.brands")
+
+ // BrowserLanguageKey is the attribute Key conforming to the "browser.language"
+ // semantic conventions. It represents the preferred language of the user using
+ // the browser.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "en", "en-US", "fr", "fr-FR"
+ // Note: This value is intended to be taken from the Navigator API
+ // `navigator.language`.
+ BrowserLanguageKey = attribute.Key("browser.language")
+
+ // BrowserMobileKey is the attribute Key conforming to the "browser.mobile"
+ // semantic conventions. It represents a boolean that is true if the browser is
+ // running on a mobile device.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: This value is intended to be taken from the [UA client hints API] (
+ // `navigator.userAgentData.mobile`). If unavailable, this attribute SHOULD be
+ // left unset.
+ //
+ // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface
+ BrowserMobileKey = attribute.Key("browser.mobile")
+
+ // BrowserPlatformKey is the attribute Key conforming to the "browser.platform"
+ // semantic conventions. It represents the platform on which the browser is
+ // running.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Windows", "macOS", "Android"
+ // Note: This value is intended to be taken from the [UA client hints API] (
+ // `navigator.userAgentData.platform`). If unavailable, the legacy
+ // `navigator.platform` API SHOULD NOT be used instead and this attribute SHOULD
+ // be left unset in order for the values to be consistent.
+ // The list of possible values is defined in the
+ // [W3C User-Agent Client Hints specification]. Note that some (but not all) of
+ // these values can overlap with values in the
+ // [`os.type` and `os.name` attributes]. However, for consistency, the values in
+ // the `browser.platform` attribute should capture the exact value that the user
+ // agent provides.
+ //
+ // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface
+ // [W3C User-Agent Client Hints specification]: https://wicg.github.io/ua-client-hints/#sec-ch-ua-platform
+ // [`os.type` and `os.name` attributes]: ./os.md
+ BrowserPlatformKey = attribute.Key("browser.platform")
+)
+
+// BrowserBrands returns an attribute KeyValue conforming to the "browser.brands"
+// semantic conventions. It represents the array of brand name and version
+// separated by a space.
+func BrowserBrands(val ...string) attribute.KeyValue {
+ return BrowserBrandsKey.StringSlice(val)
+}
+
+// BrowserLanguage returns an attribute KeyValue conforming to the
+// "browser.language" semantic conventions. It represents the preferred language
+// of the user using the browser.
+func BrowserLanguage(val string) attribute.KeyValue {
+ return BrowserLanguageKey.String(val)
+}
+
+// BrowserMobile returns an attribute KeyValue conforming to the "browser.mobile"
+// semantic conventions. It represents a boolean that is true if the browser is
+// running on a mobile device.
+func BrowserMobile(val bool) attribute.KeyValue {
+ return BrowserMobileKey.Bool(val)
+}
+
+// BrowserPlatform returns an attribute KeyValue conforming to the
+// "browser.platform" semantic conventions. It represents the platform on which
+// the browser is running.
+func BrowserPlatform(val string) attribute.KeyValue {
+ return BrowserPlatformKey.String(val)
+}
+
+// Namespace: cassandra
+const (
+ // CassandraConsistencyLevelKey is the attribute Key conforming to the
+ // "cassandra.consistency.level" semantic conventions. It represents the
+ // consistency level of the query. Based on consistency values from [CQL].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [CQL]: https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html
+ CassandraConsistencyLevelKey = attribute.Key("cassandra.consistency.level")
+
+ // CassandraCoordinatorDCKey is the attribute Key conforming to the
+ // "cassandra.coordinator.dc" semantic conventions. It represents the data
+ // center of the coordinating node for a query.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: us-west-2
+ CassandraCoordinatorDCKey = attribute.Key("cassandra.coordinator.dc")
+
+ // CassandraCoordinatorIDKey is the attribute Key conforming to the
+ // "cassandra.coordinator.id" semantic conventions. It represents the ID of the
+ // coordinating node for a query.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: be13faa2-8574-4d71-926d-27f16cf8a7af
+ CassandraCoordinatorIDKey = attribute.Key("cassandra.coordinator.id")
+
+ // CassandraPageSizeKey is the attribute Key conforming to the
+ // "cassandra.page.size" semantic conventions. It represents the fetch size used
+ // for paging, i.e. how many rows will be returned at once.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 5000
+ CassandraPageSizeKey = attribute.Key("cassandra.page.size")
+
+ // CassandraQueryIdempotentKey is the attribute Key conforming to the
+ // "cassandra.query.idempotent" semantic conventions. It represents the whether
+ // or not the query is idempotent.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ CassandraQueryIdempotentKey = attribute.Key("cassandra.query.idempotent")
+
+ // CassandraSpeculativeExecutionCountKey is the attribute Key conforming to the
+ // "cassandra.speculative_execution.count" semantic conventions. It represents
+ // the number of times a query was speculatively executed. Not set or `0` if the
+ // query was not executed speculatively.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0, 2
+ CassandraSpeculativeExecutionCountKey = attribute.Key("cassandra.speculative_execution.count")
+)
+
+// CassandraCoordinatorDC returns an attribute KeyValue conforming to the
+// "cassandra.coordinator.dc" semantic conventions. It represents the data center
+// of the coordinating node for a query.
+func CassandraCoordinatorDC(val string) attribute.KeyValue {
+ return CassandraCoordinatorDCKey.String(val)
+}
+
+// CassandraCoordinatorID returns an attribute KeyValue conforming to the
+// "cassandra.coordinator.id" semantic conventions. It represents the ID of the
+// coordinating node for a query.
+func CassandraCoordinatorID(val string) attribute.KeyValue {
+ return CassandraCoordinatorIDKey.String(val)
+}
+
+// CassandraPageSize returns an attribute KeyValue conforming to the
+// "cassandra.page.size" semantic conventions. It represents the fetch size used
+// for paging, i.e. how many rows will be returned at once.
+func CassandraPageSize(val int) attribute.KeyValue {
+ return CassandraPageSizeKey.Int(val)
+}
+
+// CassandraQueryIdempotent returns an attribute KeyValue conforming to the
+// "cassandra.query.idempotent" semantic conventions. It represents the whether
+// or not the query is idempotent.
+func CassandraQueryIdempotent(val bool) attribute.KeyValue {
+ return CassandraQueryIdempotentKey.Bool(val)
+}
+
+// CassandraSpeculativeExecutionCount returns an attribute KeyValue conforming to
+// the "cassandra.speculative_execution.count" semantic conventions. It
+// represents the number of times a query was speculatively executed. Not set or
+// `0` if the query was not executed speculatively.
+func CassandraSpeculativeExecutionCount(val int) attribute.KeyValue {
+ return CassandraSpeculativeExecutionCountKey.Int(val)
+}
+
+// Enum values for cassandra.consistency.level
+var (
+ // all
+ // Stability: development
+ CassandraConsistencyLevelAll = CassandraConsistencyLevelKey.String("all")
+ // each_quorum
+ // Stability: development
+ CassandraConsistencyLevelEachQuorum = CassandraConsistencyLevelKey.String("each_quorum")
+ // quorum
+ // Stability: development
+ CassandraConsistencyLevelQuorum = CassandraConsistencyLevelKey.String("quorum")
+ // local_quorum
+ // Stability: development
+ CassandraConsistencyLevelLocalQuorum = CassandraConsistencyLevelKey.String("local_quorum")
+ // one
+ // Stability: development
+ CassandraConsistencyLevelOne = CassandraConsistencyLevelKey.String("one")
+ // two
+ // Stability: development
+ CassandraConsistencyLevelTwo = CassandraConsistencyLevelKey.String("two")
+ // three
+ // Stability: development
+ CassandraConsistencyLevelThree = CassandraConsistencyLevelKey.String("three")
+ // local_one
+ // Stability: development
+ CassandraConsistencyLevelLocalOne = CassandraConsistencyLevelKey.String("local_one")
+ // any
+ // Stability: development
+ CassandraConsistencyLevelAny = CassandraConsistencyLevelKey.String("any")
+ // serial
+ // Stability: development
+ CassandraConsistencyLevelSerial = CassandraConsistencyLevelKey.String("serial")
+ // local_serial
+ // Stability: development
+ CassandraConsistencyLevelLocalSerial = CassandraConsistencyLevelKey.String("local_serial")
+)
+
+// Namespace: cicd
+const (
+ // CICDPipelineNameKey is the attribute Key conforming to the
+ // "cicd.pipeline.name" semantic conventions. It represents the human readable
+ // name of the pipeline within a CI/CD system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Build and Test", "Lint", "Deploy Go Project",
+ // "deploy_to_environment"
+ CICDPipelineNameKey = attribute.Key("cicd.pipeline.name")
+
+ // CICDPipelineResultKey is the attribute Key conforming to the
+ // "cicd.pipeline.result" semantic conventions. It represents the result of a
+ // pipeline run.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "success", "failure", "timeout", "skipped"
+ CICDPipelineResultKey = attribute.Key("cicd.pipeline.result")
+
+ // CICDPipelineRunIDKey is the attribute Key conforming to the
+ // "cicd.pipeline.run.id" semantic conventions. It represents the unique
+ // identifier of a pipeline run within a CI/CD system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "120912"
+ CICDPipelineRunIDKey = attribute.Key("cicd.pipeline.run.id")
+
+ // CICDPipelineRunStateKey is the attribute Key conforming to the
+ // "cicd.pipeline.run.state" semantic conventions. It represents the pipeline
+ // run goes through these states during its lifecycle.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pending", "executing", "finalizing"
+ CICDPipelineRunStateKey = attribute.Key("cicd.pipeline.run.state")
+
+ // CICDPipelineTaskNameKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.name" semantic conventions. It represents the human
+ // readable name of a task within a pipeline. Task here most closely aligns with
+ // a [computing process] in a pipeline. Other terms for tasks include commands,
+ // steps, and procedures.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Run GoLang Linter", "Go Build", "go-test", "deploy_binary"
+ //
+ // [computing process]: https://wikipedia.org/wiki/Pipeline_(computing)
+ CICDPipelineTaskNameKey = attribute.Key("cicd.pipeline.task.name")
+
+ // CICDPipelineTaskRunIDKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.run.id" semantic conventions. It represents the unique
+ // identifier of a task run within a pipeline.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "12097"
+ CICDPipelineTaskRunIDKey = attribute.Key("cicd.pipeline.task.run.id")
+
+ // CICDPipelineTaskRunURLFullKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.run.url.full" semantic conventions. It represents the
+ // [URL] of the pipeline run providing the complete address in order to locate
+ // and identify the pipeline run.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763/job/26920038674?pr=1075"
+ //
+ // [URL]: https://wikipedia.org/wiki/URL
+ CICDPipelineTaskRunURLFullKey = attribute.Key("cicd.pipeline.task.run.url.full")
+
+ // CICDPipelineTaskTypeKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.type" semantic conventions. It represents the type of the
+ // task within a pipeline.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "build", "test", "deploy"
+ CICDPipelineTaskTypeKey = attribute.Key("cicd.pipeline.task.type")
+
+ // CICDSystemComponentKey is the attribute Key conforming to the
+ // "cicd.system.component" semantic conventions. It represents the name of a
+ // component of the CICD system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "controller", "scheduler", "agent"
+ CICDSystemComponentKey = attribute.Key("cicd.system.component")
+
+ // CICDWorkerStateKey is the attribute Key conforming to the "cicd.worker.state"
+ // semantic conventions. It represents the state of a CICD worker / agent.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "idle", "busy", "down"
+ CICDWorkerStateKey = attribute.Key("cicd.worker.state")
+)
+
+// CICDPipelineName returns an attribute KeyValue conforming to the
+// "cicd.pipeline.name" semantic conventions. It represents the human readable
+// name of the pipeline within a CI/CD system.
+func CICDPipelineName(val string) attribute.KeyValue {
+ return CICDPipelineNameKey.String(val)
+}
+
+// CICDPipelineRunID returns an attribute KeyValue conforming to the
+// "cicd.pipeline.run.id" semantic conventions. It represents the unique
+// identifier of a pipeline run within a CI/CD system.
+func CICDPipelineRunID(val string) attribute.KeyValue {
+ return CICDPipelineRunIDKey.String(val)
+}
+
+// CICDPipelineTaskName returns an attribute KeyValue conforming to the
+// "cicd.pipeline.task.name" semantic conventions. It represents the human
+// readable name of a task within a pipeline. Task here most closely aligns with
+// a [computing process] in a pipeline. Other terms for tasks include commands,
+// steps, and procedures.
+//
+// [computing process]: https://wikipedia.org/wiki/Pipeline_(computing)
+func CICDPipelineTaskName(val string) attribute.KeyValue {
+ return CICDPipelineTaskNameKey.String(val)
+}
+
+// CICDPipelineTaskRunID returns an attribute KeyValue conforming to the
+// "cicd.pipeline.task.run.id" semantic conventions. It represents the unique
+// identifier of a task run within a pipeline.
+func CICDPipelineTaskRunID(val string) attribute.KeyValue {
+ return CICDPipelineTaskRunIDKey.String(val)
+}
+
+// CICDPipelineTaskRunURLFull returns an attribute KeyValue conforming to the
+// "cicd.pipeline.task.run.url.full" semantic conventions. It represents the
+// [URL] of the pipeline run providing the complete address in order to locate
+// and identify the pipeline run.
+//
+// [URL]: https://wikipedia.org/wiki/URL
+func CICDPipelineTaskRunURLFull(val string) attribute.KeyValue {
+ return CICDPipelineTaskRunURLFullKey.String(val)
+}
+
+// CICDSystemComponent returns an attribute KeyValue conforming to the
+// "cicd.system.component" semantic conventions. It represents the name of a
+// component of the CICD system.
+func CICDSystemComponent(val string) attribute.KeyValue {
+ return CICDSystemComponentKey.String(val)
+}
+
+// Enum values for cicd.pipeline.result
+var (
+ // The pipeline run finished successfully.
+ // Stability: development
+ CICDPipelineResultSuccess = CICDPipelineResultKey.String("success")
+ // The pipeline run did not finish successfully, eg. due to a compile error or a
+ // failing test. Such failures are usually detected by non-zero exit codes of
+ // the tools executed in the pipeline run.
+ // Stability: development
+ CICDPipelineResultFailure = CICDPipelineResultKey.String("failure")
+ // The pipeline run failed due to an error in the CICD system, eg. due to the
+ // worker being killed.
+ // Stability: development
+ CICDPipelineResultError = CICDPipelineResultKey.String("error")
+ // A timeout caused the pipeline run to be interrupted.
+ // Stability: development
+ CICDPipelineResultTimeout = CICDPipelineResultKey.String("timeout")
+ // The pipeline run was cancelled, eg. by a user manually cancelling the
+ // pipeline run.
+ // Stability: development
+ CICDPipelineResultCancellation = CICDPipelineResultKey.String("cancellation")
+ // The pipeline run was skipped, eg. due to a precondition not being met.
+ // Stability: development
+ CICDPipelineResultSkip = CICDPipelineResultKey.String("skip")
+)
+
+// Enum values for cicd.pipeline.run.state
+var (
+ // The run pending state spans from the event triggering the pipeline run until
+ // the execution of the run starts (eg. time spent in a queue, provisioning
+ // agents, creating run resources).
+ //
+ // Stability: development
+ CICDPipelineRunStatePending = CICDPipelineRunStateKey.String("pending")
+ // The executing state spans the execution of any run tasks (eg. build, test).
+ // Stability: development
+ CICDPipelineRunStateExecuting = CICDPipelineRunStateKey.String("executing")
+ // The finalizing state spans from when the run has finished executing (eg.
+ // cleanup of run resources).
+ // Stability: development
+ CICDPipelineRunStateFinalizing = CICDPipelineRunStateKey.String("finalizing")
+)
+
+// Enum values for cicd.pipeline.task.type
+var (
+ // build
+ // Stability: development
+ CICDPipelineTaskTypeBuild = CICDPipelineTaskTypeKey.String("build")
+ // test
+ // Stability: development
+ CICDPipelineTaskTypeTest = CICDPipelineTaskTypeKey.String("test")
+ // deploy
+ // Stability: development
+ CICDPipelineTaskTypeDeploy = CICDPipelineTaskTypeKey.String("deploy")
+)
+
+// Enum values for cicd.worker.state
+var (
+ // The worker is not performing work for the CICD system. It is available to the
+ // CICD system to perform work on (online / idle).
+ // Stability: development
+ CICDWorkerStateAvailable = CICDWorkerStateKey.String("available")
+ // The worker is performing work for the CICD system.
+ // Stability: development
+ CICDWorkerStateBusy = CICDWorkerStateKey.String("busy")
+ // The worker is not available to the CICD system (disconnected / down).
+ // Stability: development
+ CICDWorkerStateOffline = CICDWorkerStateKey.String("offline")
+)
+
+// Namespace: client
+const (
+ // ClientAddressKey is the attribute Key conforming to the "client.address"
+ // semantic conventions. It represents the client address - domain name if
+ // available without reverse DNS lookup; otherwise, IP address or Unix domain
+ // socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "client.example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the server side, and when communicating through an
+ // intermediary, `client.address` SHOULD represent the client address behind any
+ // intermediaries, for example proxies, if it's available.
+ ClientAddressKey = attribute.Key("client.address")
+
+ // ClientPortKey is the attribute Key conforming to the "client.port" semantic
+ // conventions. It represents the client port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 65123
+ // Note: When observed from the server side, and when communicating through an
+ // intermediary, `client.port` SHOULD represent the client port behind any
+ // intermediaries, for example proxies, if it's available.
+ ClientPortKey = attribute.Key("client.port")
+)
+
+// ClientAddress returns an attribute KeyValue conforming to the "client.address"
+// semantic conventions. It represents the client address - domain name if
+// available without reverse DNS lookup; otherwise, IP address or Unix domain
+// socket name.
+func ClientAddress(val string) attribute.KeyValue {
+ return ClientAddressKey.String(val)
+}
+
+// ClientPort returns an attribute KeyValue conforming to the "client.port"
+// semantic conventions. It represents the client port number.
+func ClientPort(val int) attribute.KeyValue {
+ return ClientPortKey.Int(val)
+}
+
+// Namespace: cloud
+const (
+ // CloudAccountIDKey is the attribute Key conforming to the "cloud.account.id"
+ // semantic conventions. It represents the cloud account ID the resource is
+ // assigned to.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "111111111111", "opentelemetry"
+ CloudAccountIDKey = attribute.Key("cloud.account.id")
+
+ // CloudAvailabilityZoneKey is the attribute Key conforming to the
+ // "cloud.availability_zone" semantic conventions. It represents the cloud
+ // regions often have multiple, isolated locations known as zones to increase
+ // availability. Availability zone represents the zone where the resource is
+ // running.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "us-east-1c"
+ // Note: Availability zones are called "zones" on Alibaba Cloud and Google
+ // Cloud.
+ CloudAvailabilityZoneKey = attribute.Key("cloud.availability_zone")
+
+ // CloudPlatformKey is the attribute Key conforming to the "cloud.platform"
+ // semantic conventions. It represents the cloud platform in use.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: The prefix of the service SHOULD match the one specified in
+ // `cloud.provider`.
+ CloudPlatformKey = attribute.Key("cloud.platform")
+
+ // CloudProviderKey is the attribute Key conforming to the "cloud.provider"
+ // semantic conventions. It represents the name of the cloud provider.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ CloudProviderKey = attribute.Key("cloud.provider")
+
+ // CloudRegionKey is the attribute Key conforming to the "cloud.region" semantic
+ // conventions. It represents the geographical region the resource is running.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "us-central1", "us-east-1"
+ // Note: Refer to your provider's docs to see the available regions, for example
+ // [Alibaba Cloud regions], [AWS regions], [Azure regions],
+ // [Google Cloud regions], or [Tencent Cloud regions].
+ //
+ // [Alibaba Cloud regions]: https://www.alibabacloud.com/help/doc-detail/40654.htm
+ // [AWS regions]: https://aws.amazon.com/about-aws/global-infrastructure/regions_az/
+ // [Azure regions]: https://azure.microsoft.com/global-infrastructure/geographies/
+ // [Google Cloud regions]: https://cloud.google.com/about/locations
+ // [Tencent Cloud regions]: https://www.tencentcloud.com/document/product/213/6091
+ CloudRegionKey = attribute.Key("cloud.region")
+
+ // CloudResourceIDKey is the attribute Key conforming to the "cloud.resource_id"
+ // semantic conventions. It represents the cloud provider-specific native
+ // identifier of the monitored cloud resource (e.g. an [ARN] on AWS, a
+ // [fully qualified resource ID] on Azure, a [full resource name] on GCP).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:lambda:REGION:ACCOUNT_ID:function:my-function",
+ // "//run.googleapis.com/projects/PROJECT_ID/locations/LOCATION_ID/services/SERVICE_ID",
+ // "/subscriptions//resourceGroups/
+ // /providers/Microsoft.Web/sites//functions/"
+ // Note: On some cloud providers, it may not be possible to determine the full
+ // ID at startup,
+ // so it may be necessary to set `cloud.resource_id` as a span attribute
+ // instead.
+ //
+ // The exact value to use for `cloud.resource_id` depends on the cloud provider.
+ // The following well-known definitions MUST be used if you set this attribute
+ // and they apply:
+ //
+ // - **AWS Lambda:** The function [ARN].
+ // Take care not to use the "invoked ARN" directly but replace any
+ // [alias suffix]
+ // with the resolved function version, as the same runtime instance may be
+ // invocable with
+ // multiple different aliases.
+ // - **GCP:** The [URI of the resource]
+ // - **Azure:** The [Fully Qualified Resource ID] of the invoked function,
+ // *not* the function app, having the form
+ //
+ // `/subscriptions//resourceGroups//providers/Microsoft.Web/sites//functions/`
+ // .
+ // This means that a span attribute MUST be used, as an Azure function app
+ // can host multiple functions that would usually share
+ // a TracerProvider.
+ //
+ //
+ // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html
+ // [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id
+ // [full resource name]: https://cloud.google.com/apis/design/resource_names#full_resource_name
+ // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html
+ // [alias suffix]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-aliases.html
+ // [URI of the resource]: https://cloud.google.com/iam/docs/full-resource-names
+ // [Fully Qualified Resource ID]: https://docs.microsoft.com/rest/api/resources/resources/get-by-id
+ CloudResourceIDKey = attribute.Key("cloud.resource_id")
+)
+
+// CloudAccountID returns an attribute KeyValue conforming to the
+// "cloud.account.id" semantic conventions. It represents the cloud account ID
+// the resource is assigned to.
+func CloudAccountID(val string) attribute.KeyValue {
+ return CloudAccountIDKey.String(val)
+}
+
+// CloudAvailabilityZone returns an attribute KeyValue conforming to the
+// "cloud.availability_zone" semantic conventions. It represents the cloud
+// regions often have multiple, isolated locations known as zones to increase
+// availability. Availability zone represents the zone where the resource is
+// running.
+func CloudAvailabilityZone(val string) attribute.KeyValue {
+ return CloudAvailabilityZoneKey.String(val)
+}
+
+// CloudRegion returns an attribute KeyValue conforming to the "cloud.region"
+// semantic conventions. It represents the geographical region the resource is
+// running.
+func CloudRegion(val string) attribute.KeyValue {
+ return CloudRegionKey.String(val)
+}
+
+// CloudResourceID returns an attribute KeyValue conforming to the
+// "cloud.resource_id" semantic conventions. It represents the cloud
+// provider-specific native identifier of the monitored cloud resource (e.g. an
+// [ARN] on AWS, a [fully qualified resource ID] on Azure, a [full resource name]
+// on GCP).
+//
+// [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html
+// [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id
+// [full resource name]: https://cloud.google.com/apis/design/resource_names#full_resource_name
+func CloudResourceID(val string) attribute.KeyValue {
+ return CloudResourceIDKey.String(val)
+}
+
+// Enum values for cloud.platform
+var (
+ // Alibaba Cloud Elastic Compute Service
+ // Stability: development
+ CloudPlatformAlibabaCloudECS = CloudPlatformKey.String("alibaba_cloud_ecs")
+ // Alibaba Cloud Function Compute
+ // Stability: development
+ CloudPlatformAlibabaCloudFc = CloudPlatformKey.String("alibaba_cloud_fc")
+ // Red Hat OpenShift on Alibaba Cloud
+ // Stability: development
+ CloudPlatformAlibabaCloudOpenshift = CloudPlatformKey.String("alibaba_cloud_openshift")
+ // AWS Elastic Compute Cloud
+ // Stability: development
+ CloudPlatformAWSEC2 = CloudPlatformKey.String("aws_ec2")
+ // AWS Elastic Container Service
+ // Stability: development
+ CloudPlatformAWSECS = CloudPlatformKey.String("aws_ecs")
+ // AWS Elastic Kubernetes Service
+ // Stability: development
+ CloudPlatformAWSEKS = CloudPlatformKey.String("aws_eks")
+ // AWS Lambda
+ // Stability: development
+ CloudPlatformAWSLambda = CloudPlatformKey.String("aws_lambda")
+ // AWS Elastic Beanstalk
+ // Stability: development
+ CloudPlatformAWSElasticBeanstalk = CloudPlatformKey.String("aws_elastic_beanstalk")
+ // AWS App Runner
+ // Stability: development
+ CloudPlatformAWSAppRunner = CloudPlatformKey.String("aws_app_runner")
+ // Red Hat OpenShift on AWS (ROSA)
+ // Stability: development
+ CloudPlatformAWSOpenshift = CloudPlatformKey.String("aws_openshift")
+ // Azure Virtual Machines
+ // Stability: development
+ CloudPlatformAzureVM = CloudPlatformKey.String("azure_vm")
+ // Azure Container Apps
+ // Stability: development
+ CloudPlatformAzureContainerApps = CloudPlatformKey.String("azure_container_apps")
+ // Azure Container Instances
+ // Stability: development
+ CloudPlatformAzureContainerInstances = CloudPlatformKey.String("azure_container_instances")
+ // Azure Kubernetes Service
+ // Stability: development
+ CloudPlatformAzureAKS = CloudPlatformKey.String("azure_aks")
+ // Azure Functions
+ // Stability: development
+ CloudPlatformAzureFunctions = CloudPlatformKey.String("azure_functions")
+ // Azure App Service
+ // Stability: development
+ CloudPlatformAzureAppService = CloudPlatformKey.String("azure_app_service")
+ // Azure Red Hat OpenShift
+ // Stability: development
+ CloudPlatformAzureOpenshift = CloudPlatformKey.String("azure_openshift")
+ // Google Bare Metal Solution (BMS)
+ // Stability: development
+ CloudPlatformGCPBareMetalSolution = CloudPlatformKey.String("gcp_bare_metal_solution")
+ // Google Cloud Compute Engine (GCE)
+ // Stability: development
+ CloudPlatformGCPComputeEngine = CloudPlatformKey.String("gcp_compute_engine")
+ // Google Cloud Run
+ // Stability: development
+ CloudPlatformGCPCloudRun = CloudPlatformKey.String("gcp_cloud_run")
+ // Google Cloud Kubernetes Engine (GKE)
+ // Stability: development
+ CloudPlatformGCPKubernetesEngine = CloudPlatformKey.String("gcp_kubernetes_engine")
+ // Google Cloud Functions (GCF)
+ // Stability: development
+ CloudPlatformGCPCloudFunctions = CloudPlatformKey.String("gcp_cloud_functions")
+ // Google Cloud App Engine (GAE)
+ // Stability: development
+ CloudPlatformGCPAppEngine = CloudPlatformKey.String("gcp_app_engine")
+ // Red Hat OpenShift on Google Cloud
+ // Stability: development
+ CloudPlatformGCPOpenshift = CloudPlatformKey.String("gcp_openshift")
+ // Red Hat OpenShift on IBM Cloud
+ // Stability: development
+ CloudPlatformIbmCloudOpenshift = CloudPlatformKey.String("ibm_cloud_openshift")
+ // Compute on Oracle Cloud Infrastructure (OCI)
+ // Stability: development
+ CloudPlatformOracleCloudCompute = CloudPlatformKey.String("oracle_cloud_compute")
+ // Kubernetes Engine (OKE) on Oracle Cloud Infrastructure (OCI)
+ // Stability: development
+ CloudPlatformOracleCloudOke = CloudPlatformKey.String("oracle_cloud_oke")
+ // Tencent Cloud Cloud Virtual Machine (CVM)
+ // Stability: development
+ CloudPlatformTencentCloudCvm = CloudPlatformKey.String("tencent_cloud_cvm")
+ // Tencent Cloud Elastic Kubernetes Service (EKS)
+ // Stability: development
+ CloudPlatformTencentCloudEKS = CloudPlatformKey.String("tencent_cloud_eks")
+ // Tencent Cloud Serverless Cloud Function (SCF)
+ // Stability: development
+ CloudPlatformTencentCloudScf = CloudPlatformKey.String("tencent_cloud_scf")
+)
+
+// Enum values for cloud.provider
+var (
+ // Alibaba Cloud
+ // Stability: development
+ CloudProviderAlibabaCloud = CloudProviderKey.String("alibaba_cloud")
+ // Amazon Web Services
+ // Stability: development
+ CloudProviderAWS = CloudProviderKey.String("aws")
+ // Microsoft Azure
+ // Stability: development
+ CloudProviderAzure = CloudProviderKey.String("azure")
+ // Google Cloud Platform
+ // Stability: development
+ CloudProviderGCP = CloudProviderKey.String("gcp")
+ // Heroku Platform as a Service
+ // Stability: development
+ CloudProviderHeroku = CloudProviderKey.String("heroku")
+ // IBM Cloud
+ // Stability: development
+ CloudProviderIbmCloud = CloudProviderKey.String("ibm_cloud")
+ // Oracle Cloud Infrastructure (OCI)
+ // Stability: development
+ CloudProviderOracleCloud = CloudProviderKey.String("oracle_cloud")
+ // Tencent Cloud
+ // Stability: development
+ CloudProviderTencentCloud = CloudProviderKey.String("tencent_cloud")
+)
+
+// Namespace: cloudevents
+const (
+ // CloudeventsEventIDKey is the attribute Key conforming to the
+ // "cloudevents.event_id" semantic conventions. It represents the [event_id]
+ // uniquely identifies the event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "123e4567-e89b-12d3-a456-426614174000", "0001"
+ //
+ // [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id
+ CloudeventsEventIDKey = attribute.Key("cloudevents.event_id")
+
+ // CloudeventsEventSourceKey is the attribute Key conforming to the
+ // "cloudevents.event_source" semantic conventions. It represents the [source]
+ // identifies the context in which an event happened.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://github.com/cloudevents", "/cloudevents/spec/pull/123",
+ // "my-service"
+ //
+ // [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1
+ CloudeventsEventSourceKey = attribute.Key("cloudevents.event_source")
+
+ // CloudeventsEventSpecVersionKey is the attribute Key conforming to the
+ // "cloudevents.event_spec_version" semantic conventions. It represents the
+ // [version of the CloudEvents specification] which the event uses.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0
+ //
+ // [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion
+ CloudeventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version")
+
+ // CloudeventsEventSubjectKey is the attribute Key conforming to the
+ // "cloudevents.event_subject" semantic conventions. It represents the [subject]
+ // of the event in the context of the event producer (identified by source).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: mynewfile.jpg
+ //
+ // [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject
+ CloudeventsEventSubjectKey = attribute.Key("cloudevents.event_subject")
+
+ // CloudeventsEventTypeKey is the attribute Key conforming to the
+ // "cloudevents.event_type" semantic conventions. It represents the [event_type]
+ // contains a value describing the type of event related to the originating
+ // occurrence.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "com.github.pull_request.opened", "com.example.object.deleted.v2"
+ //
+ // [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type
+ CloudeventsEventTypeKey = attribute.Key("cloudevents.event_type")
+)
+
+// CloudeventsEventID returns an attribute KeyValue conforming to the
+// "cloudevents.event_id" semantic conventions. It represents the [event_id]
+// uniquely identifies the event.
+//
+// [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id
+func CloudeventsEventID(val string) attribute.KeyValue {
+ return CloudeventsEventIDKey.String(val)
+}
+
+// CloudeventsEventSource returns an attribute KeyValue conforming to the
+// "cloudevents.event_source" semantic conventions. It represents the [source]
+// identifies the context in which an event happened.
+//
+// [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1
+func CloudeventsEventSource(val string) attribute.KeyValue {
+ return CloudeventsEventSourceKey.String(val)
+}
+
+// CloudeventsEventSpecVersion returns an attribute KeyValue conforming to the
+// "cloudevents.event_spec_version" semantic conventions. It represents the
+// [version of the CloudEvents specification] which the event uses.
+//
+// [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion
+func CloudeventsEventSpecVersion(val string) attribute.KeyValue {
+ return CloudeventsEventSpecVersionKey.String(val)
+}
+
+// CloudeventsEventSubject returns an attribute KeyValue conforming to the
+// "cloudevents.event_subject" semantic conventions. It represents the [subject]
+// of the event in the context of the event producer (identified by source).
+//
+// [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject
+func CloudeventsEventSubject(val string) attribute.KeyValue {
+ return CloudeventsEventSubjectKey.String(val)
+}
+
+// CloudeventsEventType returns an attribute KeyValue conforming to the
+// "cloudevents.event_type" semantic conventions. It represents the [event_type]
+// contains a value describing the type of event related to the originating
+// occurrence.
+//
+// [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type
+func CloudeventsEventType(val string) attribute.KeyValue {
+ return CloudeventsEventTypeKey.String(val)
+}
+
+// Namespace: cloudfoundry
+const (
+ // CloudfoundryAppIDKey is the attribute Key conforming to the
+ // "cloudfoundry.app.id" semantic conventions. It represents the guid of the
+ // application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.application_id`. This is the same value as
+ // reported by `cf app --guid`.
+ CloudfoundryAppIDKey = attribute.Key("cloudfoundry.app.id")
+
+ // CloudfoundryAppInstanceIDKey is the attribute Key conforming to the
+ // "cloudfoundry.app.instance.id" semantic conventions. It represents the index
+ // of the application instance. 0 when just one instance is active.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0", "1"
+ // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope]
+ // .
+ // It is used for logs and metrics emitted by CloudFoundry. It is
+ // supposed to contain the application instance index for applications
+ // deployed on the runtime.
+ //
+ // Application instrumentation should use the value from environment
+ // variable `CF_INSTANCE_INDEX`.
+ //
+ // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope
+ CloudfoundryAppInstanceIDKey = attribute.Key("cloudfoundry.app.instance.id")
+
+ // CloudfoundryAppNameKey is the attribute Key conforming to the
+ // "cloudfoundry.app.name" semantic conventions. It represents the name of the
+ // application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-app-name"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.application_name`. This is the same value
+ // as reported by `cf apps`.
+ CloudfoundryAppNameKey = attribute.Key("cloudfoundry.app.name")
+
+ // CloudfoundryOrgIDKey is the attribute Key conforming to the
+ // "cloudfoundry.org.id" semantic conventions. It represents the guid of the
+ // CloudFoundry org the application is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.org_id`. This is the same value as
+ // reported by `cf org --guid`.
+ CloudfoundryOrgIDKey = attribute.Key("cloudfoundry.org.id")
+
+ // CloudfoundryOrgNameKey is the attribute Key conforming to the
+ // "cloudfoundry.org.name" semantic conventions. It represents the name of the
+ // CloudFoundry organization the app is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-org-name"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.org_name`. This is the same value as
+ // reported by `cf orgs`.
+ CloudfoundryOrgNameKey = attribute.Key("cloudfoundry.org.name")
+
+ // CloudfoundryProcessIDKey is the attribute Key conforming to the
+ // "cloudfoundry.process.id" semantic conventions. It represents the UID
+ // identifying the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.process_id`. It is supposed to be equal to
+ // `VCAP_APPLICATION.app_id` for applications deployed to the runtime.
+ // For system components, this could be the actual PID.
+ CloudfoundryProcessIDKey = attribute.Key("cloudfoundry.process.id")
+
+ // CloudfoundryProcessTypeKey is the attribute Key conforming to the
+ // "cloudfoundry.process.type" semantic conventions. It represents the type of
+ // process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "web"
+ // Note: CloudFoundry applications can consist of multiple jobs. Usually the
+ // main process will be of type `web`. There can be additional background
+ // tasks or side-cars with different process types.
+ CloudfoundryProcessTypeKey = attribute.Key("cloudfoundry.process.type")
+
+ // CloudfoundrySpaceIDKey is the attribute Key conforming to the
+ // "cloudfoundry.space.id" semantic conventions. It represents the guid of the
+ // CloudFoundry space the application is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.space_id`. This is the same value as
+ // reported by `cf space --guid`.
+ CloudfoundrySpaceIDKey = attribute.Key("cloudfoundry.space.id")
+
+ // CloudfoundrySpaceNameKey is the attribute Key conforming to the
+ // "cloudfoundry.space.name" semantic conventions. It represents the name of the
+ // CloudFoundry space the application is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-space-name"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.space_name`. This is the same value as
+ // reported by `cf spaces`.
+ CloudfoundrySpaceNameKey = attribute.Key("cloudfoundry.space.name")
+
+ // CloudfoundrySystemIDKey is the attribute Key conforming to the
+ // "cloudfoundry.system.id" semantic conventions. It represents a guid or
+ // another name describing the event source.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cf/gorouter"
+ // Note: CloudFoundry defines the `source_id` in the [Loggregator v2 envelope].
+ // It is used for logs and metrics emitted by CloudFoundry. It is
+ // supposed to contain the component name, e.g. "gorouter", for
+ // CloudFoundry components.
+ //
+ // When system components are instrumented, values from the
+ // [Bosh spec]
+ // should be used. The `system.id` should be set to
+ // `spec.deployment/spec.name`.
+ //
+ // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope
+ // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec
+ CloudfoundrySystemIDKey = attribute.Key("cloudfoundry.system.id")
+
+ // CloudfoundrySystemInstanceIDKey is the attribute Key conforming to the
+ // "cloudfoundry.system.instance.id" semantic conventions. It represents a guid
+ // describing the concrete instance of the event source.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope]
+ // .
+ // It is used for logs and metrics emitted by CloudFoundry. It is
+ // supposed to contain the vm id for CloudFoundry components.
+ //
+ // When system components are instrumented, values from the
+ // [Bosh spec]
+ // should be used. The `system.instance.id` should be set to `spec.id`.
+ //
+ // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope
+ // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec
+ CloudfoundrySystemInstanceIDKey = attribute.Key("cloudfoundry.system.instance.id")
+)
+
+// CloudfoundryAppID returns an attribute KeyValue conforming to the
+// "cloudfoundry.app.id" semantic conventions. It represents the guid of the
+// application.
+func CloudfoundryAppID(val string) attribute.KeyValue {
+ return CloudfoundryAppIDKey.String(val)
+}
+
+// CloudfoundryAppInstanceID returns an attribute KeyValue conforming to the
+// "cloudfoundry.app.instance.id" semantic conventions. It represents the index
+// of the application instance. 0 when just one instance is active.
+func CloudfoundryAppInstanceID(val string) attribute.KeyValue {
+ return CloudfoundryAppInstanceIDKey.String(val)
+}
+
+// CloudfoundryAppName returns an attribute KeyValue conforming to the
+// "cloudfoundry.app.name" semantic conventions. It represents the name of the
+// application.
+func CloudfoundryAppName(val string) attribute.KeyValue {
+ return CloudfoundryAppNameKey.String(val)
+}
+
+// CloudfoundryOrgID returns an attribute KeyValue conforming to the
+// "cloudfoundry.org.id" semantic conventions. It represents the guid of the
+// CloudFoundry org the application is running in.
+func CloudfoundryOrgID(val string) attribute.KeyValue {
+ return CloudfoundryOrgIDKey.String(val)
+}
+
+// CloudfoundryOrgName returns an attribute KeyValue conforming to the
+// "cloudfoundry.org.name" semantic conventions. It represents the name of the
+// CloudFoundry organization the app is running in.
+func CloudfoundryOrgName(val string) attribute.KeyValue {
+ return CloudfoundryOrgNameKey.String(val)
+}
+
+// CloudfoundryProcessID returns an attribute KeyValue conforming to the
+// "cloudfoundry.process.id" semantic conventions. It represents the UID
+// identifying the process.
+func CloudfoundryProcessID(val string) attribute.KeyValue {
+ return CloudfoundryProcessIDKey.String(val)
+}
+
+// CloudfoundryProcessType returns an attribute KeyValue conforming to the
+// "cloudfoundry.process.type" semantic conventions. It represents the type of
+// process.
+func CloudfoundryProcessType(val string) attribute.KeyValue {
+ return CloudfoundryProcessTypeKey.String(val)
+}
+
+// CloudfoundrySpaceID returns an attribute KeyValue conforming to the
+// "cloudfoundry.space.id" semantic conventions. It represents the guid of the
+// CloudFoundry space the application is running in.
+func CloudfoundrySpaceID(val string) attribute.KeyValue {
+ return CloudfoundrySpaceIDKey.String(val)
+}
+
+// CloudfoundrySpaceName returns an attribute KeyValue conforming to the
+// "cloudfoundry.space.name" semantic conventions. It represents the name of the
+// CloudFoundry space the application is running in.
+func CloudfoundrySpaceName(val string) attribute.KeyValue {
+ return CloudfoundrySpaceNameKey.String(val)
+}
+
+// CloudfoundrySystemID returns an attribute KeyValue conforming to the
+// "cloudfoundry.system.id" semantic conventions. It represents a guid or another
+// name describing the event source.
+func CloudfoundrySystemID(val string) attribute.KeyValue {
+ return CloudfoundrySystemIDKey.String(val)
+}
+
+// CloudfoundrySystemInstanceID returns an attribute KeyValue conforming to the
+// "cloudfoundry.system.instance.id" semantic conventions. It represents a guid
+// describing the concrete instance of the event source.
+func CloudfoundrySystemInstanceID(val string) attribute.KeyValue {
+ return CloudfoundrySystemInstanceIDKey.String(val)
+}
+
+// Namespace: code
+const (
+ // CodeColumnNumberKey is the attribute Key conforming to the
+ // "code.column.number" semantic conventions. It represents the column number in
+ // `code.file.path` best representing the operation. It SHOULD point within the
+ // code unit named in `code.function.name`.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ CodeColumnNumberKey = attribute.Key("code.column.number")
+
+ // CodeFilePathKey is the attribute Key conforming to the "code.file.path"
+ // semantic conventions. It represents the source code file name that identifies
+ // the code unit as uniquely as possible (preferably an absolute file path).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: /usr/local/MyApplication/content_root/app/index.php
+ CodeFilePathKey = attribute.Key("code.file.path")
+
+ // CodeFilepathKey is the attribute Key conforming to the "code.filepath"
+ // semantic conventions. It represents the deprecated, use `code.file.path`
+ // instead.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: /usr/local/MyApplication/content_root/app/index.php
+ CodeFilepathKey = attribute.Key("code.filepath")
+
+ // CodeFunctionNameKey is the attribute Key conforming to the
+ // "code.function.name" semantic conventions. It represents the method or
+ // function name, or equivalent (usually rightmost part of the code unit's
+ // name).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: serveRequest
+ CodeFunctionNameKey = attribute.Key("code.function.name")
+
+ // CodeLineNumberKey is the attribute Key conforming to the "code.line.number"
+ // semantic conventions. It represents the line number in `code.file.path` best
+ // representing the operation. It SHOULD point within the code unit named in
+ // `code.function.name`.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ CodeLineNumberKey = attribute.Key("code.line.number")
+
+ // CodeNamespaceKey is the attribute Key conforming to the "code.namespace"
+ // semantic conventions. It represents the "namespace" within which
+ // `code.function.name` is defined. Usually the qualified class or module name,
+ // such that `code.namespace` + some separator + `code.function.name` form a
+ // unique identifier for the code unit.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: com.example.MyHttpService
+ CodeNamespaceKey = attribute.Key("code.namespace")
+
+ // CodeStacktraceKey is the attribute Key conforming to the "code.stacktrace"
+ // semantic conventions. It represents a stacktrace as a string in the natural
+ // representation for the language runtime. The representation is to be
+ // determined and documented by each language SIG.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at
+ // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at
+ // com.example.GenerateTrace.main(GenerateTrace.java:5)
+ CodeStacktraceKey = attribute.Key("code.stacktrace")
+)
+
+// CodeColumnNumber returns an attribute KeyValue conforming to the
+// "code.column.number" semantic conventions. It represents the column number in
+// `code.file.path` best representing the operation. It SHOULD point within the
+// code unit named in `code.function.name`.
+func CodeColumnNumber(val int) attribute.KeyValue {
+ return CodeColumnNumberKey.Int(val)
+}
+
+// CodeFilePath returns an attribute KeyValue conforming to the "code.file.path"
+// semantic conventions. It represents the source code file name that identifies
+// the code unit as uniquely as possible (preferably an absolute file path).
+func CodeFilePath(val string) attribute.KeyValue {
+ return CodeFilePathKey.String(val)
+}
+
+// CodeFilepath returns an attribute KeyValue conforming to the "code.filepath"
+// semantic conventions. It represents the deprecated, use `code.file.path`
+// instead.
+func CodeFilepath(val string) attribute.KeyValue {
+ return CodeFilepathKey.String(val)
+}
+
+// CodeFunctionName returns an attribute KeyValue conforming to the
+// "code.function.name" semantic conventions. It represents the method or
+// function name, or equivalent (usually rightmost part of the code unit's name).
+func CodeFunctionName(val string) attribute.KeyValue {
+ return CodeFunctionNameKey.String(val)
+}
+
+// CodeLineNumber returns an attribute KeyValue conforming to the
+// "code.line.number" semantic conventions. It represents the line number in
+// `code.file.path` best representing the operation. It SHOULD point within the
+// code unit named in `code.function.name`.
+func CodeLineNumber(val int) attribute.KeyValue {
+ return CodeLineNumberKey.Int(val)
+}
+
+// CodeNamespace returns an attribute KeyValue conforming to the "code.namespace"
+// semantic conventions. It represents the "namespace" within which
+// `code.function.name` is defined. Usually the qualified class or module name,
+// such that `code.namespace` + some separator + `code.function.name` form a
+// unique identifier for the code unit.
+func CodeNamespace(val string) attribute.KeyValue {
+ return CodeNamespaceKey.String(val)
+}
+
+// CodeStacktrace returns an attribute KeyValue conforming to the
+// "code.stacktrace" semantic conventions. It represents a stacktrace as a string
+// in the natural representation for the language runtime. The representation is
+// to be determined and documented by each language SIG.
+func CodeStacktrace(val string) attribute.KeyValue {
+ return CodeStacktraceKey.String(val)
+}
+
+// Namespace: container
+const (
+ // ContainerCommandKey is the attribute Key conforming to the
+ // "container.command" semantic conventions. It represents the command used to
+ // run the container (i.e. the command name).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcontribcol"
+ // Note: If using embedded credentials or sensitive data, it is recommended to
+ // remove them to prevent potential leakage.
+ ContainerCommandKey = attribute.Key("container.command")
+
+ // ContainerCommandArgsKey is the attribute Key conforming to the
+ // "container.command_args" semantic conventions. It represents the all the
+ // command arguments (including the command/executable itself) run by the
+ // container.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcontribcol", "--config", "config.yaml"
+ ContainerCommandArgsKey = attribute.Key("container.command_args")
+
+ // ContainerCommandLineKey is the attribute Key conforming to the
+ // "container.command_line" semantic conventions. It represents the full command
+ // run by the container as a single string representing the full command.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcontribcol --config config.yaml"
+ ContainerCommandLineKey = attribute.Key("container.command_line")
+
+ // ContainerCsiPluginNameKey is the attribute Key conforming to the
+ // "container.csi.plugin.name" semantic conventions. It represents the name of
+ // the CSI ([Container Storage Interface]) plugin used by the volume.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pd.csi.storage.gke.io"
+ // Note: This can sometimes be referred to as a "driver" in CSI implementations.
+ // This should represent the `name` field of the GetPluginInfo RPC.
+ //
+ // [Container Storage Interface]: https://github.com/container-storage-interface/spec
+ ContainerCsiPluginNameKey = attribute.Key("container.csi.plugin.name")
+
+ // ContainerCsiVolumeIDKey is the attribute Key conforming to the
+ // "container.csi.volume.id" semantic conventions. It represents the unique
+ // volume ID returned by the CSI ([Container Storage Interface]) plugin.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "projects/my-gcp-project/zones/my-gcp-zone/disks/my-gcp-disk"
+ // Note: This can sometimes be referred to as a "volume handle" in CSI
+ // implementations. This should represent the `Volume.volume_id` field in CSI
+ // spec.
+ //
+ // [Container Storage Interface]: https://github.com/container-storage-interface/spec
+ ContainerCsiVolumeIDKey = attribute.Key("container.csi.volume.id")
+
+ // ContainerIDKey is the attribute Key conforming to the "container.id" semantic
+ // conventions. It represents the container ID. Usually a UUID, as for example
+ // used to [identify Docker containers]. The UUID might be abbreviated.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "a3bf90e006b2"
+ //
+ // [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification
+ ContainerIDKey = attribute.Key("container.id")
+
+ // ContainerImageIDKey is the attribute Key conforming to the
+ // "container.image.id" semantic conventions. It represents the runtime specific
+ // image identifier. Usually a hash algorithm followed by a UUID.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "sha256:19c92d0a00d1b66d897bceaa7319bee0dd38a10a851c60bcec9474aa3f01e50f"
+ // Note: Docker defines a sha256 of the image id; `container.image.id`
+ // corresponds to the `Image` field from the Docker container inspect [API]
+ // endpoint.
+ // K8s defines a link to the container registry repository with digest
+ // `"imageID": "registry.azurecr.io /namespace/service/dockerfile@sha256:bdeabd40c3a8a492eaf9e8e44d0ebbb84bac7ee25ac0cf8a7159d25f62555625"`
+ // .
+ // The ID is assigned by the container runtime and can vary in different
+ // environments. Consider using `oci.manifest.digest` if it is important to
+ // identify the same image in different environments/runtimes.
+ //
+ // [API]: https://docs.docker.com/engine/api/v1.43/#tag/Container/operation/ContainerInspect
+ ContainerImageIDKey = attribute.Key("container.image.id")
+
+ // ContainerImageNameKey is the attribute Key conforming to the
+ // "container.image.name" semantic conventions. It represents the name of the
+ // image the container was built on.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "gcr.io/opentelemetry/operator"
+ ContainerImageNameKey = attribute.Key("container.image.name")
+
+ // ContainerImageRepoDigestsKey is the attribute Key conforming to the
+ // "container.image.repo_digests" semantic conventions. It represents the repo
+ // digests of the container image as provided by the container runtime.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "example@sha256:afcc7f1ac1b49db317a7196c902e61c6c3c4607d63599ee1a82d702d249a0ccb",
+ // "internal.registry.example.com:5000/example@sha256:b69959407d21e8a062e0416bf13405bb2b71ed7a84dde4158ebafacfa06f5578"
+ // Note: [Docker] and [CRI] report those under the `RepoDigests` field.
+ //
+ // [Docker]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect
+ // [CRI]: https://github.com/kubernetes/cri-api/blob/c75ef5b473bbe2d0a4fc92f82235efd665ea8e9f/pkg/apis/runtime/v1/api.proto#L1237-L1238
+ ContainerImageRepoDigestsKey = attribute.Key("container.image.repo_digests")
+
+ // ContainerImageTagsKey is the attribute Key conforming to the
+ // "container.image.tags" semantic conventions. It represents the container
+ // image tags. An example can be found in [Docker Image Inspect]. Should be only
+ // the `` section of the full name for example from
+ // `registry.example.com/my-org/my-image:`.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "v1.27.1", "3.5.7-0"
+ //
+ // [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect
+ ContainerImageTagsKey = attribute.Key("container.image.tags")
+
+ // ContainerNameKey is the attribute Key conforming to the "container.name"
+ // semantic conventions. It represents the container name used by container
+ // runtime.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-autoconf"
+ ContainerNameKey = attribute.Key("container.name")
+
+ // ContainerRuntimeKey is the attribute Key conforming to the
+ // "container.runtime" semantic conventions. It represents the container runtime
+ // managing this container.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "docker", "containerd", "rkt"
+ ContainerRuntimeKey = attribute.Key("container.runtime")
+)
+
+// ContainerCommand returns an attribute KeyValue conforming to the
+// "container.command" semantic conventions. It represents the command used to
+// run the container (i.e. the command name).
+func ContainerCommand(val string) attribute.KeyValue {
+ return ContainerCommandKey.String(val)
+}
+
+// ContainerCommandArgs returns an attribute KeyValue conforming to the
+// "container.command_args" semantic conventions. It represents the all the
+// command arguments (including the command/executable itself) run by the
+// container.
+func ContainerCommandArgs(val ...string) attribute.KeyValue {
+ return ContainerCommandArgsKey.StringSlice(val)
+}
+
+// ContainerCommandLine returns an attribute KeyValue conforming to the
+// "container.command_line" semantic conventions. It represents the full command
+// run by the container as a single string representing the full command.
+func ContainerCommandLine(val string) attribute.KeyValue {
+ return ContainerCommandLineKey.String(val)
+}
+
+// ContainerCsiPluginName returns an attribute KeyValue conforming to the
+// "container.csi.plugin.name" semantic conventions. It represents the name of
+// the CSI ([Container Storage Interface]) plugin used by the volume.
+//
+// [Container Storage Interface]: https://github.com/container-storage-interface/spec
+func ContainerCsiPluginName(val string) attribute.KeyValue {
+ return ContainerCsiPluginNameKey.String(val)
+}
+
+// ContainerCsiVolumeID returns an attribute KeyValue conforming to the
+// "container.csi.volume.id" semantic conventions. It represents the unique
+// volume ID returned by the CSI ([Container Storage Interface]) plugin.
+//
+// [Container Storage Interface]: https://github.com/container-storage-interface/spec
+func ContainerCsiVolumeID(val string) attribute.KeyValue {
+ return ContainerCsiVolumeIDKey.String(val)
+}
+
+// ContainerID returns an attribute KeyValue conforming to the "container.id"
+// semantic conventions. It represents the container ID. Usually a UUID, as for
+// example used to [identify Docker containers]. The UUID might be abbreviated.
+//
+// [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification
+func ContainerID(val string) attribute.KeyValue {
+ return ContainerIDKey.String(val)
+}
+
+// ContainerImageID returns an attribute KeyValue conforming to the
+// "container.image.id" semantic conventions. It represents the runtime specific
+// image identifier. Usually a hash algorithm followed by a UUID.
+func ContainerImageID(val string) attribute.KeyValue {
+ return ContainerImageIDKey.String(val)
+}
+
+// ContainerImageName returns an attribute KeyValue conforming to the
+// "container.image.name" semantic conventions. It represents the name of the
+// image the container was built on.
+func ContainerImageName(val string) attribute.KeyValue {
+ return ContainerImageNameKey.String(val)
+}
+
+// ContainerImageRepoDigests returns an attribute KeyValue conforming to the
+// "container.image.repo_digests" semantic conventions. It represents the repo
+// digests of the container image as provided by the container runtime.
+func ContainerImageRepoDigests(val ...string) attribute.KeyValue {
+ return ContainerImageRepoDigestsKey.StringSlice(val)
+}
+
+// ContainerImageTags returns an attribute KeyValue conforming to the
+// "container.image.tags" semantic conventions. It represents the container image
+// tags. An example can be found in [Docker Image Inspect]. Should be only the
+// `` section of the full name for example from
+// `registry.example.com/my-org/my-image:`.
+//
+// [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect
+func ContainerImageTags(val ...string) attribute.KeyValue {
+ return ContainerImageTagsKey.StringSlice(val)
+}
+
+// ContainerName returns an attribute KeyValue conforming to the "container.name"
+// semantic conventions. It represents the container name used by container
+// runtime.
+func ContainerName(val string) attribute.KeyValue {
+ return ContainerNameKey.String(val)
+}
+
+// ContainerRuntime returns an attribute KeyValue conforming to the
+// "container.runtime" semantic conventions. It represents the container runtime
+// managing this container.
+func ContainerRuntime(val string) attribute.KeyValue {
+ return ContainerRuntimeKey.String(val)
+}
+
+// Namespace: cpu
+const (
+ // CPUModeKey is the attribute Key conforming to the "cpu.mode" semantic
+ // conventions. It represents the mode of the CPU.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "user", "system"
+ CPUModeKey = attribute.Key("cpu.mode")
+)
+
+// Enum values for cpu.mode
+var (
+ // user
+ // Stability: development
+ CPUModeUser = CPUModeKey.String("user")
+ // system
+ // Stability: development
+ CPUModeSystem = CPUModeKey.String("system")
+ // nice
+ // Stability: development
+ CPUModeNice = CPUModeKey.String("nice")
+ // idle
+ // Stability: development
+ CPUModeIdle = CPUModeKey.String("idle")
+ // iowait
+ // Stability: development
+ CPUModeIowait = CPUModeKey.String("iowait")
+ // interrupt
+ // Stability: development
+ CPUModeInterrupt = CPUModeKey.String("interrupt")
+ // steal
+ // Stability: development
+ CPUModeSteal = CPUModeKey.String("steal")
+ // kernel
+ // Stability: development
+ CPUModeKernel = CPUModeKey.String("kernel")
+)
+
+// Namespace: db
+const (
+ // DBClientConnectionPoolNameKey is the attribute Key conforming to the
+ // "db.client.connection.pool.name" semantic conventions. It represents the name
+ // of the connection pool; unique within the instrumented application. In case
+ // the connection pool implementation doesn't provide a name, instrumentation
+ // SHOULD use a combination of parameters that would make the name unique, for
+ // example, combining attributes `server.address`, `server.port`, and
+ // `db.namespace`, formatted as `server.address:server.port/db.namespace`.
+ // Instrumentations that generate connection pool name following different
+ // patterns SHOULD document it.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "myDataSource"
+ DBClientConnectionPoolNameKey = attribute.Key("db.client.connection.pool.name")
+
+ // DBClientConnectionStateKey is the attribute Key conforming to the
+ // "db.client.connection.state" semantic conventions. It represents the state of
+ // a connection in the pool.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "idle"
+ DBClientConnectionStateKey = attribute.Key("db.client.connection.state")
+
+ // DBCollectionNameKey is the attribute Key conforming to the
+ // "db.collection.name" semantic conventions. It represents the name of a
+ // collection (table, container) within the database.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples: "public.users", "customers"
+ // Note: It is RECOMMENDED to capture the value as provided by the application
+ // without attempting to do any case normalization.
+ //
+ // The collection name SHOULD NOT be extracted from `db.query.text`,
+ // unless the query format is known to only ever have a single collection name
+ // present.
+ //
+ // For batch operations, if the individual operations are known to have the same
+ // collection name
+ // then that collection name SHOULD be used.
+ DBCollectionNameKey = attribute.Key("db.collection.name")
+
+ // DBNamespaceKey is the attribute Key conforming to the "db.namespace" semantic
+ // conventions. It represents the name of the database, fully qualified within
+ // the server address and port.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples: "customers", "test.users"
+ // Note: If a database system has multiple namespace components, they SHOULD be
+ // concatenated (potentially using database system specific conventions) from
+ // most general to most specific namespace component, and more specific
+ // namespaces SHOULD NOT be captured without the more general namespaces, to
+ // ensure that "startswith" queries for the more general namespaces will be
+ // valid.
+ // Semantic conventions for individual database systems SHOULD document what
+ // `db.namespace` means in the context of that system.
+ // It is RECOMMENDED to capture the value as provided by the application without
+ // attempting to do any case normalization.
+ DBNamespaceKey = attribute.Key("db.namespace")
+
+ // DBOperationBatchSizeKey is the attribute Key conforming to the
+ // "db.operation.batch.size" semantic conventions. It represents the number of
+ // queries included in a batch operation.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples: 2, 3, 4
+ // Note: Operations are only considered batches when they contain two or more
+ // operations, and so `db.operation.batch.size` SHOULD never be `1`.
+ DBOperationBatchSizeKey = attribute.Key("db.operation.batch.size")
+
+ // DBOperationNameKey is the attribute Key conforming to the "db.operation.name"
+ // semantic conventions. It represents the name of the operation or command
+ // being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples: "findAndModify", "HMSET", "SELECT"
+ // Note: It is RECOMMENDED to capture the value as provided by the application
+ // without attempting to do any case normalization.
+ //
+ // The operation name SHOULD NOT be extracted from `db.query.text`,
+ // unless the query format is known to only ever have a single operation name
+ // present.
+ //
+ // For batch operations, if the individual operations are known to have the same
+ // operation name
+ // then that operation name SHOULD be used prepended by `BATCH `,
+ // otherwise `db.operation.name` SHOULD be `BATCH` or some other database
+ // system specific term if more applicable.
+ DBOperationNameKey = attribute.Key("db.operation.name")
+
+ // DBQuerySummaryKey is the attribute Key conforming to the "db.query.summary"
+ // semantic conventions. It represents the low cardinality representation of a
+ // database query text.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples: "SELECT wuser_table", "INSERT shipping_details SELECT orders", "get
+ // user by id"
+ // Note: `db.query.summary` provides static summary of the query text. It
+ // describes a class of database queries and is useful as a grouping key,
+ // especially when analyzing telemetry for database calls involving complex
+ // queries.
+ // Summary may be available to the instrumentation through instrumentation hooks
+ // or other means. If it is not available, instrumentations that support query
+ // parsing SHOULD generate a summary following [Generating query summary]
+ // section.
+ //
+ // [Generating query summary]: ../../docs/database/database-spans.md#generating-a-summary-of-the-query-text
+ DBQuerySummaryKey = attribute.Key("db.query.summary")
+
+ // DBQueryTextKey is the attribute Key conforming to the "db.query.text"
+ // semantic conventions. It represents the database query being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples: "SELECT * FROM wuser_table where username = ?", "SET mykey ?"
+ // Note: For sanitization see [Sanitization of `db.query.text`].
+ // For batch operations, if the individual operations are known to have the same
+ // query text then that query text SHOULD be used, otherwise all of the
+ // individual query texts SHOULD be concatenated with separator `; ` or some
+ // other database system specific separator if more applicable.
+ // Even though parameterized query text can potentially have sensitive data, by
+ // using a parameterized query the user is giving a strong signal that any
+ // sensitive data will be passed as parameter values, and the benefit to
+ // observability of capturing the static part of the query text by default
+ // outweighs the risk.
+ //
+ // [Sanitization of `db.query.text`]: ../../docs/database/database-spans.md#sanitization-of-dbquerytext
+ DBQueryTextKey = attribute.Key("db.query.text")
+
+ // DBResponseReturnedRowsKey is the attribute Key conforming to the
+ // "db.response.returned_rows" semantic conventions. It represents the number of
+ // rows returned by the operation.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10, 30, 1000
+ DBResponseReturnedRowsKey = attribute.Key("db.response.returned_rows")
+
+ // DBResponseStatusCodeKey is the attribute Key conforming to the
+ // "db.response.status_code" semantic conventions. It represents the database
+ // response status code.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples: "102", "ORA-17002", "08P01", "404"
+ // Note: The status code returned by the database. Usually it represents an
+ // error code, but may also represent partial success, warning, or differentiate
+ // between various types of successful outcomes.
+ // Semantic conventions for individual database systems SHOULD document what
+ // `db.response.status_code` means in the context of that system.
+ DBResponseStatusCodeKey = attribute.Key("db.response.status_code")
+
+ // DBSystemNameKey is the attribute Key conforming to the "db.system.name"
+ // semantic conventions. It represents the database management system (DBMS)
+ // product as identified by the client instrumentation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Release_Candidate
+ //
+ // Examples:
+ // Note: The actual DBMS may differ from the one identified by the client. For
+ // example, when using PostgreSQL client libraries to connect to a CockroachDB,
+ // the `db.system.name` is set to `postgresql` based on the instrumentation's
+ // best knowledge.
+ DBSystemNameKey = attribute.Key("db.system.name")
+)
+
+// DBClientConnectionPoolName returns an attribute KeyValue conforming to the
+// "db.client.connection.pool.name" semantic conventions. It represents the name
+// of the connection pool; unique within the instrumented application. In case
+// the connection pool implementation doesn't provide a name, instrumentation
+// SHOULD use a combination of parameters that would make the name unique, for
+// example, combining attributes `server.address`, `server.port`, and
+// `db.namespace`, formatted as `server.address:server.port/db.namespace`.
+// Instrumentations that generate connection pool name following different
+// patterns SHOULD document it.
+func DBClientConnectionPoolName(val string) attribute.KeyValue {
+ return DBClientConnectionPoolNameKey.String(val)
+}
+
+// DBCollectionName returns an attribute KeyValue conforming to the
+// "db.collection.name" semantic conventions. It represents the name of a
+// collection (table, container) within the database.
+func DBCollectionName(val string) attribute.KeyValue {
+ return DBCollectionNameKey.String(val)
+}
+
+// DBNamespace returns an attribute KeyValue conforming to the "db.namespace"
+// semantic conventions. It represents the name of the database, fully qualified
+// within the server address and port.
+func DBNamespace(val string) attribute.KeyValue {
+ return DBNamespaceKey.String(val)
+}
+
+// DBOperationBatchSize returns an attribute KeyValue conforming to the
+// "db.operation.batch.size" semantic conventions. It represents the number of
+// queries included in a batch operation.
+func DBOperationBatchSize(val int) attribute.KeyValue {
+ return DBOperationBatchSizeKey.Int(val)
+}
+
+// DBOperationName returns an attribute KeyValue conforming to the
+// "db.operation.name" semantic conventions. It represents the name of the
+// operation or command being executed.
+func DBOperationName(val string) attribute.KeyValue {
+ return DBOperationNameKey.String(val)
+}
+
+// DBQuerySummary returns an attribute KeyValue conforming to the
+// "db.query.summary" semantic conventions. It represents the low cardinality
+// representation of a database query text.
+func DBQuerySummary(val string) attribute.KeyValue {
+ return DBQuerySummaryKey.String(val)
+}
+
+// DBQueryText returns an attribute KeyValue conforming to the "db.query.text"
+// semantic conventions. It represents the database query being executed.
+func DBQueryText(val string) attribute.KeyValue {
+ return DBQueryTextKey.String(val)
+}
+
+// DBResponseReturnedRows returns an attribute KeyValue conforming to the
+// "db.response.returned_rows" semantic conventions. It represents the number of
+// rows returned by the operation.
+func DBResponseReturnedRows(val int) attribute.KeyValue {
+ return DBResponseReturnedRowsKey.Int(val)
+}
+
+// DBResponseStatusCode returns an attribute KeyValue conforming to the
+// "db.response.status_code" semantic conventions. It represents the database
+// response status code.
+func DBResponseStatusCode(val string) attribute.KeyValue {
+ return DBResponseStatusCodeKey.String(val)
+}
+
+// Enum values for db.client.connection.state
+var (
+ // idle
+ // Stability: development
+ DBClientConnectionStateIdle = DBClientConnectionStateKey.String("idle")
+ // used
+ // Stability: development
+ DBClientConnectionStateUsed = DBClientConnectionStateKey.String("used")
+)
+
+// Enum values for db.system.name
+var (
+ // Some other SQL database. Fallback only.
+ // Stability: development
+ DBSystemNameOtherSQL = DBSystemNameKey.String("other_sql")
+ // [Adabas (Adaptable Database System)]
+ // Stability: development
+ //
+ // [Adabas (Adaptable Database System)]: https://documentation.softwareag.com/?pf=adabas
+ DBSystemNameSoftwareagAdabas = DBSystemNameKey.String("softwareag.adabas")
+ // [Actian Ingres]
+ // Stability: development
+ //
+ // [Actian Ingres]: https://www.actian.com/databases/ingres/
+ DBSystemNameActianIngres = DBSystemNameKey.String("actian.ingres")
+ // [Amazon DynamoDB]
+ // Stability: development
+ //
+ // [Amazon DynamoDB]: https://aws.amazon.com/pm/dynamodb/
+ DBSystemNameAWSDynamoDB = DBSystemNameKey.String("aws.dynamodb")
+ // [Amazon Redshift]
+ // Stability: development
+ //
+ // [Amazon Redshift]: https://aws.amazon.com/redshift/
+ DBSystemNameAWSRedshift = DBSystemNameKey.String("aws.redshift")
+ // [Azure Cosmos DB]
+ // Stability: development
+ //
+ // [Azure Cosmos DB]: https://learn.microsoft.com/azure/cosmos-db
+ DBSystemNameAzureCosmosDB = DBSystemNameKey.String("azure.cosmosdb")
+ // [InterSystems Caché]
+ // Stability: development
+ //
+ // [InterSystems Caché]: https://www.intersystems.com/products/cache/
+ DBSystemNameIntersystemsCache = DBSystemNameKey.String("intersystems.cache")
+ // [Apache Cassandra]
+ // Stability: development
+ //
+ // [Apache Cassandra]: https://cassandra.apache.org/
+ DBSystemNameCassandra = DBSystemNameKey.String("cassandra")
+ // [ClickHouse]
+ // Stability: development
+ //
+ // [ClickHouse]: https://clickhouse.com/
+ DBSystemNameClickhouse = DBSystemNameKey.String("clickhouse")
+ // [CockroachDB]
+ // Stability: development
+ //
+ // [CockroachDB]: https://www.cockroachlabs.com/
+ DBSystemNameCockroachdb = DBSystemNameKey.String("cockroachdb")
+ // [Couchbase]
+ // Stability: development
+ //
+ // [Couchbase]: https://www.couchbase.com/
+ DBSystemNameCouchbase = DBSystemNameKey.String("couchbase")
+ // [Apache CouchDB]
+ // Stability: development
+ //
+ // [Apache CouchDB]: https://couchdb.apache.org/
+ DBSystemNameCouchDB = DBSystemNameKey.String("couchdb")
+ // [Apache Derby]
+ // Stability: development
+ //
+ // [Apache Derby]: https://db.apache.org/derby/
+ DBSystemNameDerby = DBSystemNameKey.String("derby")
+ // [Elasticsearch]
+ // Stability: development
+ //
+ // [Elasticsearch]: https://www.elastic.co/elasticsearch
+ DBSystemNameElasticsearch = DBSystemNameKey.String("elasticsearch")
+ // [Firebird]
+ // Stability: development
+ //
+ // [Firebird]: https://www.firebirdsql.org/
+ DBSystemNameFirebirdsql = DBSystemNameKey.String("firebirdsql")
+ // [Google Cloud Spanner]
+ // Stability: development
+ //
+ // [Google Cloud Spanner]: https://cloud.google.com/spanner
+ DBSystemNameGCPSpanner = DBSystemNameKey.String("gcp.spanner")
+ // [Apache Geode]
+ // Stability: development
+ //
+ // [Apache Geode]: https://geode.apache.org/
+ DBSystemNameGeode = DBSystemNameKey.String("geode")
+ // [H2 Database]
+ // Stability: development
+ //
+ // [H2 Database]: https://h2database.com/
+ DBSystemNameH2database = DBSystemNameKey.String("h2database")
+ // [Apache HBase]
+ // Stability: development
+ //
+ // [Apache HBase]: https://hbase.apache.org/
+ DBSystemNameHBase = DBSystemNameKey.String("hbase")
+ // [Apache Hive]
+ // Stability: development
+ //
+ // [Apache Hive]: https://hive.apache.org/
+ DBSystemNameHive = DBSystemNameKey.String("hive")
+ // [HyperSQL Database]
+ // Stability: development
+ //
+ // [HyperSQL Database]: https://hsqldb.org/
+ DBSystemNameHSQLDB = DBSystemNameKey.String("hsqldb")
+ // [IBM Db2]
+ // Stability: development
+ //
+ // [IBM Db2]: https://www.ibm.com/db2
+ DBSystemNameIbmDb2 = DBSystemNameKey.String("ibm.db2")
+ // [IBM Informix]
+ // Stability: development
+ //
+ // [IBM Informix]: https://www.ibm.com/products/informix
+ DBSystemNameIbmInformix = DBSystemNameKey.String("ibm.informix")
+ // [IBM Netezza]
+ // Stability: development
+ //
+ // [IBM Netezza]: https://www.ibm.com/products/netezza
+ DBSystemNameIbmNetezza = DBSystemNameKey.String("ibm.netezza")
+ // [InfluxDB]
+ // Stability: development
+ //
+ // [InfluxDB]: https://www.influxdata.com/
+ DBSystemNameInfluxdb = DBSystemNameKey.String("influxdb")
+ // [Instant]
+ // Stability: development
+ //
+ // [Instant]: https://www.instantdb.com/
+ DBSystemNameInstantDB = DBSystemNameKey.String("instantdb")
+ // [MariaDB]
+ // Stability: release_candidate
+ //
+ // [MariaDB]: https://mariadb.org/
+ DBSystemNameMariaDB = DBSystemNameKey.String("mariadb")
+ // [Memcached]
+ // Stability: development
+ //
+ // [Memcached]: https://memcached.org/
+ DBSystemNameMemcached = DBSystemNameKey.String("memcached")
+ // [MongoDB]
+ // Stability: development
+ //
+ // [MongoDB]: https://www.mongodb.com/
+ DBSystemNameMongoDB = DBSystemNameKey.String("mongodb")
+ // [Microsoft SQL Server]
+ // Stability: release_candidate
+ //
+ // [Microsoft SQL Server]: https://www.microsoft.com/sql-server
+ DBSystemNameMicrosoftSQLServer = DBSystemNameKey.String("microsoft.sql_server")
+ // [MySQL]
+ // Stability: release_candidate
+ //
+ // [MySQL]: https://www.mysql.com/
+ DBSystemNameMySQL = DBSystemNameKey.String("mysql")
+ // [Neo4j]
+ // Stability: development
+ //
+ // [Neo4j]: https://neo4j.com/
+ DBSystemNameNeo4j = DBSystemNameKey.String("neo4j")
+ // [OpenSearch]
+ // Stability: development
+ //
+ // [OpenSearch]: https://opensearch.org/
+ DBSystemNameOpensearch = DBSystemNameKey.String("opensearch")
+ // [Oracle Database]
+ // Stability: development
+ //
+ // [Oracle Database]: https://www.oracle.com/database/
+ DBSystemNameOracleDB = DBSystemNameKey.String("oracle.db")
+ // [PostgreSQL]
+ // Stability: release_candidate
+ //
+ // [PostgreSQL]: https://www.postgresql.org/
+ DBSystemNamePostgreSQL = DBSystemNameKey.String("postgresql")
+ // [Redis]
+ // Stability: development
+ //
+ // [Redis]: https://redis.io/
+ DBSystemNameRedis = DBSystemNameKey.String("redis")
+ // [SAP HANA]
+ // Stability: development
+ //
+ // [SAP HANA]: https://www.sap.com/products/technology-platform/hana/what-is-sap-hana.html
+ DBSystemNameSapHana = DBSystemNameKey.String("sap.hana")
+ // [SAP MaxDB]
+ // Stability: development
+ //
+ // [SAP MaxDB]: https://maxdb.sap.com/
+ DBSystemNameSapMaxDB = DBSystemNameKey.String("sap.maxdb")
+ // [SQLite]
+ // Stability: development
+ //
+ // [SQLite]: https://www.sqlite.org/
+ DBSystemNameSqlite = DBSystemNameKey.String("sqlite")
+ // [Teradata]
+ // Stability: development
+ //
+ // [Teradata]: https://www.teradata.com/
+ DBSystemNameTeradata = DBSystemNameKey.String("teradata")
+ // [Trino]
+ // Stability: development
+ //
+ // [Trino]: https://trino.io/
+ DBSystemNameTrino = DBSystemNameKey.String("trino")
+)
+
+// Namespace: deployment
+const (
+ // DeploymentEnvironmentNameKey is the attribute Key conforming to the
+ // "deployment.environment.name" semantic conventions. It represents the name of
+ // the [deployment environment] (aka deployment tier).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "staging", "production"
+ // Note: `deployment.environment.name` does not affect the uniqueness
+ // constraints defined through
+ // the `service.namespace`, `service.name` and `service.instance.id` resource
+ // attributes.
+ // This implies that resources carrying the following attribute combinations
+ // MUST be
+ // considered to be identifying the same service:
+ //
+ // - `service.name=frontend`, `deployment.environment.name=production`
+ // - `service.name=frontend`, `deployment.environment.name=staging`.
+ //
+ //
+ // [deployment environment]: https://wikipedia.org/wiki/Deployment_environment
+ DeploymentEnvironmentNameKey = attribute.Key("deployment.environment.name")
+
+ // DeploymentIDKey is the attribute Key conforming to the "deployment.id"
+ // semantic conventions. It represents the id of the deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1208"
+ DeploymentIDKey = attribute.Key("deployment.id")
+
+ // DeploymentNameKey is the attribute Key conforming to the "deployment.name"
+ // semantic conventions. It represents the name of the deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "deploy my app", "deploy-frontend"
+ DeploymentNameKey = attribute.Key("deployment.name")
+
+ // DeploymentStatusKey is the attribute Key conforming to the
+ // "deployment.status" semantic conventions. It represents the status of the
+ // deployment.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ DeploymentStatusKey = attribute.Key("deployment.status")
+)
+
+// DeploymentEnvironmentName returns an attribute KeyValue conforming to the
+// "deployment.environment.name" semantic conventions. It represents the name of
+// the [deployment environment] (aka deployment tier).
+//
+// [deployment environment]: https://wikipedia.org/wiki/Deployment_environment
+func DeploymentEnvironmentName(val string) attribute.KeyValue {
+ return DeploymentEnvironmentNameKey.String(val)
+}
+
+// DeploymentID returns an attribute KeyValue conforming to the "deployment.id"
+// semantic conventions. It represents the id of the deployment.
+func DeploymentID(val string) attribute.KeyValue {
+ return DeploymentIDKey.String(val)
+}
+
+// DeploymentName returns an attribute KeyValue conforming to the
+// "deployment.name" semantic conventions. It represents the name of the
+// deployment.
+func DeploymentName(val string) attribute.KeyValue {
+ return DeploymentNameKey.String(val)
+}
+
+// Enum values for deployment.status
+var (
+ // failed
+ // Stability: development
+ DeploymentStatusFailed = DeploymentStatusKey.String("failed")
+ // succeeded
+ // Stability: development
+ DeploymentStatusSucceeded = DeploymentStatusKey.String("succeeded")
+)
+
+// Namespace: destination
+const (
+ // DestinationAddressKey is the attribute Key conforming to the
+ // "destination.address" semantic conventions. It represents the destination
+ // address - domain name if available without reverse DNS lookup; otherwise, IP
+ // address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "destination.example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the source side, and when communicating through an
+ // intermediary, `destination.address` SHOULD represent the destination address
+ // behind any intermediaries, for example proxies, if it's available.
+ DestinationAddressKey = attribute.Key("destination.address")
+
+ // DestinationPortKey is the attribute Key conforming to the "destination.port"
+ // semantic conventions. It represents the destination port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 3389, 2888
+ DestinationPortKey = attribute.Key("destination.port")
+)
+
+// DestinationAddress returns an attribute KeyValue conforming to the
+// "destination.address" semantic conventions. It represents the destination
+// address - domain name if available without reverse DNS lookup; otherwise, IP
+// address or Unix domain socket name.
+func DestinationAddress(val string) attribute.KeyValue {
+ return DestinationAddressKey.String(val)
+}
+
+// DestinationPort returns an attribute KeyValue conforming to the
+// "destination.port" semantic conventions. It represents the destination port
+// number.
+func DestinationPort(val int) attribute.KeyValue {
+ return DestinationPortKey.Int(val)
+}
+
+// Namespace: device
+const (
+ // DeviceIDKey is the attribute Key conforming to the "device.id" semantic
+ // conventions. It represents a unique identifier representing the device.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2ab2916d-a51f-4ac8-80ee-45ac31a28092"
+ // Note: The device identifier MUST only be defined using the values outlined
+ // below. This value is not an advertising identifier and MUST NOT be used as
+ // such. On iOS (Swift or Objective-C), this value MUST be equal to the
+ // [vendor identifier]. On Android (Java or Kotlin), this value MUST be equal to
+ // the Firebase Installation ID or a globally unique UUID which is persisted
+ // across sessions in your application. More information can be found [here] on
+ // best practices and exact implementation details. Caution should be taken when
+ // storing personal data or anything which can identify a user. GDPR and data
+ // protection laws may apply, ensure you do your own due diligence.
+ //
+ // [vendor identifier]: https://developer.apple.com/documentation/uikit/uidevice/1620059-identifierforvendor
+ // [here]: https://developer.android.com/training/articles/user-data-ids
+ DeviceIDKey = attribute.Key("device.id")
+
+ // DeviceManufacturerKey is the attribute Key conforming to the
+ // "device.manufacturer" semantic conventions. It represents the name of the
+ // device manufacturer.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Apple", "Samsung"
+ // Note: The Android OS provides this field via [Build]. iOS apps SHOULD
+ // hardcode the value `Apple`.
+ //
+ // [Build]: https://developer.android.com/reference/android/os/Build#MANUFACTURER
+ DeviceManufacturerKey = attribute.Key("device.manufacturer")
+
+ // DeviceModelIdentifierKey is the attribute Key conforming to the
+ // "device.model.identifier" semantic conventions. It represents the model
+ // identifier for the device.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "iPhone3,4", "SM-G920F"
+ // Note: It's recommended this value represents a machine-readable version of
+ // the model identifier rather than the market or consumer-friendly name of the
+ // device.
+ DeviceModelIdentifierKey = attribute.Key("device.model.identifier")
+
+ // DeviceModelNameKey is the attribute Key conforming to the "device.model.name"
+ // semantic conventions. It represents the marketing name for the device model.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "iPhone 6s Plus", "Samsung Galaxy S6"
+ // Note: It's recommended this value represents a human-readable version of the
+ // device model rather than a machine-readable alternative.
+ DeviceModelNameKey = attribute.Key("device.model.name")
+)
+
+// DeviceID returns an attribute KeyValue conforming to the "device.id" semantic
+// conventions. It represents a unique identifier representing the device.
+func DeviceID(val string) attribute.KeyValue {
+ return DeviceIDKey.String(val)
+}
+
+// DeviceManufacturer returns an attribute KeyValue conforming to the
+// "device.manufacturer" semantic conventions. It represents the name of the
+// device manufacturer.
+func DeviceManufacturer(val string) attribute.KeyValue {
+ return DeviceManufacturerKey.String(val)
+}
+
+// DeviceModelIdentifier returns an attribute KeyValue conforming to the
+// "device.model.identifier" semantic conventions. It represents the model
+// identifier for the device.
+func DeviceModelIdentifier(val string) attribute.KeyValue {
+ return DeviceModelIdentifierKey.String(val)
+}
+
+// DeviceModelName returns an attribute KeyValue conforming to the
+// "device.model.name" semantic conventions. It represents the marketing name for
+// the device model.
+func DeviceModelName(val string) attribute.KeyValue {
+ return DeviceModelNameKey.String(val)
+}
+
+// Namespace: disk
+const (
+ // DiskIoDirectionKey is the attribute Key conforming to the "disk.io.direction"
+ // semantic conventions. It represents the disk IO operation direction.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "read"
+ DiskIoDirectionKey = attribute.Key("disk.io.direction")
+)
+
+// Enum values for disk.io.direction
+var (
+ // read
+ // Stability: development
+ DiskIoDirectionRead = DiskIoDirectionKey.String("read")
+ // write
+ // Stability: development
+ DiskIoDirectionWrite = DiskIoDirectionKey.String("write")
+)
+
+// Namespace: dns
+const (
+ // DNSQuestionNameKey is the attribute Key conforming to the "dns.question.name"
+ // semantic conventions. It represents the name being queried.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "www.example.com", "opentelemetry.io"
+ // Note: If the name field contains non-printable characters (below 32 or above
+ // 126), those characters should be represented as escaped base 10 integers
+ // (\DDD). Back slashes and quotes should be escaped. Tabs, carriage returns,
+ // and line feeds should be converted to \t, \r, and \n respectively.
+ DNSQuestionNameKey = attribute.Key("dns.question.name")
+)
+
+// DNSQuestionName returns an attribute KeyValue conforming to the
+// "dns.question.name" semantic conventions. It represents the name being
+// queried.
+func DNSQuestionName(val string) attribute.KeyValue {
+ return DNSQuestionNameKey.String(val)
+}
+
+// Namespace: elasticsearch
+const (
+ // ElasticsearchNodeNameKey is the attribute Key conforming to the
+ // "elasticsearch.node.name" semantic conventions. It represents the represents
+ // the human-readable identifier of the node/instance to which a request was
+ // routed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "instance-0000000001"
+ ElasticsearchNodeNameKey = attribute.Key("elasticsearch.node.name")
+)
+
+// ElasticsearchNodeName returns an attribute KeyValue conforming to the
+// "elasticsearch.node.name" semantic conventions. It represents the represents
+// the human-readable identifier of the node/instance to which a request was
+// routed.
+func ElasticsearchNodeName(val string) attribute.KeyValue {
+ return ElasticsearchNodeNameKey.String(val)
+}
+
+// Namespace: error
+const (
+ // ErrorTypeKey is the attribute Key conforming to the "error.type" semantic
+ // conventions. It represents the describes a class of error the operation ended
+ // with.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "timeout", "java.net.UnknownHostException",
+ // "server_certificate_invalid", "500"
+ // Note: The `error.type` SHOULD be predictable, and SHOULD have low
+ // cardinality.
+ //
+ // When `error.type` is set to a type (e.g., an exception type), its
+ // canonical class name identifying the type within the artifact SHOULD be used.
+ //
+ // Instrumentations SHOULD document the list of errors they report.
+ //
+ // The cardinality of `error.type` within one instrumentation library SHOULD be
+ // low.
+ // Telemetry consumers that aggregate data from multiple instrumentation
+ // libraries and applications
+ // should be prepared for `error.type` to have high cardinality at query time
+ // when no
+ // additional filters are applied.
+ //
+ // If the operation has completed successfully, instrumentations SHOULD NOT set
+ // `error.type`.
+ //
+ // If a specific domain defines its own set of error identifiers (such as HTTP
+ // or gRPC status codes),
+ // it's RECOMMENDED to:
+ //
+ // - Use a domain-specific attribute
+ // - Set `error.type` to capture all errors, regardless of whether they are
+ // defined within the domain-specific set or not.
+ ErrorTypeKey = attribute.Key("error.type")
+)
+
+// Enum values for error.type
+var (
+ // A fallback error value to be used when the instrumentation doesn't define a
+ // custom value.
+ //
+ // Stability: stable
+ ErrorTypeOther = ErrorTypeKey.String("_OTHER")
+)
+
+// Namespace: exception
+const (
+ // ExceptionMessageKey is the attribute Key conforming to the
+ // "exception.message" semantic conventions. It represents the exception
+ // message.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "Division by zero", "Can't convert 'int' object to str implicitly"
+ ExceptionMessageKey = attribute.Key("exception.message")
+
+ // ExceptionStacktraceKey is the attribute Key conforming to the
+ // "exception.stacktrace" semantic conventions. It represents a stacktrace as a
+ // string in the natural representation for the language runtime. The
+ // representation is to be determined and documented by each language SIG.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: Exception in thread "main" java.lang.RuntimeException: Test
+ // exception\n at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at
+ // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at
+ // com.example.GenerateTrace.main(GenerateTrace.java:5)
+ ExceptionStacktraceKey = attribute.Key("exception.stacktrace")
+
+ // ExceptionTypeKey is the attribute Key conforming to the "exception.type"
+ // semantic conventions. It represents the type of the exception (its
+ // fully-qualified class name, if applicable). The dynamic type of the exception
+ // should be preferred over the static type in languages that support it.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "java.net.ConnectException", "OSError"
+ ExceptionTypeKey = attribute.Key("exception.type")
+)
+
+// ExceptionMessage returns an attribute KeyValue conforming to the
+// "exception.message" semantic conventions. It represents the exception message.
+func ExceptionMessage(val string) attribute.KeyValue {
+ return ExceptionMessageKey.String(val)
+}
+
+// ExceptionStacktrace returns an attribute KeyValue conforming to the
+// "exception.stacktrace" semantic conventions. It represents a stacktrace as a
+// string in the natural representation for the language runtime. The
+// representation is to be determined and documented by each language SIG.
+func ExceptionStacktrace(val string) attribute.KeyValue {
+ return ExceptionStacktraceKey.String(val)
+}
+
+// ExceptionType returns an attribute KeyValue conforming to the "exception.type"
+// semantic conventions. It represents the type of the exception (its
+// fully-qualified class name, if applicable). The dynamic type of the exception
+// should be preferred over the static type in languages that support it.
+func ExceptionType(val string) attribute.KeyValue {
+ return ExceptionTypeKey.String(val)
+}
+
+// Namespace: faas
+const (
+ // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart"
+ // semantic conventions. It represents a boolean that is true if the serverless
+ // function is executed for the first time (aka cold-start).
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FaaSColdstartKey = attribute.Key("faas.coldstart")
+
+ // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic
+ // conventions. It represents a string containing the schedule period as
+ // [Cron Expression].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0/5 * * * ? *
+ //
+ // [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm
+ FaaSCronKey = attribute.Key("faas.cron")
+
+ // FaaSDocumentCollectionKey is the attribute Key conforming to the
+ // "faas.document.collection" semantic conventions. It represents the name of
+ // the source on which the triggering operation was performed. For example, in
+ // Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the
+ // database name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "myBucketName", "myDbName"
+ FaaSDocumentCollectionKey = attribute.Key("faas.document.collection")
+
+ // FaaSDocumentNameKey is the attribute Key conforming to the
+ // "faas.document.name" semantic conventions. It represents the document
+ // name/table subjected to the operation. For example, in Cloud Storage or S3 is
+ // the name of the file, and in Cosmos DB the table name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "myFile.txt", "myTableName"
+ FaaSDocumentNameKey = attribute.Key("faas.document.name")
+
+ // FaaSDocumentOperationKey is the attribute Key conforming to the
+ // "faas.document.operation" semantic conventions. It represents the describes
+ // the type of the operation that was performed on the data.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FaaSDocumentOperationKey = attribute.Key("faas.document.operation")
+
+ // FaaSDocumentTimeKey is the attribute Key conforming to the
+ // "faas.document.time" semantic conventions. It represents a string containing
+ // the time when the data was accessed in the [ISO 8601] format expressed in
+ // [UTC].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 2020-01-23T13:47:06Z
+ //
+ // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+ // [UTC]: https://www.w3.org/TR/NOTE-datetime
+ FaaSDocumentTimeKey = attribute.Key("faas.document.time")
+
+ // FaaSInstanceKey is the attribute Key conforming to the "faas.instance"
+ // semantic conventions. It represents the execution environment ID as a string,
+ // that will be potentially reused for other invocations to the same
+ // function/function version.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021/06/28/[$LATEST]2f399eb14537447da05ab2a2e39309de"
+ // Note: - **AWS Lambda:** Use the (full) log stream name.
+ FaaSInstanceKey = attribute.Key("faas.instance")
+
+ // FaaSInvocationIDKey is the attribute Key conforming to the
+ // "faas.invocation_id" semantic conventions. It represents the invocation ID of
+ // the current function invocation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: af9d5aa4-a685-4c5f-a22b-444f80b3cc28
+ FaaSInvocationIDKey = attribute.Key("faas.invocation_id")
+
+ // FaaSInvokedNameKey is the attribute Key conforming to the "faas.invoked_name"
+ // semantic conventions. It represents the name of the invoked function.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: my-function
+ // Note: SHOULD be equal to the `faas.name` resource attribute of the invoked
+ // function.
+ FaaSInvokedNameKey = attribute.Key("faas.invoked_name")
+
+ // FaaSInvokedProviderKey is the attribute Key conforming to the
+ // "faas.invoked_provider" semantic conventions. It represents the cloud
+ // provider of the invoked function.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: SHOULD be equal to the `cloud.provider` resource attribute of the
+ // invoked function.
+ FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider")
+
+ // FaaSInvokedRegionKey is the attribute Key conforming to the
+ // "faas.invoked_region" semantic conventions. It represents the cloud region of
+ // the invoked function.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: eu-central-1
+ // Note: SHOULD be equal to the `cloud.region` resource attribute of the invoked
+ // function.
+ FaaSInvokedRegionKey = attribute.Key("faas.invoked_region")
+
+ // FaaSMaxMemoryKey is the attribute Key conforming to the "faas.max_memory"
+ // semantic conventions. It represents the amount of memory available to the
+ // serverless function converted to Bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Note: It's recommended to set this attribute since e.g. too little memory can
+ // easily stop a Java AWS Lambda function from working correctly. On AWS Lambda,
+ // the environment variable `AWS_LAMBDA_FUNCTION_MEMORY_SIZE` provides this
+ // information (which must be multiplied by 1,048,576).
+ FaaSMaxMemoryKey = attribute.Key("faas.max_memory")
+
+ // FaaSNameKey is the attribute Key conforming to the "faas.name" semantic
+ // conventions. It represents the name of the single function that this runtime
+ // instance executes.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-function", "myazurefunctionapp/some-function-name"
+ // Note: This is the name of the function as configured/deployed on the FaaS
+ // platform and is usually different from the name of the callback
+ // function (which may be stored in the
+ // [`code.namespace`/`code.function.name`]
+ // span attributes).
+ //
+ // For some cloud providers, the above definition is ambiguous. The following
+ // definition of function name MUST be used for this attribute
+ // (and consequently the span name) for the listed cloud providers/products:
+ //
+ // - **Azure:** The full name `/`, i.e., function app name
+ // followed by a forward slash followed by the function name (this form
+ // can also be seen in the resource JSON for the function).
+ // This means that a span attribute MUST be used, as an Azure function
+ // app can host multiple functions that would usually share
+ // a TracerProvider (see also the `cloud.resource_id` attribute).
+ //
+ //
+ // [`code.namespace`/`code.function.name`]: /docs/general/attributes.md#source-code-attributes
+ FaaSNameKey = attribute.Key("faas.name")
+
+ // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic
+ // conventions. It represents a string containing the function invocation time
+ // in the [ISO 8601] format expressed in [UTC].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 2020-01-23T13:47:06Z
+ //
+ // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+ // [UTC]: https://www.w3.org/TR/NOTE-datetime
+ FaaSTimeKey = attribute.Key("faas.time")
+
+ // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger" semantic
+ // conventions. It represents the type of the trigger which caused this function
+ // invocation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FaaSTriggerKey = attribute.Key("faas.trigger")
+
+ // FaaSVersionKey is the attribute Key conforming to the "faas.version" semantic
+ // conventions. It represents the immutable version of the function being
+ // executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "26", "pinkfroid-00002"
+ // Note: Depending on the cloud provider and platform, use:
+ //
+ // - **AWS Lambda:** The [function version]
+ // (an integer represented as a decimal string).
+ // - **Google Cloud Run (Services):** The [revision]
+ // (i.e., the function name plus the revision suffix).
+ // - **Google Cloud Functions:** The value of the
+ // [`K_REVISION` environment variable].
+ // - **Azure Functions:** Not applicable. Do not set this attribute.
+ //
+ //
+ // [function version]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-versions.html
+ // [revision]: https://cloud.google.com/run/docs/managing/revisions
+ // [`K_REVISION` environment variable]: https://cloud.google.com/functions/docs/env-var#runtime_environment_variables_set_automatically
+ FaaSVersionKey = attribute.Key("faas.version")
+)
+
+// FaaSColdstart returns an attribute KeyValue conforming to the "faas.coldstart"
+// semantic conventions. It represents a boolean that is true if the serverless
+// function is executed for the first time (aka cold-start).
+func FaaSColdstart(val bool) attribute.KeyValue {
+ return FaaSColdstartKey.Bool(val)
+}
+
+// FaaSCron returns an attribute KeyValue conforming to the "faas.cron" semantic
+// conventions. It represents a string containing the schedule period as
+// [Cron Expression].
+//
+// [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm
+func FaaSCron(val string) attribute.KeyValue {
+ return FaaSCronKey.String(val)
+}
+
+// FaaSDocumentCollection returns an attribute KeyValue conforming to the
+// "faas.document.collection" semantic conventions. It represents the name of the
+// source on which the triggering operation was performed. For example, in Cloud
+// Storage or S3 corresponds to the bucket name, and in Cosmos DB to the database
+// name.
+func FaaSDocumentCollection(val string) attribute.KeyValue {
+ return FaaSDocumentCollectionKey.String(val)
+}
+
+// FaaSDocumentName returns an attribute KeyValue conforming to the
+// "faas.document.name" semantic conventions. It represents the document
+// name/table subjected to the operation. For example, in Cloud Storage or S3 is
+// the name of the file, and in Cosmos DB the table name.
+func FaaSDocumentName(val string) attribute.KeyValue {
+ return FaaSDocumentNameKey.String(val)
+}
+
+// FaaSDocumentTime returns an attribute KeyValue conforming to the
+// "faas.document.time" semantic conventions. It represents a string containing
+// the time when the data was accessed in the [ISO 8601] format expressed in
+// [UTC].
+//
+// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+// [UTC]: https://www.w3.org/TR/NOTE-datetime
+func FaaSDocumentTime(val string) attribute.KeyValue {
+ return FaaSDocumentTimeKey.String(val)
+}
+
+// FaaSInstance returns an attribute KeyValue conforming to the "faas.instance"
+// semantic conventions. It represents the execution environment ID as a string,
+// that will be potentially reused for other invocations to the same
+// function/function version.
+func FaaSInstance(val string) attribute.KeyValue {
+ return FaaSInstanceKey.String(val)
+}
+
+// FaaSInvocationID returns an attribute KeyValue conforming to the
+// "faas.invocation_id" semantic conventions. It represents the invocation ID of
+// the current function invocation.
+func FaaSInvocationID(val string) attribute.KeyValue {
+ return FaaSInvocationIDKey.String(val)
+}
+
+// FaaSInvokedName returns an attribute KeyValue conforming to the
+// "faas.invoked_name" semantic conventions. It represents the name of the
+// invoked function.
+func FaaSInvokedName(val string) attribute.KeyValue {
+ return FaaSInvokedNameKey.String(val)
+}
+
+// FaaSInvokedRegion returns an attribute KeyValue conforming to the
+// "faas.invoked_region" semantic conventions. It represents the cloud region of
+// the invoked function.
+func FaaSInvokedRegion(val string) attribute.KeyValue {
+ return FaaSInvokedRegionKey.String(val)
+}
+
+// FaaSMaxMemory returns an attribute KeyValue conforming to the
+// "faas.max_memory" semantic conventions. It represents the amount of memory
+// available to the serverless function converted to Bytes.
+func FaaSMaxMemory(val int) attribute.KeyValue {
+ return FaaSMaxMemoryKey.Int(val)
+}
+
+// FaaSName returns an attribute KeyValue conforming to the "faas.name" semantic
+// conventions. It represents the name of the single function that this runtime
+// instance executes.
+func FaaSName(val string) attribute.KeyValue {
+ return FaaSNameKey.String(val)
+}
+
+// FaaSTime returns an attribute KeyValue conforming to the "faas.time" semantic
+// conventions. It represents a string containing the function invocation time in
+// the [ISO 8601] format expressed in [UTC].
+//
+// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+// [UTC]: https://www.w3.org/TR/NOTE-datetime
+func FaaSTime(val string) attribute.KeyValue {
+ return FaaSTimeKey.String(val)
+}
+
+// FaaSVersion returns an attribute KeyValue conforming to the "faas.version"
+// semantic conventions. It represents the immutable version of the function
+// being executed.
+func FaaSVersion(val string) attribute.KeyValue {
+ return FaaSVersionKey.String(val)
+}
+
+// Enum values for faas.document.operation
+var (
+ // When a new object is created.
+ // Stability: development
+ FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert")
+ // When an object is modified.
+ // Stability: development
+ FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit")
+ // When an object is deleted.
+ // Stability: development
+ FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete")
+)
+
+// Enum values for faas.invoked_provider
+var (
+ // Alibaba Cloud
+ // Stability: development
+ FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud")
+ // Amazon Web Services
+ // Stability: development
+ FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws")
+ // Microsoft Azure
+ // Stability: development
+ FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure")
+ // Google Cloud Platform
+ // Stability: development
+ FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp")
+ // Tencent Cloud
+ // Stability: development
+ FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud")
+)
+
+// Enum values for faas.trigger
+var (
+ // A response to some data source operation such as a database or filesystem
+ // read/write
+ // Stability: development
+ FaaSTriggerDatasource = FaaSTriggerKey.String("datasource")
+ // To provide an answer to an inbound HTTP request
+ // Stability: development
+ FaaSTriggerHTTP = FaaSTriggerKey.String("http")
+ // A function is set to be executed when messages are sent to a messaging system
+ // Stability: development
+ FaaSTriggerPubsub = FaaSTriggerKey.String("pubsub")
+ // A function is scheduled to be executed regularly
+ // Stability: development
+ FaaSTriggerTimer = FaaSTriggerKey.String("timer")
+ // If none of the others apply
+ // Stability: development
+ FaaSTriggerOther = FaaSTriggerKey.String("other")
+)
+
+// Namespace: feature_flag
+const (
+ // FeatureFlagContextIDKey is the attribute Key conforming to the
+ // "feature_flag.context.id" semantic conventions. It represents the unique
+ // identifier for the flag evaluation context. For example, the targeting key.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "5157782b-2203-4c80-a857-dbbd5e7761db"
+ FeatureFlagContextIDKey = attribute.Key("feature_flag.context.id")
+
+ // FeatureFlagEvaluationErrorMessageKey is the attribute Key conforming to the
+ // "feature_flag.evaluation.error.message" semantic conventions. It represents a
+ // message explaining the nature of an error occurring during flag evaluation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Flag `header-color` expected type `string` but found type `number`
+ // "
+ FeatureFlagEvaluationErrorMessageKey = attribute.Key("feature_flag.evaluation.error.message")
+
+ // FeatureFlagEvaluationReasonKey is the attribute Key conforming to the
+ // "feature_flag.evaluation.reason" semantic conventions. It represents the
+ // reason code which shows how a feature flag value was determined.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "static", "targeting_match", "error", "default"
+ FeatureFlagEvaluationReasonKey = attribute.Key("feature_flag.evaluation.reason")
+
+ // FeatureFlagKeyKey is the attribute Key conforming to the "feature_flag.key"
+ // semantic conventions. It represents the lookup key of the feature flag.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "logo-color"
+ FeatureFlagKeyKey = attribute.Key("feature_flag.key")
+
+ // FeatureFlagProviderNameKey is the attribute Key conforming to the
+ // "feature_flag.provider_name" semantic conventions. It represents the
+ // identifies the feature flag provider.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Flag Manager"
+ FeatureFlagProviderNameKey = attribute.Key("feature_flag.provider_name")
+
+ // FeatureFlagSetIDKey is the attribute Key conforming to the
+ // "feature_flag.set.id" semantic conventions. It represents the identifier of
+ // the [flag set] to which the feature flag belongs.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "proj-1", "ab98sgs", "service1/dev"
+ //
+ // [flag set]: https://openfeature.dev/specification/glossary/#flag-set
+ FeatureFlagSetIDKey = attribute.Key("feature_flag.set.id")
+
+ // FeatureFlagVariantKey is the attribute Key conforming to the
+ // "feature_flag.variant" semantic conventions. It represents a semantic
+ // identifier for an evaluated flag value.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "red", "true", "on"
+ // Note: A semantic identifier, commonly referred to as a variant, provides a
+ // means
+ // for referring to a value without including the value itself. This can
+ // provide additional context for understanding the meaning behind a value.
+ // For example, the variant `red` maybe be used for the value `#c05543`.
+ FeatureFlagVariantKey = attribute.Key("feature_flag.variant")
+
+ // FeatureFlagVersionKey is the attribute Key conforming to the
+ // "feature_flag.version" semantic conventions. It represents the version of the
+ // ruleset used during the evaluation. This may be any stable value which
+ // uniquely identifies the ruleset.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1", "01ABCDEF"
+ FeatureFlagVersionKey = attribute.Key("feature_flag.version")
+)
+
+// FeatureFlagContextID returns an attribute KeyValue conforming to the
+// "feature_flag.context.id" semantic conventions. It represents the unique
+// identifier for the flag evaluation context. For example, the targeting key.
+func FeatureFlagContextID(val string) attribute.KeyValue {
+ return FeatureFlagContextIDKey.String(val)
+}
+
+// FeatureFlagEvaluationErrorMessage returns an attribute KeyValue conforming to
+// the "feature_flag.evaluation.error.message" semantic conventions. It
+// represents a message explaining the nature of an error occurring during flag
+// evaluation.
+func FeatureFlagEvaluationErrorMessage(val string) attribute.KeyValue {
+ return FeatureFlagEvaluationErrorMessageKey.String(val)
+}
+
+// FeatureFlagKey returns an attribute KeyValue conforming to the
+// "feature_flag.key" semantic conventions. It represents the lookup key of the
+// feature flag.
+func FeatureFlagKey(val string) attribute.KeyValue {
+ return FeatureFlagKeyKey.String(val)
+}
+
+// FeatureFlagProviderName returns an attribute KeyValue conforming to the
+// "feature_flag.provider_name" semantic conventions. It represents the
+// identifies the feature flag provider.
+func FeatureFlagProviderName(val string) attribute.KeyValue {
+ return FeatureFlagProviderNameKey.String(val)
+}
+
+// FeatureFlagSetID returns an attribute KeyValue conforming to the
+// "feature_flag.set.id" semantic conventions. It represents the identifier of
+// the [flag set] to which the feature flag belongs.
+//
+// [flag set]: https://openfeature.dev/specification/glossary/#flag-set
+func FeatureFlagSetID(val string) attribute.KeyValue {
+ return FeatureFlagSetIDKey.String(val)
+}
+
+// FeatureFlagVariant returns an attribute KeyValue conforming to the
+// "feature_flag.variant" semantic conventions. It represents a semantic
+// identifier for an evaluated flag value.
+func FeatureFlagVariant(val string) attribute.KeyValue {
+ return FeatureFlagVariantKey.String(val)
+}
+
+// FeatureFlagVersion returns an attribute KeyValue conforming to the
+// "feature_flag.version" semantic conventions. It represents the version of the
+// ruleset used during the evaluation. This may be any stable value which
+// uniquely identifies the ruleset.
+func FeatureFlagVersion(val string) attribute.KeyValue {
+ return FeatureFlagVersionKey.String(val)
+}
+
+// Enum values for feature_flag.evaluation.reason
+var (
+ // The resolved value is static (no dynamic evaluation).
+ // Stability: development
+ FeatureFlagEvaluationReasonStatic = FeatureFlagEvaluationReasonKey.String("static")
+ // The resolved value fell back to a pre-configured value (no dynamic evaluation
+ // occurred or dynamic evaluation yielded no result).
+ // Stability: development
+ FeatureFlagEvaluationReasonDefault = FeatureFlagEvaluationReasonKey.String("default")
+ // The resolved value was the result of a dynamic evaluation, such as a rule or
+ // specific user-targeting.
+ // Stability: development
+ FeatureFlagEvaluationReasonTargetingMatch = FeatureFlagEvaluationReasonKey.String("targeting_match")
+ // The resolved value was the result of pseudorandom assignment.
+ // Stability: development
+ FeatureFlagEvaluationReasonSplit = FeatureFlagEvaluationReasonKey.String("split")
+ // The resolved value was retrieved from cache.
+ // Stability: development
+ FeatureFlagEvaluationReasonCached = FeatureFlagEvaluationReasonKey.String("cached")
+ // The resolved value was the result of the flag being disabled in the
+ // management system.
+ // Stability: development
+ FeatureFlagEvaluationReasonDisabled = FeatureFlagEvaluationReasonKey.String("disabled")
+ // The reason for the resolved value could not be determined.
+ // Stability: development
+ FeatureFlagEvaluationReasonUnknown = FeatureFlagEvaluationReasonKey.String("unknown")
+ // The resolved value is non-authoritative or possibly out of date
+ // Stability: development
+ FeatureFlagEvaluationReasonStale = FeatureFlagEvaluationReasonKey.String("stale")
+ // The resolved value was the result of an error.
+ // Stability: development
+ FeatureFlagEvaluationReasonError = FeatureFlagEvaluationReasonKey.String("error")
+)
+
+// Namespace: file
+const (
+ // FileAccessedKey is the attribute Key conforming to the "file.accessed"
+ // semantic conventions. It represents the time when the file was last accessed,
+ // in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ // Note: This attribute might not be supported by some file systems — NFS,
+ // FAT32, in embedded OS, etc.
+ FileAccessedKey = attribute.Key("file.accessed")
+
+ // FileAttributesKey is the attribute Key conforming to the "file.attributes"
+ // semantic conventions. It represents the array of file attributes.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "readonly", "hidden"
+ // Note: Attributes names depend on the OS or file system. Here’s a
+ // non-exhaustive list of values expected for this attribute: `archive`,
+ // `compressed`, `directory`, `encrypted`, `execute`, `hidden`, `immutable`,
+ // `journaled`, `read`, `readonly`, `symbolic link`, `system`, `temporary`,
+ // `write`.
+ FileAttributesKey = attribute.Key("file.attributes")
+
+ // FileChangedKey is the attribute Key conforming to the "file.changed" semantic
+ // conventions. It represents the time when the file attributes or metadata was
+ // last changed, in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ // Note: `file.changed` captures the time when any of the file's properties or
+ // attributes (including the content) are changed, while `file.modified`
+ // captures the timestamp when the file content is modified.
+ FileChangedKey = attribute.Key("file.changed")
+
+ // FileCreatedKey is the attribute Key conforming to the "file.created" semantic
+ // conventions. It represents the time when the file was created, in ISO 8601
+ // format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ // Note: This attribute might not be supported by some file systems — NFS,
+ // FAT32, in embedded OS, etc.
+ FileCreatedKey = attribute.Key("file.created")
+
+ // FileDirectoryKey is the attribute Key conforming to the "file.directory"
+ // semantic conventions. It represents the directory where the file is located.
+ // It should include the drive letter, when appropriate.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/home/user", "C:\Program Files\MyApp"
+ FileDirectoryKey = attribute.Key("file.directory")
+
+ // FileExtensionKey is the attribute Key conforming to the "file.extension"
+ // semantic conventions. It represents the file extension, excluding the leading
+ // dot.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "png", "gz"
+ // Note: When the file name has multiple extensions (example.tar.gz), only the
+ // last one should be captured ("gz", not "tar.gz").
+ FileExtensionKey = attribute.Key("file.extension")
+
+ // FileForkNameKey is the attribute Key conforming to the "file.fork_name"
+ // semantic conventions. It represents the name of the fork. A fork is
+ // additional data associated with a filesystem object.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Zone.Identifer"
+ // Note: On Linux, a resource fork is used to store additional data with a
+ // filesystem object. A file always has at least one fork for the data portion,
+ // and additional forks may exist.
+ // On NTFS, this is analogous to an Alternate Data Stream (ADS), and the default
+ // data stream for a file is just called $DATA. Zone.Identifier is commonly used
+ // by Windows to track contents downloaded from the Internet. An ADS is
+ // typically of the form: C:\path\to\filename.extension:some_fork_name, and
+ // some_fork_name is the value that should populate `fork_name`.
+ // `filename.extension` should populate `file.name`, and `extension` should
+ // populate `file.extension`. The full path, `file.path`, will include the fork
+ // name.
+ FileForkNameKey = attribute.Key("file.fork_name")
+
+ // FileGroupIDKey is the attribute Key conforming to the "file.group.id"
+ // semantic conventions. It represents the primary Group ID (GID) of the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1000"
+ FileGroupIDKey = attribute.Key("file.group.id")
+
+ // FileGroupNameKey is the attribute Key conforming to the "file.group.name"
+ // semantic conventions. It represents the primary group name of the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "users"
+ FileGroupNameKey = attribute.Key("file.group.name")
+
+ // FileInodeKey is the attribute Key conforming to the "file.inode" semantic
+ // conventions. It represents the inode representing the file in the filesystem.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "256383"
+ FileInodeKey = attribute.Key("file.inode")
+
+ // FileModeKey is the attribute Key conforming to the "file.mode" semantic
+ // conventions. It represents the mode of the file in octal representation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0640"
+ FileModeKey = attribute.Key("file.mode")
+
+ // FileModifiedKey is the attribute Key conforming to the "file.modified"
+ // semantic conventions. It represents the time when the file content was last
+ // modified, in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ FileModifiedKey = attribute.Key("file.modified")
+
+ // FileNameKey is the attribute Key conforming to the "file.name" semantic
+ // conventions. It represents the name of the file including the extension,
+ // without the directory.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "example.png"
+ FileNameKey = attribute.Key("file.name")
+
+ // FileOwnerIDKey is the attribute Key conforming to the "file.owner.id"
+ // semantic conventions. It represents the user ID (UID) or security identifier
+ // (SID) of the file owner.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1000"
+ FileOwnerIDKey = attribute.Key("file.owner.id")
+
+ // FileOwnerNameKey is the attribute Key conforming to the "file.owner.name"
+ // semantic conventions. It represents the username of the file owner.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "root"
+ FileOwnerNameKey = attribute.Key("file.owner.name")
+
+ // FilePathKey is the attribute Key conforming to the "file.path" semantic
+ // conventions. It represents the full path to the file, including the file
+ // name. It should include the drive letter, when appropriate.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/home/alice/example.png", "C:\Program Files\MyApp\myapp.exe"
+ FilePathKey = attribute.Key("file.path")
+
+ // FileSizeKey is the attribute Key conforming to the "file.size" semantic
+ // conventions. It represents the file size in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FileSizeKey = attribute.Key("file.size")
+
+ // FileSymbolicLinkTargetPathKey is the attribute Key conforming to the
+ // "file.symbolic_link.target_path" semantic conventions. It represents the path
+ // to the target of a symbolic link.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/usr/bin/python3"
+ // Note: This attribute is only applicable to symbolic links.
+ FileSymbolicLinkTargetPathKey = attribute.Key("file.symbolic_link.target_path")
+)
+
+// FileAccessed returns an attribute KeyValue conforming to the "file.accessed"
+// semantic conventions. It represents the time when the file was last accessed,
+// in ISO 8601 format.
+func FileAccessed(val string) attribute.KeyValue {
+ return FileAccessedKey.String(val)
+}
+
+// FileAttributes returns an attribute KeyValue conforming to the
+// "file.attributes" semantic conventions. It represents the array of file
+// attributes.
+func FileAttributes(val ...string) attribute.KeyValue {
+ return FileAttributesKey.StringSlice(val)
+}
+
+// FileChanged returns an attribute KeyValue conforming to the "file.changed"
+// semantic conventions. It represents the time when the file attributes or
+// metadata was last changed, in ISO 8601 format.
+func FileChanged(val string) attribute.KeyValue {
+ return FileChangedKey.String(val)
+}
+
+// FileCreated returns an attribute KeyValue conforming to the "file.created"
+// semantic conventions. It represents the time when the file was created, in ISO
+// 8601 format.
+func FileCreated(val string) attribute.KeyValue {
+ return FileCreatedKey.String(val)
+}
+
+// FileDirectory returns an attribute KeyValue conforming to the "file.directory"
+// semantic conventions. It represents the directory where the file is located.
+// It should include the drive letter, when appropriate.
+func FileDirectory(val string) attribute.KeyValue {
+ return FileDirectoryKey.String(val)
+}
+
+// FileExtension returns an attribute KeyValue conforming to the "file.extension"
+// semantic conventions. It represents the file extension, excluding the leading
+// dot.
+func FileExtension(val string) attribute.KeyValue {
+ return FileExtensionKey.String(val)
+}
+
+// FileForkName returns an attribute KeyValue conforming to the "file.fork_name"
+// semantic conventions. It represents the name of the fork. A fork is additional
+// data associated with a filesystem object.
+func FileForkName(val string) attribute.KeyValue {
+ return FileForkNameKey.String(val)
+}
+
+// FileGroupID returns an attribute KeyValue conforming to the "file.group.id"
+// semantic conventions. It represents the primary Group ID (GID) of the file.
+func FileGroupID(val string) attribute.KeyValue {
+ return FileGroupIDKey.String(val)
+}
+
+// FileGroupName returns an attribute KeyValue conforming to the
+// "file.group.name" semantic conventions. It represents the primary group name
+// of the file.
+func FileGroupName(val string) attribute.KeyValue {
+ return FileGroupNameKey.String(val)
+}
+
+// FileInode returns an attribute KeyValue conforming to the "file.inode"
+// semantic conventions. It represents the inode representing the file in the
+// filesystem.
+func FileInode(val string) attribute.KeyValue {
+ return FileInodeKey.String(val)
+}
+
+// FileMode returns an attribute KeyValue conforming to the "file.mode" semantic
+// conventions. It represents the mode of the file in octal representation.
+func FileMode(val string) attribute.KeyValue {
+ return FileModeKey.String(val)
+}
+
+// FileModified returns an attribute KeyValue conforming to the "file.modified"
+// semantic conventions. It represents the time when the file content was last
+// modified, in ISO 8601 format.
+func FileModified(val string) attribute.KeyValue {
+ return FileModifiedKey.String(val)
+}
+
+// FileName returns an attribute KeyValue conforming to the "file.name" semantic
+// conventions. It represents the name of the file including the extension,
+// without the directory.
+func FileName(val string) attribute.KeyValue {
+ return FileNameKey.String(val)
+}
+
+// FileOwnerID returns an attribute KeyValue conforming to the "file.owner.id"
+// semantic conventions. It represents the user ID (UID) or security identifier
+// (SID) of the file owner.
+func FileOwnerID(val string) attribute.KeyValue {
+ return FileOwnerIDKey.String(val)
+}
+
+// FileOwnerName returns an attribute KeyValue conforming to the
+// "file.owner.name" semantic conventions. It represents the username of the file
+// owner.
+func FileOwnerName(val string) attribute.KeyValue {
+ return FileOwnerNameKey.String(val)
+}
+
+// FilePath returns an attribute KeyValue conforming to the "file.path" semantic
+// conventions. It represents the full path to the file, including the file name.
+// It should include the drive letter, when appropriate.
+func FilePath(val string) attribute.KeyValue {
+ return FilePathKey.String(val)
+}
+
+// FileSize returns an attribute KeyValue conforming to the "file.size" semantic
+// conventions. It represents the file size in bytes.
+func FileSize(val int) attribute.KeyValue {
+ return FileSizeKey.Int(val)
+}
+
+// FileSymbolicLinkTargetPath returns an attribute KeyValue conforming to the
+// "file.symbolic_link.target_path" semantic conventions. It represents the path
+// to the target of a symbolic link.
+func FileSymbolicLinkTargetPath(val string) attribute.KeyValue {
+ return FileSymbolicLinkTargetPathKey.String(val)
+}
+
+// Namespace: gcp
+const (
+ // GCPClientServiceKey is the attribute Key conforming to the
+ // "gcp.client.service" semantic conventions. It represents the identifies the
+ // Google Cloud service for which the official client library is intended.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "appengine", "run", "firestore", "alloydb", "spanner"
+ // Note: Intended to be a stable identifier for Google Cloud client libraries
+ // that is uniform across implementation languages. The value should be derived
+ // from the canonical service domain for the service; for example,
+ // 'foo.googleapis.com' should result in a value of 'foo'.
+ GCPClientServiceKey = attribute.Key("gcp.client.service")
+
+ // GCPCloudRunJobExecutionKey is the attribute Key conforming to the
+ // "gcp.cloud_run.job.execution" semantic conventions. It represents the name of
+ // the Cloud Run [execution] being run for the Job, as set by the
+ // [`CLOUD_RUN_EXECUTION`] environment variable.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "job-name-xxxx", "sample-job-mdw84"
+ //
+ // [execution]: https://cloud.google.com/run/docs/managing/job-executions
+ // [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+ GCPCloudRunJobExecutionKey = attribute.Key("gcp.cloud_run.job.execution")
+
+ // GCPCloudRunJobTaskIndexKey is the attribute Key conforming to the
+ // "gcp.cloud_run.job.task_index" semantic conventions. It represents the index
+ // for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`]
+ // environment variable.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0, 1
+ //
+ // [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+ GCPCloudRunJobTaskIndexKey = attribute.Key("gcp.cloud_run.job.task_index")
+
+ // GCPGceInstanceHostnameKey is the attribute Key conforming to the
+ // "gcp.gce.instance.hostname" semantic conventions. It represents the hostname
+ // of a GCE instance. This is the full value of the default or [custom hostname]
+ // .
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-host1234.example.com",
+ // "sample-vm.us-west1-b.c.my-project.internal"
+ //
+ // [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm
+ GCPGceInstanceHostnameKey = attribute.Key("gcp.gce.instance.hostname")
+
+ // GCPGceInstanceNameKey is the attribute Key conforming to the
+ // "gcp.gce.instance.name" semantic conventions. It represents the instance name
+ // of a GCE instance. This is the value provided by `host.name`, the visible
+ // name of the instance in the Cloud Console UI, and the prefix for the default
+ // hostname of the instance as defined by the [default internal DNS name].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "instance-1", "my-vm-name"
+ //
+ // [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names
+ GCPGceInstanceNameKey = attribute.Key("gcp.gce.instance.name")
+)
+
+// GCPClientService returns an attribute KeyValue conforming to the
+// "gcp.client.service" semantic conventions. It represents the identifies the
+// Google Cloud service for which the official client library is intended.
+func GCPClientService(val string) attribute.KeyValue {
+ return GCPClientServiceKey.String(val)
+}
+
+// GCPCloudRunJobExecution returns an attribute KeyValue conforming to the
+// "gcp.cloud_run.job.execution" semantic conventions. It represents the name of
+// the Cloud Run [execution] being run for the Job, as set by the
+// [`CLOUD_RUN_EXECUTION`] environment variable.
+//
+// [execution]: https://cloud.google.com/run/docs/managing/job-executions
+// [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+func GCPCloudRunJobExecution(val string) attribute.KeyValue {
+ return GCPCloudRunJobExecutionKey.String(val)
+}
+
+// GCPCloudRunJobTaskIndex returns an attribute KeyValue conforming to the
+// "gcp.cloud_run.job.task_index" semantic conventions. It represents the index
+// for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`]
+// environment variable.
+//
+// [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+func GCPCloudRunJobTaskIndex(val int) attribute.KeyValue {
+ return GCPCloudRunJobTaskIndexKey.Int(val)
+}
+
+// GCPGceInstanceHostname returns an attribute KeyValue conforming to the
+// "gcp.gce.instance.hostname" semantic conventions. It represents the hostname
+// of a GCE instance. This is the full value of the default or [custom hostname]
+// .
+//
+// [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm
+func GCPGceInstanceHostname(val string) attribute.KeyValue {
+ return GCPGceInstanceHostnameKey.String(val)
+}
+
+// GCPGceInstanceName returns an attribute KeyValue conforming to the
+// "gcp.gce.instance.name" semantic conventions. It represents the instance name
+// of a GCE instance. This is the value provided by `host.name`, the visible name
+// of the instance in the Cloud Console UI, and the prefix for the default
+// hostname of the instance as defined by the [default internal DNS name].
+//
+// [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names
+func GCPGceInstanceName(val string) attribute.KeyValue {
+ return GCPGceInstanceNameKey.String(val)
+}
+
+// Namespace: gen_ai
+const (
+ // GenAIOpenaiRequestResponseFormatKey is the attribute Key conforming to the
+ // "gen_ai.openai.request.response_format" semantic conventions. It represents
+ // the response format that is requested.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "json"
+ GenAIOpenaiRequestResponseFormatKey = attribute.Key("gen_ai.openai.request.response_format")
+
+ // GenAIOpenaiRequestServiceTierKey is the attribute Key conforming to the
+ // "gen_ai.openai.request.service_tier" semantic conventions. It represents the
+ // service tier requested. May be a specific tier, default, or auto.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "auto", "default"
+ GenAIOpenaiRequestServiceTierKey = attribute.Key("gen_ai.openai.request.service_tier")
+
+ // GenAIOpenaiResponseServiceTierKey is the attribute Key conforming to the
+ // "gen_ai.openai.response.service_tier" semantic conventions. It represents the
+ // service tier used for the response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "scale", "default"
+ GenAIOpenaiResponseServiceTierKey = attribute.Key("gen_ai.openai.response.service_tier")
+
+ // GenAIOpenaiResponseSystemFingerprintKey is the attribute Key conforming to
+ // the "gen_ai.openai.response.system_fingerprint" semantic conventions. It
+ // represents a fingerprint to track any eventual change in the Generative AI
+ // environment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "fp_44709d6fcb"
+ GenAIOpenaiResponseSystemFingerprintKey = attribute.Key("gen_ai.openai.response.system_fingerprint")
+
+ // GenAIOperationNameKey is the attribute Key conforming to the
+ // "gen_ai.operation.name" semantic conventions. It represents the name of the
+ // operation being performed.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: If one of the predefined values applies, but specific system uses a
+ // different name it's RECOMMENDED to document it in the semantic conventions
+ // for specific GenAI system and use system-specific name in the
+ // instrumentation. If a different name is not documented, instrumentation
+ // libraries SHOULD use applicable predefined value.
+ GenAIOperationNameKey = attribute.Key("gen_ai.operation.name")
+
+ // GenAIRequestEncodingFormatsKey is the attribute Key conforming to the
+ // "gen_ai.request.encoding_formats" semantic conventions. It represents the
+ // encoding formats requested in an embeddings operation, if specified.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "base64"], ["float", "binary"
+ // Note: In some GenAI systems the encoding formats are called embedding types.
+ // Also, some GenAI systems only accept a single format per request.
+ GenAIRequestEncodingFormatsKey = attribute.Key("gen_ai.request.encoding_formats")
+
+ // GenAIRequestFrequencyPenaltyKey is the attribute Key conforming to the
+ // "gen_ai.request.frequency_penalty" semantic conventions. It represents the
+ // frequency penalty setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0.1
+ GenAIRequestFrequencyPenaltyKey = attribute.Key("gen_ai.request.frequency_penalty")
+
+ // GenAIRequestMaxTokensKey is the attribute Key conforming to the
+ // "gen_ai.request.max_tokens" semantic conventions. It represents the maximum
+ // number of tokens the model generates for a request.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ GenAIRequestMaxTokensKey = attribute.Key("gen_ai.request.max_tokens")
+
+ // GenAIRequestModelKey is the attribute Key conforming to the
+ // "gen_ai.request.model" semantic conventions. It represents the name of the
+ // GenAI model a request is being made to.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: gpt-4
+ GenAIRequestModelKey = attribute.Key("gen_ai.request.model")
+
+ // GenAIRequestPresencePenaltyKey is the attribute Key conforming to the
+ // "gen_ai.request.presence_penalty" semantic conventions. It represents the
+ // presence penalty setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0.1
+ GenAIRequestPresencePenaltyKey = attribute.Key("gen_ai.request.presence_penalty")
+
+ // GenAIRequestSeedKey is the attribute Key conforming to the
+ // "gen_ai.request.seed" semantic conventions. It represents the requests with
+ // same seed value more likely to return same result.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ GenAIRequestSeedKey = attribute.Key("gen_ai.request.seed")
+
+ // GenAIRequestStopSequencesKey is the attribute Key conforming to the
+ // "gen_ai.request.stop_sequences" semantic conventions. It represents the list
+ // of sequences that the model will use to stop generating further tokens.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "forest", "lived"
+ GenAIRequestStopSequencesKey = attribute.Key("gen_ai.request.stop_sequences")
+
+ // GenAIRequestTemperatureKey is the attribute Key conforming to the
+ // "gen_ai.request.temperature" semantic conventions. It represents the
+ // temperature setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0.0
+ GenAIRequestTemperatureKey = attribute.Key("gen_ai.request.temperature")
+
+ // GenAIRequestTopKKey is the attribute Key conforming to the
+ // "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling
+ // setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0
+ GenAIRequestTopKKey = attribute.Key("gen_ai.request.top_k")
+
+ // GenAIRequestTopPKey is the attribute Key conforming to the
+ // "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling
+ // setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0
+ GenAIRequestTopPKey = attribute.Key("gen_ai.request.top_p")
+
+ // GenAIResponseFinishReasonsKey is the attribute Key conforming to the
+ // "gen_ai.response.finish_reasons" semantic conventions. It represents the
+ // array of reasons the model stopped generating tokens, corresponding to each
+ // generation received.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "stop"], ["stop", "length"
+ GenAIResponseFinishReasonsKey = attribute.Key("gen_ai.response.finish_reasons")
+
+ // GenAIResponseIDKey is the attribute Key conforming to the
+ // "gen_ai.response.id" semantic conventions. It represents the unique
+ // identifier for the completion.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "chatcmpl-123"
+ GenAIResponseIDKey = attribute.Key("gen_ai.response.id")
+
+ // GenAIResponseModelKey is the attribute Key conforming to the
+ // "gen_ai.response.model" semantic conventions. It represents the name of the
+ // model that generated the response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "gpt-4-0613"
+ GenAIResponseModelKey = attribute.Key("gen_ai.response.model")
+
+ // GenAISystemKey is the attribute Key conforming to the "gen_ai.system"
+ // semantic conventions. It represents the Generative AI product as identified
+ // by the client or server instrumentation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: openai
+ // Note: The `gen_ai.system` describes a family of GenAI models with specific
+ // model identified
+ // by `gen_ai.request.model` and `gen_ai.response.model` attributes.
+ //
+ // The actual GenAI product may differ from the one identified by the client.
+ // Multiple systems, including Azure OpenAI and Gemini, are accessible by OpenAI
+ // client
+ // libraries. In such cases, the `gen_ai.system` is set to `openai` based on the
+ // instrumentation's best knowledge, instead of the actual system. The
+ // `server.address`
+ // attribute may help identify the actual system in use for `openai`.
+ //
+ // For custom model, a custom friendly name SHOULD be used.
+ // If none of these options apply, the `gen_ai.system` SHOULD be set to `_OTHER`
+ // .
+ GenAISystemKey = attribute.Key("gen_ai.system")
+
+ // GenAITokenTypeKey is the attribute Key conforming to the "gen_ai.token.type"
+ // semantic conventions. It represents the type of token being counted.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "input", "output"
+ GenAITokenTypeKey = attribute.Key("gen_ai.token.type")
+
+ // GenAIUsageInputTokensKey is the attribute Key conforming to the
+ // "gen_ai.usage.input_tokens" semantic conventions. It represents the number of
+ // tokens used in the GenAI input (prompt).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ GenAIUsageInputTokensKey = attribute.Key("gen_ai.usage.input_tokens")
+
+ // GenAIUsageOutputTokensKey is the attribute Key conforming to the
+ // "gen_ai.usage.output_tokens" semantic conventions. It represents the number
+ // of tokens used in the GenAI response (completion).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 180
+ GenAIUsageOutputTokensKey = attribute.Key("gen_ai.usage.output_tokens")
+)
+
+// GenAIOpenaiResponseServiceTier returns an attribute KeyValue conforming to the
+// "gen_ai.openai.response.service_tier" semantic conventions. It represents the
+// service tier used for the response.
+func GenAIOpenaiResponseServiceTier(val string) attribute.KeyValue {
+ return GenAIOpenaiResponseServiceTierKey.String(val)
+}
+
+// GenAIOpenaiResponseSystemFingerprint returns an attribute KeyValue conforming
+// to the "gen_ai.openai.response.system_fingerprint" semantic conventions. It
+// represents a fingerprint to track any eventual change in the Generative AI
+// environment.
+func GenAIOpenaiResponseSystemFingerprint(val string) attribute.KeyValue {
+ return GenAIOpenaiResponseSystemFingerprintKey.String(val)
+}
+
+// GenAIRequestEncodingFormats returns an attribute KeyValue conforming to the
+// "gen_ai.request.encoding_formats" semantic conventions. It represents the
+// encoding formats requested in an embeddings operation, if specified.
+func GenAIRequestEncodingFormats(val ...string) attribute.KeyValue {
+ return GenAIRequestEncodingFormatsKey.StringSlice(val)
+}
+
+// GenAIRequestFrequencyPenalty returns an attribute KeyValue conforming to the
+// "gen_ai.request.frequency_penalty" semantic conventions. It represents the
+// frequency penalty setting for the GenAI request.
+func GenAIRequestFrequencyPenalty(val float64) attribute.KeyValue {
+ return GenAIRequestFrequencyPenaltyKey.Float64(val)
+}
+
+// GenAIRequestMaxTokens returns an attribute KeyValue conforming to the
+// "gen_ai.request.max_tokens" semantic conventions. It represents the maximum
+// number of tokens the model generates for a request.
+func GenAIRequestMaxTokens(val int) attribute.KeyValue {
+ return GenAIRequestMaxTokensKey.Int(val)
+}
+
+// GenAIRequestModel returns an attribute KeyValue conforming to the
+// "gen_ai.request.model" semantic conventions. It represents the name of the
+// GenAI model a request is being made to.
+func GenAIRequestModel(val string) attribute.KeyValue {
+ return GenAIRequestModelKey.String(val)
+}
+
+// GenAIRequestPresencePenalty returns an attribute KeyValue conforming to the
+// "gen_ai.request.presence_penalty" semantic conventions. It represents the
+// presence penalty setting for the GenAI request.
+func GenAIRequestPresencePenalty(val float64) attribute.KeyValue {
+ return GenAIRequestPresencePenaltyKey.Float64(val)
+}
+
+// GenAIRequestSeed returns an attribute KeyValue conforming to the
+// "gen_ai.request.seed" semantic conventions. It represents the requests with
+// same seed value more likely to return same result.
+func GenAIRequestSeed(val int) attribute.KeyValue {
+ return GenAIRequestSeedKey.Int(val)
+}
+
+// GenAIRequestStopSequences returns an attribute KeyValue conforming to the
+// "gen_ai.request.stop_sequences" semantic conventions. It represents the list
+// of sequences that the model will use to stop generating further tokens.
+func GenAIRequestStopSequences(val ...string) attribute.KeyValue {
+ return GenAIRequestStopSequencesKey.StringSlice(val)
+}
+
+// GenAIRequestTemperature returns an attribute KeyValue conforming to the
+// "gen_ai.request.temperature" semantic conventions. It represents the
+// temperature setting for the GenAI request.
+func GenAIRequestTemperature(val float64) attribute.KeyValue {
+ return GenAIRequestTemperatureKey.Float64(val)
+}
+
+// GenAIRequestTopK returns an attribute KeyValue conforming to the
+// "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling
+// setting for the GenAI request.
+func GenAIRequestTopK(val float64) attribute.KeyValue {
+ return GenAIRequestTopKKey.Float64(val)
+}
+
+// GenAIRequestTopP returns an attribute KeyValue conforming to the
+// "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling
+// setting for the GenAI request.
+func GenAIRequestTopP(val float64) attribute.KeyValue {
+ return GenAIRequestTopPKey.Float64(val)
+}
+
+// GenAIResponseFinishReasons returns an attribute KeyValue conforming to the
+// "gen_ai.response.finish_reasons" semantic conventions. It represents the array
+// of reasons the model stopped generating tokens, corresponding to each
+// generation received.
+func GenAIResponseFinishReasons(val ...string) attribute.KeyValue {
+ return GenAIResponseFinishReasonsKey.StringSlice(val)
+}
+
+// GenAIResponseID returns an attribute KeyValue conforming to the
+// "gen_ai.response.id" semantic conventions. It represents the unique identifier
+// for the completion.
+func GenAIResponseID(val string) attribute.KeyValue {
+ return GenAIResponseIDKey.String(val)
+}
+
+// GenAIResponseModel returns an attribute KeyValue conforming to the
+// "gen_ai.response.model" semantic conventions. It represents the name of the
+// model that generated the response.
+func GenAIResponseModel(val string) attribute.KeyValue {
+ return GenAIResponseModelKey.String(val)
+}
+
+// GenAIUsageInputTokens returns an attribute KeyValue conforming to the
+// "gen_ai.usage.input_tokens" semantic conventions. It represents the number of
+// tokens used in the GenAI input (prompt).
+func GenAIUsageInputTokens(val int) attribute.KeyValue {
+ return GenAIUsageInputTokensKey.Int(val)
+}
+
+// GenAIUsageOutputTokens returns an attribute KeyValue conforming to the
+// "gen_ai.usage.output_tokens" semantic conventions. It represents the number of
+// tokens used in the GenAI response (completion).
+func GenAIUsageOutputTokens(val int) attribute.KeyValue {
+ return GenAIUsageOutputTokensKey.Int(val)
+}
+
+// Enum values for gen_ai.openai.request.response_format
+var (
+ // Text response format
+ // Stability: development
+ GenAIOpenaiRequestResponseFormatText = GenAIOpenaiRequestResponseFormatKey.String("text")
+ // JSON object response format
+ // Stability: development
+ GenAIOpenaiRequestResponseFormatJSONObject = GenAIOpenaiRequestResponseFormatKey.String("json_object")
+ // JSON schema response format
+ // Stability: development
+ GenAIOpenaiRequestResponseFormatJSONSchema = GenAIOpenaiRequestResponseFormatKey.String("json_schema")
+)
+
+// Enum values for gen_ai.openai.request.service_tier
+var (
+ // The system will utilize scale tier credits until they are exhausted.
+ // Stability: development
+ GenAIOpenaiRequestServiceTierAuto = GenAIOpenaiRequestServiceTierKey.String("auto")
+ // The system will utilize the default scale tier.
+ // Stability: development
+ GenAIOpenaiRequestServiceTierDefault = GenAIOpenaiRequestServiceTierKey.String("default")
+)
+
+// Enum values for gen_ai.operation.name
+var (
+ // Chat completion operation such as [OpenAI Chat API]
+ // Stability: development
+ //
+ // [OpenAI Chat API]: https://platform.openai.com/docs/api-reference/chat
+ GenAIOperationNameChat = GenAIOperationNameKey.String("chat")
+ // Text completions operation such as [OpenAI Completions API (Legacy)]
+ // Stability: development
+ //
+ // [OpenAI Completions API (Legacy)]: https://platform.openai.com/docs/api-reference/completions
+ GenAIOperationNameTextCompletion = GenAIOperationNameKey.String("text_completion")
+ // Embeddings operation such as [OpenAI Create embeddings API]
+ // Stability: development
+ //
+ // [OpenAI Create embeddings API]: https://platform.openai.com/docs/api-reference/embeddings/create
+ GenAIOperationNameEmbeddings = GenAIOperationNameKey.String("embeddings")
+)
+
+// Enum values for gen_ai.system
+var (
+ // OpenAI
+ // Stability: development
+ GenAISystemOpenai = GenAISystemKey.String("openai")
+ // Vertex AI
+ // Stability: development
+ GenAISystemVertexAI = GenAISystemKey.String("vertex_ai")
+ // Gemini
+ // Stability: development
+ GenAISystemGemini = GenAISystemKey.String("gemini")
+ // Anthropic
+ // Stability: development
+ GenAISystemAnthropic = GenAISystemKey.String("anthropic")
+ // Cohere
+ // Stability: development
+ GenAISystemCohere = GenAISystemKey.String("cohere")
+ // Azure AI Inference
+ // Stability: development
+ GenAISystemAzAIInference = GenAISystemKey.String("az.ai.inference")
+ // Azure OpenAI
+ // Stability: development
+ GenAISystemAzAIOpenai = GenAISystemKey.String("az.ai.openai")
+ // IBM Watsonx AI
+ // Stability: development
+ GenAISystemIbmWatsonxAI = GenAISystemKey.String("ibm.watsonx.ai")
+ // AWS Bedrock
+ // Stability: development
+ GenAISystemAWSBedrock = GenAISystemKey.String("aws.bedrock")
+ // Perplexity
+ // Stability: development
+ GenAISystemPerplexity = GenAISystemKey.String("perplexity")
+ // xAI
+ // Stability: development
+ GenAISystemXai = GenAISystemKey.String("xai")
+ // DeepSeek
+ // Stability: development
+ GenAISystemDeepseek = GenAISystemKey.String("deepseek")
+ // Groq
+ // Stability: development
+ GenAISystemGroq = GenAISystemKey.String("groq")
+ // Mistral AI
+ // Stability: development
+ GenAISystemMistralAI = GenAISystemKey.String("mistral_ai")
+)
+
+// Enum values for gen_ai.token.type
+var (
+ // Input tokens (prompt, input, etc.)
+ // Stability: development
+ GenAITokenTypeInput = GenAITokenTypeKey.String("input")
+ // Output tokens (completion, response, etc.)
+ // Stability: development
+ GenAITokenTypeCompletion = GenAITokenTypeKey.String("output")
+)
+
+// Namespace: geo
+const (
+ // GeoContinentCodeKey is the attribute Key conforming to the
+ // "geo.continent.code" semantic conventions. It represents the two-letter code
+ // representing continent’s name.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ GeoContinentCodeKey = attribute.Key("geo.continent.code")
+
+ // GeoCountryIsoCodeKey is the attribute Key conforming to the
+ // "geo.country.iso_code" semantic conventions. It represents the two-letter ISO
+ // Country Code ([ISO 3166-1 alpha2]).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CA"
+ //
+ // [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes
+ GeoCountryIsoCodeKey = attribute.Key("geo.country.iso_code")
+
+ // GeoLocalityNameKey is the attribute Key conforming to the "geo.locality.name"
+ // semantic conventions. It represents the locality name. Represents the name of
+ // a city, town, village, or similar populated place.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Montreal", "Berlin"
+ GeoLocalityNameKey = attribute.Key("geo.locality.name")
+
+ // GeoLocationLatKey is the attribute Key conforming to the "geo.location.lat"
+ // semantic conventions. It represents the latitude of the geo location in
+ // [WGS84].
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 45.505918
+ //
+ // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+ GeoLocationLatKey = attribute.Key("geo.location.lat")
+
+ // GeoLocationLonKey is the attribute Key conforming to the "geo.location.lon"
+ // semantic conventions. It represents the longitude of the geo location in
+ // [WGS84].
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: -73.61483
+ //
+ // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+ GeoLocationLonKey = attribute.Key("geo.location.lon")
+
+ // GeoPostalCodeKey is the attribute Key conforming to the "geo.postal_code"
+ // semantic conventions. It represents the postal code associated with the
+ // location. Values appropriate for this field may also be known as a postcode
+ // or ZIP code and will vary widely from country to country.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "94040"
+ GeoPostalCodeKey = attribute.Key("geo.postal_code")
+
+ // GeoRegionIsoCodeKey is the attribute Key conforming to the
+ // "geo.region.iso_code" semantic conventions. It represents the region ISO code
+ // ([ISO 3166-2]).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CA-QC"
+ //
+ // [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2
+ GeoRegionIsoCodeKey = attribute.Key("geo.region.iso_code")
+)
+
+// GeoCountryIsoCode returns an attribute KeyValue conforming to the
+// "geo.country.iso_code" semantic conventions. It represents the two-letter ISO
+// Country Code ([ISO 3166-1 alpha2]).
+//
+// [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes
+func GeoCountryIsoCode(val string) attribute.KeyValue {
+ return GeoCountryIsoCodeKey.String(val)
+}
+
+// GeoLocalityName returns an attribute KeyValue conforming to the
+// "geo.locality.name" semantic conventions. It represents the locality name.
+// Represents the name of a city, town, village, or similar populated place.
+func GeoLocalityName(val string) attribute.KeyValue {
+ return GeoLocalityNameKey.String(val)
+}
+
+// GeoLocationLat returns an attribute KeyValue conforming to the
+// "geo.location.lat" semantic conventions. It represents the latitude of the geo
+// location in [WGS84].
+//
+// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+func GeoLocationLat(val float64) attribute.KeyValue {
+ return GeoLocationLatKey.Float64(val)
+}
+
+// GeoLocationLon returns an attribute KeyValue conforming to the
+// "geo.location.lon" semantic conventions. It represents the longitude of the
+// geo location in [WGS84].
+//
+// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+func GeoLocationLon(val float64) attribute.KeyValue {
+ return GeoLocationLonKey.Float64(val)
+}
+
+// GeoPostalCode returns an attribute KeyValue conforming to the
+// "geo.postal_code" semantic conventions. It represents the postal code
+// associated with the location. Values appropriate for this field may also be
+// known as a postcode or ZIP code and will vary widely from country to country.
+func GeoPostalCode(val string) attribute.KeyValue {
+ return GeoPostalCodeKey.String(val)
+}
+
+// GeoRegionIsoCode returns an attribute KeyValue conforming to the
+// "geo.region.iso_code" semantic conventions. It represents the region ISO code
+// ([ISO 3166-2]).
+//
+// [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2
+func GeoRegionIsoCode(val string) attribute.KeyValue {
+ return GeoRegionIsoCodeKey.String(val)
+}
+
+// Enum values for geo.continent.code
+var (
+ // Africa
+ // Stability: development
+ GeoContinentCodeAf = GeoContinentCodeKey.String("AF")
+ // Antarctica
+ // Stability: development
+ GeoContinentCodeAn = GeoContinentCodeKey.String("AN")
+ // Asia
+ // Stability: development
+ GeoContinentCodeAs = GeoContinentCodeKey.String("AS")
+ // Europe
+ // Stability: development
+ GeoContinentCodeEu = GeoContinentCodeKey.String("EU")
+ // North America
+ // Stability: development
+ GeoContinentCodeNa = GeoContinentCodeKey.String("NA")
+ // Oceania
+ // Stability: development
+ GeoContinentCodeOc = GeoContinentCodeKey.String("OC")
+ // South America
+ // Stability: development
+ GeoContinentCodeSa = GeoContinentCodeKey.String("SA")
+)
+
+// Namespace: go
+const (
+ // GoMemoryTypeKey is the attribute Key conforming to the "go.memory.type"
+ // semantic conventions. It represents the type of memory.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "other", "stack"
+ GoMemoryTypeKey = attribute.Key("go.memory.type")
+)
+
+// Enum values for go.memory.type
+var (
+ // Memory allocated from the heap that is reserved for stack space, whether or
+ // not it is currently in-use.
+ // Stability: development
+ GoMemoryTypeStack = GoMemoryTypeKey.String("stack")
+ // Memory used by the Go runtime, excluding other categories of memory usage
+ // described in this enumeration.
+ // Stability: development
+ GoMemoryTypeOther = GoMemoryTypeKey.String("other")
+)
+
+// Namespace: graphql
+const (
+ // GraphqlDocumentKey is the attribute Key conforming to the "graphql.document"
+ // semantic conventions. It represents the GraphQL document being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: query findBookById { bookById(id: ?) { name } }
+ // Note: The value may be sanitized to exclude sensitive information.
+ GraphqlDocumentKey = attribute.Key("graphql.document")
+
+ // GraphqlOperationNameKey is the attribute Key conforming to the
+ // "graphql.operation.name" semantic conventions. It represents the name of the
+ // operation being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: findBookById
+ GraphqlOperationNameKey = attribute.Key("graphql.operation.name")
+
+ // GraphqlOperationTypeKey is the attribute Key conforming to the
+ // "graphql.operation.type" semantic conventions. It represents the type of the
+ // operation being executed.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "query", "mutation", "subscription"
+ GraphqlOperationTypeKey = attribute.Key("graphql.operation.type")
+)
+
+// GraphqlDocument returns an attribute KeyValue conforming to the
+// "graphql.document" semantic conventions. It represents the GraphQL document
+// being executed.
+func GraphqlDocument(val string) attribute.KeyValue {
+ return GraphqlDocumentKey.String(val)
+}
+
+// GraphqlOperationName returns an attribute KeyValue conforming to the
+// "graphql.operation.name" semantic conventions. It represents the name of the
+// operation being executed.
+func GraphqlOperationName(val string) attribute.KeyValue {
+ return GraphqlOperationNameKey.String(val)
+}
+
+// Enum values for graphql.operation.type
+var (
+ // GraphQL query
+ // Stability: development
+ GraphqlOperationTypeQuery = GraphqlOperationTypeKey.String("query")
+ // GraphQL mutation
+ // Stability: development
+ GraphqlOperationTypeMutation = GraphqlOperationTypeKey.String("mutation")
+ // GraphQL subscription
+ // Stability: development
+ GraphqlOperationTypeSubscription = GraphqlOperationTypeKey.String("subscription")
+)
+
+// Namespace: heroku
+const (
+ // HerokuAppIDKey is the attribute Key conforming to the "heroku.app.id"
+ // semantic conventions. It represents the unique identifier for the
+ // application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2daa2797-e42b-4624-9322-ec3f968df4da"
+ HerokuAppIDKey = attribute.Key("heroku.app.id")
+
+ // HerokuReleaseCommitKey is the attribute Key conforming to the
+ // "heroku.release.commit" semantic conventions. It represents the commit hash
+ // for the current release.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "e6134959463efd8966b20e75b913cafe3f5ec"
+ HerokuReleaseCommitKey = attribute.Key("heroku.release.commit")
+
+ // HerokuReleaseCreationTimestampKey is the attribute Key conforming to the
+ // "heroku.release.creation_timestamp" semantic conventions. It represents the
+ // time and date the release was created.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2022-10-23T18:00:42Z"
+ HerokuReleaseCreationTimestampKey = attribute.Key("heroku.release.creation_timestamp")
+)
+
+// HerokuAppID returns an attribute KeyValue conforming to the "heroku.app.id"
+// semantic conventions. It represents the unique identifier for the application.
+func HerokuAppID(val string) attribute.KeyValue {
+ return HerokuAppIDKey.String(val)
+}
+
+// HerokuReleaseCommit returns an attribute KeyValue conforming to the
+// "heroku.release.commit" semantic conventions. It represents the commit hash
+// for the current release.
+func HerokuReleaseCommit(val string) attribute.KeyValue {
+ return HerokuReleaseCommitKey.String(val)
+}
+
+// HerokuReleaseCreationTimestamp returns an attribute KeyValue conforming to the
+// "heroku.release.creation_timestamp" semantic conventions. It represents the
+// time and date the release was created.
+func HerokuReleaseCreationTimestamp(val string) attribute.KeyValue {
+ return HerokuReleaseCreationTimestampKey.String(val)
+}
+
+// Namespace: host
+const (
+ // HostArchKey is the attribute Key conforming to the "host.arch" semantic
+ // conventions. It represents the CPU architecture the host system is running
+ // on.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ HostArchKey = attribute.Key("host.arch")
+
+ // HostCPUCacheL2SizeKey is the attribute Key conforming to the
+ // "host.cpu.cache.l2.size" semantic conventions. It represents the amount of
+ // level 2 memory cache available to the processor (in Bytes).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 12288000
+ HostCPUCacheL2SizeKey = attribute.Key("host.cpu.cache.l2.size")
+
+ // HostCPUFamilyKey is the attribute Key conforming to the "host.cpu.family"
+ // semantic conventions. It represents the family or generation of the CPU.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "6", "PA-RISC 1.1e"
+ HostCPUFamilyKey = attribute.Key("host.cpu.family")
+
+ // HostCPUModelIDKey is the attribute Key conforming to the "host.cpu.model.id"
+ // semantic conventions. It represents the model identifier. It provides more
+ // granular information about the CPU, distinguishing it from other CPUs within
+ // the same family.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "6", "9000/778/B180L"
+ HostCPUModelIDKey = attribute.Key("host.cpu.model.id")
+
+ // HostCPUModelNameKey is the attribute Key conforming to the
+ // "host.cpu.model.name" semantic conventions. It represents the model
+ // designation of the processor.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "11th Gen Intel(R) Core(TM) i7-1185G7 @ 3.00GHz"
+ HostCPUModelNameKey = attribute.Key("host.cpu.model.name")
+
+ // HostCPUSteppingKey is the attribute Key conforming to the "host.cpu.stepping"
+ // semantic conventions. It represents the stepping or core revisions.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1", "r1p1"
+ HostCPUSteppingKey = attribute.Key("host.cpu.stepping")
+
+ // HostCPUVendorIDKey is the attribute Key conforming to the
+ // "host.cpu.vendor.id" semantic conventions. It represents the processor
+ // manufacturer identifier. A maximum 12-character string.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "GenuineIntel"
+ // Note: [CPUID] command returns the vendor ID string in EBX, EDX and ECX
+ // registers. Writing these to memory in this order results in a 12-character
+ // string.
+ //
+ // [CPUID]: https://wiki.osdev.org/CPUID
+ HostCPUVendorIDKey = attribute.Key("host.cpu.vendor.id")
+
+ // HostIDKey is the attribute Key conforming to the "host.id" semantic
+ // conventions. It represents the unique host ID. For Cloud, this must be the
+ // instance_id assigned by the cloud provider. For non-containerized systems,
+ // this should be the `machine-id`. See the table below for the sources to use
+ // to determine the `machine-id` based on operating system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "fdbf79e8af94cb7f9e8df36789187052"
+ HostIDKey = attribute.Key("host.id")
+
+ // HostImageIDKey is the attribute Key conforming to the "host.image.id"
+ // semantic conventions. It represents the vM image ID or host OS image ID. For
+ // Cloud, this value is from the provider.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ami-07b06b442921831e5"
+ HostImageIDKey = attribute.Key("host.image.id")
+
+ // HostImageNameKey is the attribute Key conforming to the "host.image.name"
+ // semantic conventions. It represents the name of the VM image or OS install
+ // the host was instantiated from.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "infra-ami-eks-worker-node-7d4ec78312", "CentOS-8-x86_64-1905"
+ HostImageNameKey = attribute.Key("host.image.name")
+
+ // HostImageVersionKey is the attribute Key conforming to the
+ // "host.image.version" semantic conventions. It represents the version string
+ // of the VM image or host OS as defined in [Version Attributes].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0.1"
+ //
+ // [Version Attributes]: /docs/resource/README.md#version-attributes
+ HostImageVersionKey = attribute.Key("host.image.version")
+
+ // HostIPKey is the attribute Key conforming to the "host.ip" semantic
+ // conventions. It represents the available IP addresses of the host, excluding
+ // loopback interfaces.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "192.168.1.140", "fe80::abc2:4a28:737a:609e"
+ // Note: IPv4 Addresses MUST be specified in dotted-quad notation. IPv6
+ // addresses MUST be specified in the [RFC 5952] format.
+ //
+ // [RFC 5952]: https://www.rfc-editor.org/rfc/rfc5952.html
+ HostIPKey = attribute.Key("host.ip")
+
+ // HostMacKey is the attribute Key conforming to the "host.mac" semantic
+ // conventions. It represents the available MAC addresses of the host, excluding
+ // loopback interfaces.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "AC-DE-48-23-45-67", "AC-DE-48-23-45-67-01-9F"
+ // Note: MAC Addresses MUST be represented in [IEEE RA hexadecimal form]: as
+ // hyphen-separated octets in uppercase hexadecimal form from most to least
+ // significant.
+ //
+ // [IEEE RA hexadecimal form]: https://standards.ieee.org/wp-content/uploads/import/documents/tutorials/eui.pdf
+ HostMacKey = attribute.Key("host.mac")
+
+ // HostNameKey is the attribute Key conforming to the "host.name" semantic
+ // conventions. It represents the name of the host. On Unix systems, it may
+ // contain what the hostname command returns, or the fully qualified hostname,
+ // or another name specified by the user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-test"
+ HostNameKey = attribute.Key("host.name")
+
+ // HostTypeKey is the attribute Key conforming to the "host.type" semantic
+ // conventions. It represents the type of host. For Cloud, this must be the
+ // machine type.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "n1-standard-1"
+ HostTypeKey = attribute.Key("host.type")
+)
+
+// HostCPUCacheL2Size returns an attribute KeyValue conforming to the
+// "host.cpu.cache.l2.size" semantic conventions. It represents the amount of
+// level 2 memory cache available to the processor (in Bytes).
+func HostCPUCacheL2Size(val int) attribute.KeyValue {
+ return HostCPUCacheL2SizeKey.Int(val)
+}
+
+// HostCPUFamily returns an attribute KeyValue conforming to the
+// "host.cpu.family" semantic conventions. It represents the family or generation
+// of the CPU.
+func HostCPUFamily(val string) attribute.KeyValue {
+ return HostCPUFamilyKey.String(val)
+}
+
+// HostCPUModelID returns an attribute KeyValue conforming to the
+// "host.cpu.model.id" semantic conventions. It represents the model identifier.
+// It provides more granular information about the CPU, distinguishing it from
+// other CPUs within the same family.
+func HostCPUModelID(val string) attribute.KeyValue {
+ return HostCPUModelIDKey.String(val)
+}
+
+// HostCPUModelName returns an attribute KeyValue conforming to the
+// "host.cpu.model.name" semantic conventions. It represents the model
+// designation of the processor.
+func HostCPUModelName(val string) attribute.KeyValue {
+ return HostCPUModelNameKey.String(val)
+}
+
+// HostCPUStepping returns an attribute KeyValue conforming to the
+// "host.cpu.stepping" semantic conventions. It represents the stepping or core
+// revisions.
+func HostCPUStepping(val string) attribute.KeyValue {
+ return HostCPUSteppingKey.String(val)
+}
+
+// HostCPUVendorID returns an attribute KeyValue conforming to the
+// "host.cpu.vendor.id" semantic conventions. It represents the processor
+// manufacturer identifier. A maximum 12-character string.
+func HostCPUVendorID(val string) attribute.KeyValue {
+ return HostCPUVendorIDKey.String(val)
+}
+
+// HostID returns an attribute KeyValue conforming to the "host.id" semantic
+// conventions. It represents the unique host ID. For Cloud, this must be the
+// instance_id assigned by the cloud provider. For non-containerized systems,
+// this should be the `machine-id`. See the table below for the sources to use to
+// determine the `machine-id` based on operating system.
+func HostID(val string) attribute.KeyValue {
+ return HostIDKey.String(val)
+}
+
+// HostImageID returns an attribute KeyValue conforming to the "host.image.id"
+// semantic conventions. It represents the vM image ID or host OS image ID. For
+// Cloud, this value is from the provider.
+func HostImageID(val string) attribute.KeyValue {
+ return HostImageIDKey.String(val)
+}
+
+// HostImageName returns an attribute KeyValue conforming to the
+// "host.image.name" semantic conventions. It represents the name of the VM image
+// or OS install the host was instantiated from.
+func HostImageName(val string) attribute.KeyValue {
+ return HostImageNameKey.String(val)
+}
+
+// HostImageVersion returns an attribute KeyValue conforming to the
+// "host.image.version" semantic conventions. It represents the version string of
+// the VM image or host OS as defined in [Version Attributes].
+//
+// [Version Attributes]: /docs/resource/README.md#version-attributes
+func HostImageVersion(val string) attribute.KeyValue {
+ return HostImageVersionKey.String(val)
+}
+
+// HostIP returns an attribute KeyValue conforming to the "host.ip" semantic
+// conventions. It represents the available IP addresses of the host, excluding
+// loopback interfaces.
+func HostIP(val ...string) attribute.KeyValue {
+ return HostIPKey.StringSlice(val)
+}
+
+// HostMac returns an attribute KeyValue conforming to the "host.mac" semantic
+// conventions. It represents the available MAC addresses of the host, excluding
+// loopback interfaces.
+func HostMac(val ...string) attribute.KeyValue {
+ return HostMacKey.StringSlice(val)
+}
+
+// HostName returns an attribute KeyValue conforming to the "host.name" semantic
+// conventions. It represents the name of the host. On Unix systems, it may
+// contain what the hostname command returns, or the fully qualified hostname, or
+// another name specified by the user.
+func HostName(val string) attribute.KeyValue {
+ return HostNameKey.String(val)
+}
+
+// HostType returns an attribute KeyValue conforming to the "host.type" semantic
+// conventions. It represents the type of host. For Cloud, this must be the
+// machine type.
+func HostType(val string) attribute.KeyValue {
+ return HostTypeKey.String(val)
+}
+
+// Enum values for host.arch
+var (
+ // AMD64
+ // Stability: development
+ HostArchAMD64 = HostArchKey.String("amd64")
+ // ARM32
+ // Stability: development
+ HostArchARM32 = HostArchKey.String("arm32")
+ // ARM64
+ // Stability: development
+ HostArchARM64 = HostArchKey.String("arm64")
+ // Itanium
+ // Stability: development
+ HostArchIA64 = HostArchKey.String("ia64")
+ // 32-bit PowerPC
+ // Stability: development
+ HostArchPPC32 = HostArchKey.String("ppc32")
+ // 64-bit PowerPC
+ // Stability: development
+ HostArchPPC64 = HostArchKey.String("ppc64")
+ // IBM z/Architecture
+ // Stability: development
+ HostArchS390x = HostArchKey.String("s390x")
+ // 32-bit x86
+ // Stability: development
+ HostArchX86 = HostArchKey.String("x86")
+)
+
+// Namespace: http
+const (
+ // HTTPConnectionStateKey is the attribute Key conforming to the
+ // "http.connection.state" semantic conventions. It represents the state of the
+ // HTTP connection in the HTTP connection pool.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "active", "idle"
+ HTTPConnectionStateKey = attribute.Key("http.connection.state")
+
+ // HTTPRequestBodySizeKey is the attribute Key conforming to the
+ // "http.request.body.size" semantic conventions. It represents the size of the
+ // request payload body in bytes. This is the number of bytes transferred
+ // excluding headers and is often, but not always, present as the
+ // [Content-Length] header. For requests using transport encoding, this should
+ // be the compressed size.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+ HTTPRequestBodySizeKey = attribute.Key("http.request.body.size")
+
+ // HTTPRequestMethodKey is the attribute Key conforming to the
+ // "http.request.method" semantic conventions. It represents the hTTP request
+ // method.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "GET", "POST", "HEAD"
+ // Note: HTTP request method value SHOULD be "known" to the instrumentation.
+ // By default, this convention defines "known" methods as the ones listed in
+ // [RFC9110]
+ // and the PATCH method defined in [RFC5789].
+ //
+ // If the HTTP request method is not known to instrumentation, it MUST set the
+ // `http.request.method` attribute to `_OTHER`.
+ //
+ // If the HTTP instrumentation could end up converting valid HTTP request
+ // methods to `_OTHER`, then it MUST provide a way to override
+ // the list of known HTTP methods. If this override is done via environment
+ // variable, then the environment variable MUST be named
+ // OTEL_INSTRUMENTATION_HTTP_KNOWN_METHODS and support a comma-separated list of
+ // case-sensitive known HTTP methods
+ // (this list MUST be a full override of the default known method, it is not a
+ // list of known methods in addition to the defaults).
+ //
+ // HTTP method names are case-sensitive and `http.request.method` attribute
+ // value MUST match a known HTTP method name exactly.
+ // Instrumentations for specific web frameworks that consider HTTP methods to be
+ // case insensitive, SHOULD populate a canonical equivalent.
+ // Tracing instrumentations that do so, MUST also set
+ // `http.request.method_original` to the original value.
+ //
+ // [RFC9110]: https://www.rfc-editor.org/rfc/rfc9110.html#name-methods
+ // [RFC5789]: https://www.rfc-editor.org/rfc/rfc5789.html
+ HTTPRequestMethodKey = attribute.Key("http.request.method")
+
+ // HTTPRequestMethodOriginalKey is the attribute Key conforming to the
+ // "http.request.method_original" semantic conventions. It represents the
+ // original HTTP method sent by the client in the request line.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "GeT", "ACL", "foo"
+ HTTPRequestMethodOriginalKey = attribute.Key("http.request.method_original")
+
+ // HTTPRequestResendCountKey is the attribute Key conforming to the
+ // "http.request.resend_count" semantic conventions. It represents the ordinal
+ // number of request resending attempt (for any reason, including redirects).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Note: The resend count SHOULD be updated each time an HTTP request gets
+ // resent by the client, regardless of what was the cause of the resending (e.g.
+ // redirection, authorization failure, 503 Server Unavailable, network issues,
+ // or any other).
+ HTTPRequestResendCountKey = attribute.Key("http.request.resend_count")
+
+ // HTTPRequestSizeKey is the attribute Key conforming to the "http.request.size"
+ // semantic conventions. It represents the total size of the request in bytes.
+ // This should be the total number of bytes sent over the wire, including the
+ // request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, and request
+ // body if any.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ HTTPRequestSizeKey = attribute.Key("http.request.size")
+
+ // HTTPResponseBodySizeKey is the attribute Key conforming to the
+ // "http.response.body.size" semantic conventions. It represents the size of the
+ // response payload body in bytes. This is the number of bytes transferred
+ // excluding headers and is often, but not always, present as the
+ // [Content-Length] header. For requests using transport encoding, this should
+ // be the compressed size.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+ HTTPResponseBodySizeKey = attribute.Key("http.response.body.size")
+
+ // HTTPResponseSizeKey is the attribute Key conforming to the
+ // "http.response.size" semantic conventions. It represents the total size of
+ // the response in bytes. This should be the total number of bytes sent over the
+ // wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3),
+ // headers, and response body and trailers if any.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ HTTPResponseSizeKey = attribute.Key("http.response.size")
+
+ // HTTPResponseStatusCodeKey is the attribute Key conforming to the
+ // "http.response.status_code" semantic conventions. It represents the
+ // [HTTP response status code].
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 200
+ //
+ // [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6
+ HTTPResponseStatusCodeKey = attribute.Key("http.response.status_code")
+
+ // HTTPRouteKey is the attribute Key conforming to the "http.route" semantic
+ // conventions. It represents the matched route, that is, the path template in
+ // the format used by the respective server framework.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "/users/:userID?", "{controller}/{action}/{id?}"
+ // Note: MUST NOT be populated when this is not supported by the HTTP server
+ // framework as the route attribute should have low-cardinality and the URI path
+ // can NOT substitute it.
+ // SHOULD include the [application root] if there is one.
+ //
+ // [application root]: /docs/http/http-spans.md#http-server-definitions
+ HTTPRouteKey = attribute.Key("http.route")
+)
+
+// HTTPRequestBodySize returns an attribute KeyValue conforming to the
+// "http.request.body.size" semantic conventions. It represents the size of the
+// request payload body in bytes. This is the number of bytes transferred
+// excluding headers and is often, but not always, present as the
+// [Content-Length] header. For requests using transport encoding, this should be
+// the compressed size.
+//
+// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+func HTTPRequestBodySize(val int) attribute.KeyValue {
+ return HTTPRequestBodySizeKey.Int(val)
+}
+
+// HTTPRequestMethodOriginal returns an attribute KeyValue conforming to the
+// "http.request.method_original" semantic conventions. It represents the
+// original HTTP method sent by the client in the request line.
+func HTTPRequestMethodOriginal(val string) attribute.KeyValue {
+ return HTTPRequestMethodOriginalKey.String(val)
+}
+
+// HTTPRequestResendCount returns an attribute KeyValue conforming to the
+// "http.request.resend_count" semantic conventions. It represents the ordinal
+// number of request resending attempt (for any reason, including redirects).
+func HTTPRequestResendCount(val int) attribute.KeyValue {
+ return HTTPRequestResendCountKey.Int(val)
+}
+
+// HTTPRequestSize returns an attribute KeyValue conforming to the
+// "http.request.size" semantic conventions. It represents the total size of the
+// request in bytes. This should be the total number of bytes sent over the wire,
+// including the request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers,
+// and request body if any.
+func HTTPRequestSize(val int) attribute.KeyValue {
+ return HTTPRequestSizeKey.Int(val)
+}
+
+// HTTPResponseBodySize returns an attribute KeyValue conforming to the
+// "http.response.body.size" semantic conventions. It represents the size of the
+// response payload body in bytes. This is the number of bytes transferred
+// excluding headers and is often, but not always, present as the
+// [Content-Length] header. For requests using transport encoding, this should be
+// the compressed size.
+//
+// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+func HTTPResponseBodySize(val int) attribute.KeyValue {
+ return HTTPResponseBodySizeKey.Int(val)
+}
+
+// HTTPResponseSize returns an attribute KeyValue conforming to the
+// "http.response.size" semantic conventions. It represents the total size of the
+// response in bytes. This should be the total number of bytes sent over the
+// wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3),
+// headers, and response body and trailers if any.
+func HTTPResponseSize(val int) attribute.KeyValue {
+ return HTTPResponseSizeKey.Int(val)
+}
+
+// HTTPResponseStatusCode returns an attribute KeyValue conforming to the
+// "http.response.status_code" semantic conventions. It represents the
+// [HTTP response status code].
+//
+// [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6
+func HTTPResponseStatusCode(val int) attribute.KeyValue {
+ return HTTPResponseStatusCodeKey.Int(val)
+}
+
+// HTTPRoute returns an attribute KeyValue conforming to the "http.route"
+// semantic conventions. It represents the matched route, that is, the path
+// template in the format used by the respective server framework.
+func HTTPRoute(val string) attribute.KeyValue {
+ return HTTPRouteKey.String(val)
+}
+
+// Enum values for http.connection.state
+var (
+ // active state.
+ // Stability: development
+ HTTPConnectionStateActive = HTTPConnectionStateKey.String("active")
+ // idle state.
+ // Stability: development
+ HTTPConnectionStateIdle = HTTPConnectionStateKey.String("idle")
+)
+
+// Enum values for http.request.method
+var (
+ // CONNECT method.
+ // Stability: stable
+ HTTPRequestMethodConnect = HTTPRequestMethodKey.String("CONNECT")
+ // DELETE method.
+ // Stability: stable
+ HTTPRequestMethodDelete = HTTPRequestMethodKey.String("DELETE")
+ // GET method.
+ // Stability: stable
+ HTTPRequestMethodGet = HTTPRequestMethodKey.String("GET")
+ // HEAD method.
+ // Stability: stable
+ HTTPRequestMethodHead = HTTPRequestMethodKey.String("HEAD")
+ // OPTIONS method.
+ // Stability: stable
+ HTTPRequestMethodOptions = HTTPRequestMethodKey.String("OPTIONS")
+ // PATCH method.
+ // Stability: stable
+ HTTPRequestMethodPatch = HTTPRequestMethodKey.String("PATCH")
+ // POST method.
+ // Stability: stable
+ HTTPRequestMethodPost = HTTPRequestMethodKey.String("POST")
+ // PUT method.
+ // Stability: stable
+ HTTPRequestMethodPut = HTTPRequestMethodKey.String("PUT")
+ // TRACE method.
+ // Stability: stable
+ HTTPRequestMethodTrace = HTTPRequestMethodKey.String("TRACE")
+ // Any HTTP method that the instrumentation has no prior knowledge of.
+ // Stability: stable
+ HTTPRequestMethodOther = HTTPRequestMethodKey.String("_OTHER")
+)
+
+// Namespace: hw
+const (
+ // HwIDKey is the attribute Key conforming to the "hw.id" semantic conventions.
+ // It represents an identifier for the hardware component, unique within the
+ // monitored host.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "win32battery_battery_testsysa33_1"
+ HwIDKey = attribute.Key("hw.id")
+
+ // HwNameKey is the attribute Key conforming to the "hw.name" semantic
+ // conventions. It represents an easily-recognizable name for the hardware
+ // component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "eth0"
+ HwNameKey = attribute.Key("hw.name")
+
+ // HwParentKey is the attribute Key conforming to the "hw.parent" semantic
+ // conventions. It represents the unique identifier of the parent component
+ // (typically the `hw.id` attribute of the enclosure, or disk controller).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "dellStorage_perc_0"
+ HwParentKey = attribute.Key("hw.parent")
+
+ // HwStateKey is the attribute Key conforming to the "hw.state" semantic
+ // conventions. It represents the current state of the component.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ HwStateKey = attribute.Key("hw.state")
+
+ // HwTypeKey is the attribute Key conforming to the "hw.type" semantic
+ // conventions. It represents the type of the component.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: Describes the category of the hardware component for which `hw.state`
+ // is being reported. For example, `hw.type=temperature` along with
+ // `hw.state=degraded` would indicate that the temperature of the hardware
+ // component has been reported as `degraded`.
+ HwTypeKey = attribute.Key("hw.type")
+)
+
+// HwID returns an attribute KeyValue conforming to the "hw.id" semantic
+// conventions. It represents an identifier for the hardware component, unique
+// within the monitored host.
+func HwID(val string) attribute.KeyValue {
+ return HwIDKey.String(val)
+}
+
+// HwName returns an attribute KeyValue conforming to the "hw.name" semantic
+// conventions. It represents an easily-recognizable name for the hardware
+// component.
+func HwName(val string) attribute.KeyValue {
+ return HwNameKey.String(val)
+}
+
+// HwParent returns an attribute KeyValue conforming to the "hw.parent" semantic
+// conventions. It represents the unique identifier of the parent component
+// (typically the `hw.id` attribute of the enclosure, or disk controller).
+func HwParent(val string) attribute.KeyValue {
+ return HwParentKey.String(val)
+}
+
+// Enum values for hw.state
+var (
+ // Ok
+ // Stability: development
+ HwStateOk = HwStateKey.String("ok")
+ // Degraded
+ // Stability: development
+ HwStateDegraded = HwStateKey.String("degraded")
+ // Failed
+ // Stability: development
+ HwStateFailed = HwStateKey.String("failed")
+)
+
+// Enum values for hw.type
+var (
+ // Battery
+ // Stability: development
+ HwTypeBattery = HwTypeKey.String("battery")
+ // CPU
+ // Stability: development
+ HwTypeCPU = HwTypeKey.String("cpu")
+ // Disk controller
+ // Stability: development
+ HwTypeDiskController = HwTypeKey.String("disk_controller")
+ // Enclosure
+ // Stability: development
+ HwTypeEnclosure = HwTypeKey.String("enclosure")
+ // Fan
+ // Stability: development
+ HwTypeFan = HwTypeKey.String("fan")
+ // GPU
+ // Stability: development
+ HwTypeGpu = HwTypeKey.String("gpu")
+ // Logical disk
+ // Stability: development
+ HwTypeLogicalDisk = HwTypeKey.String("logical_disk")
+ // Memory
+ // Stability: development
+ HwTypeMemory = HwTypeKey.String("memory")
+ // Network
+ // Stability: development
+ HwTypeNetwork = HwTypeKey.String("network")
+ // Physical disk
+ // Stability: development
+ HwTypePhysicalDisk = HwTypeKey.String("physical_disk")
+ // Power supply
+ // Stability: development
+ HwTypePowerSupply = HwTypeKey.String("power_supply")
+ // Tape drive
+ // Stability: development
+ HwTypeTapeDrive = HwTypeKey.String("tape_drive")
+ // Temperature
+ // Stability: development
+ HwTypeTemperature = HwTypeKey.String("temperature")
+ // Voltage
+ // Stability: development
+ HwTypeVoltage = HwTypeKey.String("voltage")
+)
+
+// Namespace: k8s
+const (
+ // K8SClusterNameKey is the attribute Key conforming to the "k8s.cluster.name"
+ // semantic conventions. It represents the name of the cluster.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-cluster"
+ K8SClusterNameKey = attribute.Key("k8s.cluster.name")
+
+ // K8SClusterUIDKey is the attribute Key conforming to the "k8s.cluster.uid"
+ // semantic conventions. It represents a pseudo-ID for the cluster, set to the
+ // UID of the `kube-system` namespace.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: K8s doesn't have support for obtaining a cluster ID. If this is ever
+ // added, we will recommend collecting the `k8s.cluster.uid` through the
+ // official APIs. In the meantime, we are able to use the `uid` of the
+ // `kube-system` namespace as a proxy for cluster ID. Read on for the
+ // rationale.
+ //
+ // Every object created in a K8s cluster is assigned a distinct UID. The
+ // `kube-system` namespace is used by Kubernetes itself and will exist
+ // for the lifetime of the cluster. Using the `uid` of the `kube-system`
+ // namespace is a reasonable proxy for the K8s ClusterID as it will only
+ // change if the cluster is rebuilt. Furthermore, Kubernetes UIDs are
+ // UUIDs as standardized by
+ // [ISO/IEC 9834-8 and ITU-T X.667].
+ // Which states:
+ //
+ // > If generated according to one of the mechanisms defined in Rec.
+ // > ITU-T X.667 | ISO/IEC 9834-8, a UUID is either guaranteed to be
+ // > different from all other UUIDs generated before 3603 A.D., or is
+ // > extremely likely to be different (depending on the mechanism chosen).
+ //
+ // Therefore, UIDs between clusters should be extremely unlikely to
+ // conflict.
+ //
+ // [ISO/IEC 9834-8 and ITU-T X.667]: https://www.itu.int/ITU-T/studygroups/com17/oid.html
+ K8SClusterUIDKey = attribute.Key("k8s.cluster.uid")
+
+ // K8SContainerNameKey is the attribute Key conforming to the
+ // "k8s.container.name" semantic conventions. It represents the name of the
+ // Container from Pod specification, must be unique within a Pod. Container
+ // runtime usually uses different globally unique name (`container.name`).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "redis"
+ K8SContainerNameKey = attribute.Key("k8s.container.name")
+
+ // K8SContainerRestartCountKey is the attribute Key conforming to the
+ // "k8s.container.restart_count" semantic conventions. It represents the number
+ // of times the container was restarted. This attribute can be used to identify
+ // a particular container (running or stopped) within a container spec.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ K8SContainerRestartCountKey = attribute.Key("k8s.container.restart_count")
+
+ // K8SContainerStatusLastTerminatedReasonKey is the attribute Key conforming to
+ // the "k8s.container.status.last_terminated_reason" semantic conventions. It
+ // represents the last terminated reason of the Container.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Evicted", "Error"
+ K8SContainerStatusLastTerminatedReasonKey = attribute.Key("k8s.container.status.last_terminated_reason")
+
+ // K8SCronJobNameKey is the attribute Key conforming to the "k8s.cronjob.name"
+ // semantic conventions. It represents the name of the CronJob.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SCronJobNameKey = attribute.Key("k8s.cronjob.name")
+
+ // K8SCronJobUIDKey is the attribute Key conforming to the "k8s.cronjob.uid"
+ // semantic conventions. It represents the UID of the CronJob.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SCronJobUIDKey = attribute.Key("k8s.cronjob.uid")
+
+ // K8SDaemonSetNameKey is the attribute Key conforming to the
+ // "k8s.daemonset.name" semantic conventions. It represents the name of the
+ // DaemonSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SDaemonSetNameKey = attribute.Key("k8s.daemonset.name")
+
+ // K8SDaemonSetUIDKey is the attribute Key conforming to the "k8s.daemonset.uid"
+ // semantic conventions. It represents the UID of the DaemonSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SDaemonSetUIDKey = attribute.Key("k8s.daemonset.uid")
+
+ // K8SDeploymentNameKey is the attribute Key conforming to the
+ // "k8s.deployment.name" semantic conventions. It represents the name of the
+ // Deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SDeploymentNameKey = attribute.Key("k8s.deployment.name")
+
+ // K8SDeploymentUIDKey is the attribute Key conforming to the
+ // "k8s.deployment.uid" semantic conventions. It represents the UID of the
+ // Deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SDeploymentUIDKey = attribute.Key("k8s.deployment.uid")
+
+ // K8SJobNameKey is the attribute Key conforming to the "k8s.job.name" semantic
+ // conventions. It represents the name of the Job.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SJobNameKey = attribute.Key("k8s.job.name")
+
+ // K8SJobUIDKey is the attribute Key conforming to the "k8s.job.uid" semantic
+ // conventions. It represents the UID of the Job.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SJobUIDKey = attribute.Key("k8s.job.uid")
+
+ // K8SNamespaceNameKey is the attribute Key conforming to the
+ // "k8s.namespace.name" semantic conventions. It represents the name of the
+ // namespace that the pod is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "default"
+ K8SNamespaceNameKey = attribute.Key("k8s.namespace.name")
+
+ // K8SNamespacePhaseKey is the attribute Key conforming to the
+ // "k8s.namespace.phase" semantic conventions. It represents the phase of the
+ // K8s namespace.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "active", "terminating"
+ // Note: This attribute aligns with the `phase` field of the
+ // [K8s NamespaceStatus]
+ //
+ // [K8s NamespaceStatus]: https://kubernetes.io/docs/reference/generated/kubernetes-api/v1.30/#namespacestatus-v1-core
+ K8SNamespacePhaseKey = attribute.Key("k8s.namespace.phase")
+
+ // K8SNodeNameKey is the attribute Key conforming to the "k8s.node.name"
+ // semantic conventions. It represents the name of the Node.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "node-1"
+ K8SNodeNameKey = attribute.Key("k8s.node.name")
+
+ // K8SNodeUIDKey is the attribute Key conforming to the "k8s.node.uid" semantic
+ // conventions. It represents the UID of the Node.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1eb3a0c6-0477-4080-a9cb-0cb7db65c6a2"
+ K8SNodeUIDKey = attribute.Key("k8s.node.uid")
+
+ // K8SPodNameKey is the attribute Key conforming to the "k8s.pod.name" semantic
+ // conventions. It represents the name of the Pod.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-pod-autoconf"
+ K8SPodNameKey = attribute.Key("k8s.pod.name")
+
+ // K8SPodUIDKey is the attribute Key conforming to the "k8s.pod.uid" semantic
+ // conventions. It represents the UID of the Pod.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SPodUIDKey = attribute.Key("k8s.pod.uid")
+
+ // K8SReplicaSetNameKey is the attribute Key conforming to the
+ // "k8s.replicaset.name" semantic conventions. It represents the name of the
+ // ReplicaSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SReplicaSetNameKey = attribute.Key("k8s.replicaset.name")
+
+ // K8SReplicaSetUIDKey is the attribute Key conforming to the
+ // "k8s.replicaset.uid" semantic conventions. It represents the UID of the
+ // ReplicaSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SReplicaSetUIDKey = attribute.Key("k8s.replicaset.uid")
+
+ // K8SStatefulSetNameKey is the attribute Key conforming to the
+ // "k8s.statefulset.name" semantic conventions. It represents the name of the
+ // StatefulSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SStatefulSetNameKey = attribute.Key("k8s.statefulset.name")
+
+ // K8SStatefulSetUIDKey is the attribute Key conforming to the
+ // "k8s.statefulset.uid" semantic conventions. It represents the UID of the
+ // StatefulSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SStatefulSetUIDKey = attribute.Key("k8s.statefulset.uid")
+
+ // K8SVolumeNameKey is the attribute Key conforming to the "k8s.volume.name"
+ // semantic conventions. It represents the name of the K8s volume.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "volume0"
+ K8SVolumeNameKey = attribute.Key("k8s.volume.name")
+
+ // K8SVolumeTypeKey is the attribute Key conforming to the "k8s.volume.type"
+ // semantic conventions. It represents the type of the K8s volume.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "emptyDir", "persistentVolumeClaim"
+ K8SVolumeTypeKey = attribute.Key("k8s.volume.type")
+)
+
+// K8SClusterName returns an attribute KeyValue conforming to the
+// "k8s.cluster.name" semantic conventions. It represents the name of the
+// cluster.
+func K8SClusterName(val string) attribute.KeyValue {
+ return K8SClusterNameKey.String(val)
+}
+
+// K8SClusterUID returns an attribute KeyValue conforming to the
+// "k8s.cluster.uid" semantic conventions. It represents a pseudo-ID for the
+// cluster, set to the UID of the `kube-system` namespace.
+func K8SClusterUID(val string) attribute.KeyValue {
+ return K8SClusterUIDKey.String(val)
+}
+
+// K8SContainerName returns an attribute KeyValue conforming to the
+// "k8s.container.name" semantic conventions. It represents the name of the
+// Container from Pod specification, must be unique within a Pod. Container
+// runtime usually uses different globally unique name (`container.name`).
+func K8SContainerName(val string) attribute.KeyValue {
+ return K8SContainerNameKey.String(val)
+}
+
+// K8SContainerRestartCount returns an attribute KeyValue conforming to the
+// "k8s.container.restart_count" semantic conventions. It represents the number
+// of times the container was restarted. This attribute can be used to identify a
+// particular container (running or stopped) within a container spec.
+func K8SContainerRestartCount(val int) attribute.KeyValue {
+ return K8SContainerRestartCountKey.Int(val)
+}
+
+// K8SContainerStatusLastTerminatedReason returns an attribute KeyValue
+// conforming to the "k8s.container.status.last_terminated_reason" semantic
+// conventions. It represents the last terminated reason of the Container.
+func K8SContainerStatusLastTerminatedReason(val string) attribute.KeyValue {
+ return K8SContainerStatusLastTerminatedReasonKey.String(val)
+}
+
+// K8SCronJobName returns an attribute KeyValue conforming to the
+// "k8s.cronjob.name" semantic conventions. It represents the name of the
+// CronJob.
+func K8SCronJobName(val string) attribute.KeyValue {
+ return K8SCronJobNameKey.String(val)
+}
+
+// K8SCronJobUID returns an attribute KeyValue conforming to the
+// "k8s.cronjob.uid" semantic conventions. It represents the UID of the CronJob.
+func K8SCronJobUID(val string) attribute.KeyValue {
+ return K8SCronJobUIDKey.String(val)
+}
+
+// K8SDaemonSetName returns an attribute KeyValue conforming to the
+// "k8s.daemonset.name" semantic conventions. It represents the name of the
+// DaemonSet.
+func K8SDaemonSetName(val string) attribute.KeyValue {
+ return K8SDaemonSetNameKey.String(val)
+}
+
+// K8SDaemonSetUID returns an attribute KeyValue conforming to the
+// "k8s.daemonset.uid" semantic conventions. It represents the UID of the
+// DaemonSet.
+func K8SDaemonSetUID(val string) attribute.KeyValue {
+ return K8SDaemonSetUIDKey.String(val)
+}
+
+// K8SDeploymentName returns an attribute KeyValue conforming to the
+// "k8s.deployment.name" semantic conventions. It represents the name of the
+// Deployment.
+func K8SDeploymentName(val string) attribute.KeyValue {
+ return K8SDeploymentNameKey.String(val)
+}
+
+// K8SDeploymentUID returns an attribute KeyValue conforming to the
+// "k8s.deployment.uid" semantic conventions. It represents the UID of the
+// Deployment.
+func K8SDeploymentUID(val string) attribute.KeyValue {
+ return K8SDeploymentUIDKey.String(val)
+}
+
+// K8SJobName returns an attribute KeyValue conforming to the "k8s.job.name"
+// semantic conventions. It represents the name of the Job.
+func K8SJobName(val string) attribute.KeyValue {
+ return K8SJobNameKey.String(val)
+}
+
+// K8SJobUID returns an attribute KeyValue conforming to the "k8s.job.uid"
+// semantic conventions. It represents the UID of the Job.
+func K8SJobUID(val string) attribute.KeyValue {
+ return K8SJobUIDKey.String(val)
+}
+
+// K8SNamespaceName returns an attribute KeyValue conforming to the
+// "k8s.namespace.name" semantic conventions. It represents the name of the
+// namespace that the pod is running in.
+func K8SNamespaceName(val string) attribute.KeyValue {
+ return K8SNamespaceNameKey.String(val)
+}
+
+// K8SNodeName returns an attribute KeyValue conforming to the "k8s.node.name"
+// semantic conventions. It represents the name of the Node.
+func K8SNodeName(val string) attribute.KeyValue {
+ return K8SNodeNameKey.String(val)
+}
+
+// K8SNodeUID returns an attribute KeyValue conforming to the "k8s.node.uid"
+// semantic conventions. It represents the UID of the Node.
+func K8SNodeUID(val string) attribute.KeyValue {
+ return K8SNodeUIDKey.String(val)
+}
+
+// K8SPodName returns an attribute KeyValue conforming to the "k8s.pod.name"
+// semantic conventions. It represents the name of the Pod.
+func K8SPodName(val string) attribute.KeyValue {
+ return K8SPodNameKey.String(val)
+}
+
+// K8SPodUID returns an attribute KeyValue conforming to the "k8s.pod.uid"
+// semantic conventions. It represents the UID of the Pod.
+func K8SPodUID(val string) attribute.KeyValue {
+ return K8SPodUIDKey.String(val)
+}
+
+// K8SReplicaSetName returns an attribute KeyValue conforming to the
+// "k8s.replicaset.name" semantic conventions. It represents the name of the
+// ReplicaSet.
+func K8SReplicaSetName(val string) attribute.KeyValue {
+ return K8SReplicaSetNameKey.String(val)
+}
+
+// K8SReplicaSetUID returns an attribute KeyValue conforming to the
+// "k8s.replicaset.uid" semantic conventions. It represents the UID of the
+// ReplicaSet.
+func K8SReplicaSetUID(val string) attribute.KeyValue {
+ return K8SReplicaSetUIDKey.String(val)
+}
+
+// K8SStatefulSetName returns an attribute KeyValue conforming to the
+// "k8s.statefulset.name" semantic conventions. It represents the name of the
+// StatefulSet.
+func K8SStatefulSetName(val string) attribute.KeyValue {
+ return K8SStatefulSetNameKey.String(val)
+}
+
+// K8SStatefulSetUID returns an attribute KeyValue conforming to the
+// "k8s.statefulset.uid" semantic conventions. It represents the UID of the
+// StatefulSet.
+func K8SStatefulSetUID(val string) attribute.KeyValue {
+ return K8SStatefulSetUIDKey.String(val)
+}
+
+// K8SVolumeName returns an attribute KeyValue conforming to the
+// "k8s.volume.name" semantic conventions. It represents the name of the K8s
+// volume.
+func K8SVolumeName(val string) attribute.KeyValue {
+ return K8SVolumeNameKey.String(val)
+}
+
+// Enum values for k8s.namespace.phase
+var (
+ // Active namespace phase as described by [K8s API]
+ // Stability: development
+ //
+ // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase
+ K8SNamespacePhaseActive = K8SNamespacePhaseKey.String("active")
+ // Terminating namespace phase as described by [K8s API]
+ // Stability: development
+ //
+ // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase
+ K8SNamespacePhaseTerminating = K8SNamespacePhaseKey.String("terminating")
+)
+
+// Enum values for k8s.volume.type
+var (
+ // A [persistentVolumeClaim] volume
+ // Stability: development
+ //
+ // [persistentVolumeClaim]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#persistentvolumeclaim
+ K8SVolumeTypePersistentVolumeClaim = K8SVolumeTypeKey.String("persistentVolumeClaim")
+ // A [configMap] volume
+ // Stability: development
+ //
+ // [configMap]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#configmap
+ K8SVolumeTypeConfigMap = K8SVolumeTypeKey.String("configMap")
+ // A [downwardAPI] volume
+ // Stability: development
+ //
+ // [downwardAPI]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#downwardapi
+ K8SVolumeTypeDownwardAPI = K8SVolumeTypeKey.String("downwardAPI")
+ // An [emptyDir] volume
+ // Stability: development
+ //
+ // [emptyDir]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#emptydir
+ K8SVolumeTypeEmptyDir = K8SVolumeTypeKey.String("emptyDir")
+ // A [secret] volume
+ // Stability: development
+ //
+ // [secret]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#secret
+ K8SVolumeTypeSecret = K8SVolumeTypeKey.String("secret")
+ // A [local] volume
+ // Stability: development
+ //
+ // [local]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#local
+ K8SVolumeTypeLocal = K8SVolumeTypeKey.String("local")
+)
+
+// Namespace: linux
+const (
+ // LinuxMemorySlabStateKey is the attribute Key conforming to the
+ // "linux.memory.slab.state" semantic conventions. It represents the Linux Slab
+ // memory state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "reclaimable", "unreclaimable"
+ LinuxMemorySlabStateKey = attribute.Key("linux.memory.slab.state")
+)
+
+// Enum values for linux.memory.slab.state
+var (
+ // reclaimable
+ // Stability: development
+ LinuxMemorySlabStateReclaimable = LinuxMemorySlabStateKey.String("reclaimable")
+ // unreclaimable
+ // Stability: development
+ LinuxMemorySlabStateUnreclaimable = LinuxMemorySlabStateKey.String("unreclaimable")
+)
+
+// Namespace: log
+const (
+ // LogFileNameKey is the attribute Key conforming to the "log.file.name"
+ // semantic conventions. It represents the basename of the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "audit.log"
+ LogFileNameKey = attribute.Key("log.file.name")
+
+ // LogFileNameResolvedKey is the attribute Key conforming to the
+ // "log.file.name_resolved" semantic conventions. It represents the basename of
+ // the file, with symlinks resolved.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "uuid.log"
+ LogFileNameResolvedKey = attribute.Key("log.file.name_resolved")
+
+ // LogFilePathKey is the attribute Key conforming to the "log.file.path"
+ // semantic conventions. It represents the full path to the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/var/log/mysql/audit.log"
+ LogFilePathKey = attribute.Key("log.file.path")
+
+ // LogFilePathResolvedKey is the attribute Key conforming to the
+ // "log.file.path_resolved" semantic conventions. It represents the full path to
+ // the file, with symlinks resolved.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/var/lib/docker/uuid.log"
+ LogFilePathResolvedKey = attribute.Key("log.file.path_resolved")
+
+ // LogIostreamKey is the attribute Key conforming to the "log.iostream" semantic
+ // conventions. It represents the stream associated with the log. See below for
+ // a list of well-known values.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ LogIostreamKey = attribute.Key("log.iostream")
+
+ // LogRecordOriginalKey is the attribute Key conforming to the
+ // "log.record.original" semantic conventions. It represents the complete
+ // original Log Record.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "77 <86>1 2015-08-06T21:58:59.694Z 192.168.2.133 inactive - - -
+ // Something happened", "[INFO] 8/3/24 12:34:56 Something happened"
+ // Note: This value MAY be added when processing a Log Record which was
+ // originally transmitted as a string or equivalent data type AND the Body field
+ // of the Log Record does not contain the same value. (e.g. a syslog or a log
+ // record read from a file.)
+ LogRecordOriginalKey = attribute.Key("log.record.original")
+
+ // LogRecordUIDKey is the attribute Key conforming to the "log.record.uid"
+ // semantic conventions. It represents a unique identifier for the Log Record.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "01ARZ3NDEKTSV4RRFFQ69G5FAV"
+ // Note: If an id is provided, other log records with the same id will be
+ // considered duplicates and can be removed safely. This means, that two
+ // distinguishable log records MUST have different values.
+ // The id MAY be an
+ // [Universally Unique Lexicographically Sortable Identifier (ULID)], but other
+ // identifiers (e.g. UUID) may be used as needed.
+ //
+ // [Universally Unique Lexicographically Sortable Identifier (ULID)]: https://github.com/ulid/spec
+ LogRecordUIDKey = attribute.Key("log.record.uid")
+)
+
+// LogFileName returns an attribute KeyValue conforming to the "log.file.name"
+// semantic conventions. It represents the basename of the file.
+func LogFileName(val string) attribute.KeyValue {
+ return LogFileNameKey.String(val)
+}
+
+// LogFileNameResolved returns an attribute KeyValue conforming to the
+// "log.file.name_resolved" semantic conventions. It represents the basename of
+// the file, with symlinks resolved.
+func LogFileNameResolved(val string) attribute.KeyValue {
+ return LogFileNameResolvedKey.String(val)
+}
+
+// LogFilePath returns an attribute KeyValue conforming to the "log.file.path"
+// semantic conventions. It represents the full path to the file.
+func LogFilePath(val string) attribute.KeyValue {
+ return LogFilePathKey.String(val)
+}
+
+// LogFilePathResolved returns an attribute KeyValue conforming to the
+// "log.file.path_resolved" semantic conventions. It represents the full path to
+// the file, with symlinks resolved.
+func LogFilePathResolved(val string) attribute.KeyValue {
+ return LogFilePathResolvedKey.String(val)
+}
+
+// LogRecordOriginal returns an attribute KeyValue conforming to the
+// "log.record.original" semantic conventions. It represents the complete
+// original Log Record.
+func LogRecordOriginal(val string) attribute.KeyValue {
+ return LogRecordOriginalKey.String(val)
+}
+
+// LogRecordUID returns an attribute KeyValue conforming to the "log.record.uid"
+// semantic conventions. It represents a unique identifier for the Log Record.
+func LogRecordUID(val string) attribute.KeyValue {
+ return LogRecordUIDKey.String(val)
+}
+
+// Enum values for log.iostream
+var (
+ // Logs from stdout stream
+ // Stability: development
+ LogIostreamStdout = LogIostreamKey.String("stdout")
+ // Events from stderr stream
+ // Stability: development
+ LogIostreamStderr = LogIostreamKey.String("stderr")
+)
+
+// Namespace: messaging
+const (
+ // MessagingBatchMessageCountKey is the attribute Key conforming to the
+ // "messaging.batch.message_count" semantic conventions. It represents the
+ // number of messages sent, received, or processed in the scope of the batching
+ // operation.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0, 1, 2
+ // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on
+ // spans that operate with a single message. When a messaging client library
+ // supports both batch and single-message API for the same operation,
+ // instrumentations SHOULD use `messaging.batch.message_count` for batching APIs
+ // and SHOULD NOT use it for single-message APIs.
+ MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count")
+
+ // MessagingClientIDKey is the attribute Key conforming to the
+ // "messaging.client.id" semantic conventions. It represents a unique identifier
+ // for the client that consumes or produces a message.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "client-5", "myhost@8742@s8083jm"
+ MessagingClientIDKey = attribute.Key("messaging.client.id")
+
+ // MessagingConsumerGroupNameKey is the attribute Key conforming to the
+ // "messaging.consumer.group.name" semantic conventions. It represents the name
+ // of the consumer group with which a consumer is associated.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-group", "indexer"
+ // Note: Semantic conventions for individual messaging systems SHOULD document
+ // whether `messaging.consumer.group.name` is applicable and what it means in
+ // the context of that system.
+ MessagingConsumerGroupNameKey = attribute.Key("messaging.consumer.group.name")
+
+ // MessagingDestinationAnonymousKey is the attribute Key conforming to the
+ // "messaging.destination.anonymous" semantic conventions. It represents a
+ // boolean that is true if the message destination is anonymous (could be
+ // unnamed or have auto-generated name).
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingDestinationAnonymousKey = attribute.Key("messaging.destination.anonymous")
+
+ // MessagingDestinationNameKey is the attribute Key conforming to the
+ // "messaging.destination.name" semantic conventions. It represents the message
+ // destination name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MyQueue", "MyTopic"
+ // Note: Destination name SHOULD uniquely identify a specific queue, topic or
+ // other entity within the broker. If
+ // the broker doesn't have such notion, the destination name SHOULD uniquely
+ // identify the broker.
+ MessagingDestinationNameKey = attribute.Key("messaging.destination.name")
+
+ // MessagingDestinationPartitionIDKey is the attribute Key conforming to the
+ // "messaging.destination.partition.id" semantic conventions. It represents the
+ // identifier of the partition messages are sent to or received from, unique
+ // within the `messaging.destination.name`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1
+ MessagingDestinationPartitionIDKey = attribute.Key("messaging.destination.partition.id")
+
+ // MessagingDestinationSubscriptionNameKey is the attribute Key conforming to
+ // the "messaging.destination.subscription.name" semantic conventions. It
+ // represents the name of the destination subscription from which a message is
+ // consumed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "subscription-a"
+ // Note: Semantic conventions for individual messaging systems SHOULD document
+ // whether `messaging.destination.subscription.name` is applicable and what it
+ // means in the context of that system.
+ MessagingDestinationSubscriptionNameKey = attribute.Key("messaging.destination.subscription.name")
+
+ // MessagingDestinationTemplateKey is the attribute Key conforming to the
+ // "messaging.destination.template" semantic conventions. It represents the low
+ // cardinality representation of the messaging destination name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/customers/{customerId}"
+ // Note: Destination names could be constructed from templates. An example would
+ // be a destination name involving a user name or product id. Although the
+ // destination name in this case is of high cardinality, the underlying template
+ // is of low cardinality and can be effectively used for grouping and
+ // aggregation.
+ MessagingDestinationTemplateKey = attribute.Key("messaging.destination.template")
+
+ // MessagingDestinationTemporaryKey is the attribute Key conforming to the
+ // "messaging.destination.temporary" semantic conventions. It represents a
+ // boolean that is true if the message destination is temporary and might not
+ // exist anymore after messages are processed.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingDestinationTemporaryKey = attribute.Key("messaging.destination.temporary")
+
+ // MessagingEventhubsMessageEnqueuedTimeKey is the attribute Key conforming to
+ // the "messaging.eventhubs.message.enqueued_time" semantic conventions. It
+ // represents the UTC epoch seconds at which the message has been accepted and
+ // stored in the entity.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingEventhubsMessageEnqueuedTimeKey = attribute.Key("messaging.eventhubs.message.enqueued_time")
+
+ // MessagingGCPPubsubMessageAckDeadlineKey is the attribute Key conforming to
+ // the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It
+ // represents the ack deadline in seconds set for the modify ack deadline
+ // request.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingGCPPubsubMessageAckDeadlineKey = attribute.Key("messaging.gcp_pubsub.message.ack_deadline")
+
+ // MessagingGCPPubsubMessageAckIDKey is the attribute Key conforming to the
+ // "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the
+ // ack id for a given message.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: ack_id
+ MessagingGCPPubsubMessageAckIDKey = attribute.Key("messaging.gcp_pubsub.message.ack_id")
+
+ // MessagingGCPPubsubMessageDeliveryAttemptKey is the attribute Key conforming
+ // to the "messaging.gcp_pubsub.message.delivery_attempt" semantic conventions.
+ // It represents the delivery attempt for a given message.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingGCPPubsubMessageDeliveryAttemptKey = attribute.Key("messaging.gcp_pubsub.message.delivery_attempt")
+
+ // MessagingGCPPubsubMessageOrderingKeyKey is the attribute Key conforming to
+ // the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It
+ // represents the ordering key for a given message. If the attribute is not
+ // present, the message does not have an ordering key.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: ordering_key
+ MessagingGCPPubsubMessageOrderingKeyKey = attribute.Key("messaging.gcp_pubsub.message.ordering_key")
+
+ // MessagingKafkaMessageKeyKey is the attribute Key conforming to the
+ // "messaging.kafka.message.key" semantic conventions. It represents the message
+ // keys in Kafka are used for grouping alike messages to ensure they're
+ // processed on the same partition. They differ from `messaging.message.id` in
+ // that they're not unique. If the key is `null`, the attribute MUST NOT be set.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myKey
+ // Note: If the key type is not string, it's string representation has to be
+ // supplied for the attribute. If the key has no unambiguous, canonical string
+ // form, don't include its value.
+ MessagingKafkaMessageKeyKey = attribute.Key("messaging.kafka.message.key")
+
+ // MessagingKafkaMessageTombstoneKey is the attribute Key conforming to the
+ // "messaging.kafka.message.tombstone" semantic conventions. It represents a
+ // boolean that is true if the message is a tombstone.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingKafkaMessageTombstoneKey = attribute.Key("messaging.kafka.message.tombstone")
+
+ // MessagingKafkaOffsetKey is the attribute Key conforming to the
+ // "messaging.kafka.offset" semantic conventions. It represents the offset of a
+ // record in the corresponding Kafka partition.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingKafkaOffsetKey = attribute.Key("messaging.kafka.offset")
+
+ // MessagingMessageBodySizeKey is the attribute Key conforming to the
+ // "messaging.message.body.size" semantic conventions. It represents the size of
+ // the message body in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Note: This can refer to both the compressed or uncompressed body size. If
+ // both sizes are known, the uncompressed
+ // body size should be used.
+ MessagingMessageBodySizeKey = attribute.Key("messaging.message.body.size")
+
+ // MessagingMessageConversationIDKey is the attribute Key conforming to the
+ // "messaging.message.conversation_id" semantic conventions. It represents the
+ // conversation ID identifying the conversation to which the message belongs,
+ // represented as a string. Sometimes called "Correlation ID".
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: MyConversationId
+ MessagingMessageConversationIDKey = attribute.Key("messaging.message.conversation_id")
+
+ // MessagingMessageEnvelopeSizeKey is the attribute Key conforming to the
+ // "messaging.message.envelope.size" semantic conventions. It represents the
+ // size of the message body and metadata in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Note: This can refer to both the compressed or uncompressed size. If both
+ // sizes are known, the uncompressed
+ // size should be used.
+ MessagingMessageEnvelopeSizeKey = attribute.Key("messaging.message.envelope.size")
+
+ // MessagingMessageIDKey is the attribute Key conforming to the
+ // "messaging.message.id" semantic conventions. It represents a value used by
+ // the messaging system as an identifier for the message, represented as a
+ // string.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 452a7c7c7c7048c2f887f61572b18fc2
+ MessagingMessageIDKey = attribute.Key("messaging.message.id")
+
+ // MessagingOperationNameKey is the attribute Key conforming to the
+ // "messaging.operation.name" semantic conventions. It represents the
+ // system-specific name of the messaging operation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ack", "nack", "send"
+ MessagingOperationNameKey = attribute.Key("messaging.operation.name")
+
+ // MessagingOperationTypeKey is the attribute Key conforming to the
+ // "messaging.operation.type" semantic conventions. It represents a string
+ // identifying the type of the messaging operation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: If a custom value is used, it MUST be of low cardinality.
+ MessagingOperationTypeKey = attribute.Key("messaging.operation.type")
+
+ // MessagingRabbitmqDestinationRoutingKeyKey is the attribute Key conforming to
+ // the "messaging.rabbitmq.destination.routing_key" semantic conventions. It
+ // represents the rabbitMQ message routing key.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myKey
+ MessagingRabbitmqDestinationRoutingKeyKey = attribute.Key("messaging.rabbitmq.destination.routing_key")
+
+ // MessagingRabbitmqMessageDeliveryTagKey is the attribute Key conforming to the
+ // "messaging.rabbitmq.message.delivery_tag" semantic conventions. It represents
+ // the rabbitMQ message delivery tag.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingRabbitmqMessageDeliveryTagKey = attribute.Key("messaging.rabbitmq.message.delivery_tag")
+
+ // MessagingRocketmqConsumptionModelKey is the attribute Key conforming to the
+ // "messaging.rocketmq.consumption_model" semantic conventions. It represents
+ // the model of message consumption. This only applies to consumer spans.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingRocketmqConsumptionModelKey = attribute.Key("messaging.rocketmq.consumption_model")
+
+ // MessagingRocketmqMessageDelayTimeLevelKey is the attribute Key conforming to
+ // the "messaging.rocketmq.message.delay_time_level" semantic conventions. It
+ // represents the delay time level for delay message, which determines the
+ // message delay time.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingRocketmqMessageDelayTimeLevelKey = attribute.Key("messaging.rocketmq.message.delay_time_level")
+
+ // MessagingRocketmqMessageDeliveryTimestampKey is the attribute Key conforming
+ // to the "messaging.rocketmq.message.delivery_timestamp" semantic conventions.
+ // It represents the timestamp in milliseconds that the delay message is
+ // expected to be delivered to consumer.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingRocketmqMessageDeliveryTimestampKey = attribute.Key("messaging.rocketmq.message.delivery_timestamp")
+
+ // MessagingRocketmqMessageGroupKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.group" semantic conventions. It represents the it
+ // is essential for FIFO message. Messages that belong to the same message group
+ // are always processed one by one within the same consumer group.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myMessageGroup
+ MessagingRocketmqMessageGroupKey = attribute.Key("messaging.rocketmq.message.group")
+
+ // MessagingRocketmqMessageKeysKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.keys" semantic conventions. It represents the
+ // key(s) of message, another way to mark message besides message id.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "keyA", "keyB"
+ MessagingRocketmqMessageKeysKey = attribute.Key("messaging.rocketmq.message.keys")
+
+ // MessagingRocketmqMessageTagKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.tag" semantic conventions. It represents the
+ // secondary classifier of message besides topic.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: tagA
+ MessagingRocketmqMessageTagKey = attribute.Key("messaging.rocketmq.message.tag")
+
+ // MessagingRocketmqMessageTypeKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.type" semantic conventions. It represents the
+ // type of message.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingRocketmqMessageTypeKey = attribute.Key("messaging.rocketmq.message.type")
+
+ // MessagingRocketmqNamespaceKey is the attribute Key conforming to the
+ // "messaging.rocketmq.namespace" semantic conventions. It represents the
+ // namespace of RocketMQ resources, resources in different namespaces are
+ // individual.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myNamespace
+ MessagingRocketmqNamespaceKey = attribute.Key("messaging.rocketmq.namespace")
+
+ // MessagingServicebusDispositionStatusKey is the attribute Key conforming to
+ // the "messaging.servicebus.disposition_status" semantic conventions. It
+ // represents the describes the [settlement type].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [settlement type]: https://learn.microsoft.com/azure/service-bus-messaging/message-transfers-locks-settlement#peeklock
+ MessagingServicebusDispositionStatusKey = attribute.Key("messaging.servicebus.disposition_status")
+
+ // MessagingServicebusMessageDeliveryCountKey is the attribute Key conforming to
+ // the "messaging.servicebus.message.delivery_count" semantic conventions. It
+ // represents the number of deliveries that have been attempted for this
+ // message.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingServicebusMessageDeliveryCountKey = attribute.Key("messaging.servicebus.message.delivery_count")
+
+ // MessagingServicebusMessageEnqueuedTimeKey is the attribute Key conforming to
+ // the "messaging.servicebus.message.enqueued_time" semantic conventions. It
+ // represents the UTC epoch seconds at which the message has been accepted and
+ // stored in the entity.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingServicebusMessageEnqueuedTimeKey = attribute.Key("messaging.servicebus.message.enqueued_time")
+
+ // MessagingSystemKey is the attribute Key conforming to the "messaging.system"
+ // semantic conventions. It represents the messaging system as identified by the
+ // client instrumentation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: The actual messaging system may differ from the one known by the
+ // client. For example, when using Kafka client libraries to communicate with
+ // Azure Event Hubs, the `messaging.system` is set to `kafka` based on the
+ // instrumentation's best knowledge.
+ MessagingSystemKey = attribute.Key("messaging.system")
+)
+
+// MessagingBatchMessageCount returns an attribute KeyValue conforming to the
+// "messaging.batch.message_count" semantic conventions. It represents the number
+// of messages sent, received, or processed in the scope of the batching
+// operation.
+func MessagingBatchMessageCount(val int) attribute.KeyValue {
+ return MessagingBatchMessageCountKey.Int(val)
+}
+
+// MessagingClientID returns an attribute KeyValue conforming to the
+// "messaging.client.id" semantic conventions. It represents a unique identifier
+// for the client that consumes or produces a message.
+func MessagingClientID(val string) attribute.KeyValue {
+ return MessagingClientIDKey.String(val)
+}
+
+// MessagingConsumerGroupName returns an attribute KeyValue conforming to the
+// "messaging.consumer.group.name" semantic conventions. It represents the name
+// of the consumer group with which a consumer is associated.
+func MessagingConsumerGroupName(val string) attribute.KeyValue {
+ return MessagingConsumerGroupNameKey.String(val)
+}
+
+// MessagingDestinationAnonymous returns an attribute KeyValue conforming to the
+// "messaging.destination.anonymous" semantic conventions. It represents a
+// boolean that is true if the message destination is anonymous (could be unnamed
+// or have auto-generated name).
+func MessagingDestinationAnonymous(val bool) attribute.KeyValue {
+ return MessagingDestinationAnonymousKey.Bool(val)
+}
+
+// MessagingDestinationName returns an attribute KeyValue conforming to the
+// "messaging.destination.name" semantic conventions. It represents the message
+// destination name.
+func MessagingDestinationName(val string) attribute.KeyValue {
+ return MessagingDestinationNameKey.String(val)
+}
+
+// MessagingDestinationPartitionID returns an attribute KeyValue conforming to
+// the "messaging.destination.partition.id" semantic conventions. It represents
+// the identifier of the partition messages are sent to or received from, unique
+// within the `messaging.destination.name`.
+func MessagingDestinationPartitionID(val string) attribute.KeyValue {
+ return MessagingDestinationPartitionIDKey.String(val)
+}
+
+// MessagingDestinationSubscriptionName returns an attribute KeyValue conforming
+// to the "messaging.destination.subscription.name" semantic conventions. It
+// represents the name of the destination subscription from which a message is
+// consumed.
+func MessagingDestinationSubscriptionName(val string) attribute.KeyValue {
+ return MessagingDestinationSubscriptionNameKey.String(val)
+}
+
+// MessagingDestinationTemplate returns an attribute KeyValue conforming to the
+// "messaging.destination.template" semantic conventions. It represents the low
+// cardinality representation of the messaging destination name.
+func MessagingDestinationTemplate(val string) attribute.KeyValue {
+ return MessagingDestinationTemplateKey.String(val)
+}
+
+// MessagingDestinationTemporary returns an attribute KeyValue conforming to the
+// "messaging.destination.temporary" semantic conventions. It represents a
+// boolean that is true if the message destination is temporary and might not
+// exist anymore after messages are processed.
+func MessagingDestinationTemporary(val bool) attribute.KeyValue {
+ return MessagingDestinationTemporaryKey.Bool(val)
+}
+
+// MessagingEventhubsMessageEnqueuedTime returns an attribute KeyValue conforming
+// to the "messaging.eventhubs.message.enqueued_time" semantic conventions. It
+// represents the UTC epoch seconds at which the message has been accepted and
+// stored in the entity.
+func MessagingEventhubsMessageEnqueuedTime(val int) attribute.KeyValue {
+ return MessagingEventhubsMessageEnqueuedTimeKey.Int(val)
+}
+
+// MessagingGCPPubsubMessageAckDeadline returns an attribute KeyValue conforming
+// to the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It
+// represents the ack deadline in seconds set for the modify ack deadline
+// request.
+func MessagingGCPPubsubMessageAckDeadline(val int) attribute.KeyValue {
+ return MessagingGCPPubsubMessageAckDeadlineKey.Int(val)
+}
+
+// MessagingGCPPubsubMessageAckID returns an attribute KeyValue conforming to the
+// "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the
+// ack id for a given message.
+func MessagingGCPPubsubMessageAckID(val string) attribute.KeyValue {
+ return MessagingGCPPubsubMessageAckIDKey.String(val)
+}
+
+// MessagingGCPPubsubMessageDeliveryAttempt returns an attribute KeyValue
+// conforming to the "messaging.gcp_pubsub.message.delivery_attempt" semantic
+// conventions. It represents the delivery attempt for a given message.
+func MessagingGCPPubsubMessageDeliveryAttempt(val int) attribute.KeyValue {
+ return MessagingGCPPubsubMessageDeliveryAttemptKey.Int(val)
+}
+
+// MessagingGCPPubsubMessageOrderingKey returns an attribute KeyValue conforming
+// to the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It
+// represents the ordering key for a given message. If the attribute is not
+// present, the message does not have an ordering key.
+func MessagingGCPPubsubMessageOrderingKey(val string) attribute.KeyValue {
+ return MessagingGCPPubsubMessageOrderingKeyKey.String(val)
+}
+
+// MessagingKafkaMessageKey returns an attribute KeyValue conforming to the
+// "messaging.kafka.message.key" semantic conventions. It represents the message
+// keys in Kafka are used for grouping alike messages to ensure they're processed
+// on the same partition. They differ from `messaging.message.id` in that they're
+// not unique. If the key is `null`, the attribute MUST NOT be set.
+func MessagingKafkaMessageKey(val string) attribute.KeyValue {
+ return MessagingKafkaMessageKeyKey.String(val)
+}
+
+// MessagingKafkaMessageTombstone returns an attribute KeyValue conforming to the
+// "messaging.kafka.message.tombstone" semantic conventions. It represents a
+// boolean that is true if the message is a tombstone.
+func MessagingKafkaMessageTombstone(val bool) attribute.KeyValue {
+ return MessagingKafkaMessageTombstoneKey.Bool(val)
+}
+
+// MessagingKafkaOffset returns an attribute KeyValue conforming to the
+// "messaging.kafka.offset" semantic conventions. It represents the offset of a
+// record in the corresponding Kafka partition.
+func MessagingKafkaOffset(val int) attribute.KeyValue {
+ return MessagingKafkaOffsetKey.Int(val)
+}
+
+// MessagingMessageBodySize returns an attribute KeyValue conforming to the
+// "messaging.message.body.size" semantic conventions. It represents the size of
+// the message body in bytes.
+func MessagingMessageBodySize(val int) attribute.KeyValue {
+ return MessagingMessageBodySizeKey.Int(val)
+}
+
+// MessagingMessageConversationID returns an attribute KeyValue conforming to the
+// "messaging.message.conversation_id" semantic conventions. It represents the
+// conversation ID identifying the conversation to which the message belongs,
+// represented as a string. Sometimes called "Correlation ID".
+func MessagingMessageConversationID(val string) attribute.KeyValue {
+ return MessagingMessageConversationIDKey.String(val)
+}
+
+// MessagingMessageEnvelopeSize returns an attribute KeyValue conforming to the
+// "messaging.message.envelope.size" semantic conventions. It represents the size
+// of the message body and metadata in bytes.
+func MessagingMessageEnvelopeSize(val int) attribute.KeyValue {
+ return MessagingMessageEnvelopeSizeKey.Int(val)
+}
+
+// MessagingMessageID returns an attribute KeyValue conforming to the
+// "messaging.message.id" semantic conventions. It represents a value used by the
+// messaging system as an identifier for the message, represented as a string.
+func MessagingMessageID(val string) attribute.KeyValue {
+ return MessagingMessageIDKey.String(val)
+}
+
+// MessagingOperationName returns an attribute KeyValue conforming to the
+// "messaging.operation.name" semantic conventions. It represents the
+// system-specific name of the messaging operation.
+func MessagingOperationName(val string) attribute.KeyValue {
+ return MessagingOperationNameKey.String(val)
+}
+
+// MessagingRabbitmqDestinationRoutingKey returns an attribute KeyValue
+// conforming to the "messaging.rabbitmq.destination.routing_key" semantic
+// conventions. It represents the rabbitMQ message routing key.
+func MessagingRabbitmqDestinationRoutingKey(val string) attribute.KeyValue {
+ return MessagingRabbitmqDestinationRoutingKeyKey.String(val)
+}
+
+// MessagingRabbitmqMessageDeliveryTag returns an attribute KeyValue conforming
+// to the "messaging.rabbitmq.message.delivery_tag" semantic conventions. It
+// represents the rabbitMQ message delivery tag.
+func MessagingRabbitmqMessageDeliveryTag(val int) attribute.KeyValue {
+ return MessagingRabbitmqMessageDeliveryTagKey.Int(val)
+}
+
+// MessagingRocketmqMessageDelayTimeLevel returns an attribute KeyValue
+// conforming to the "messaging.rocketmq.message.delay_time_level" semantic
+// conventions. It represents the delay time level for delay message, which
+// determines the message delay time.
+func MessagingRocketmqMessageDelayTimeLevel(val int) attribute.KeyValue {
+ return MessagingRocketmqMessageDelayTimeLevelKey.Int(val)
+}
+
+// MessagingRocketmqMessageDeliveryTimestamp returns an attribute KeyValue
+// conforming to the "messaging.rocketmq.message.delivery_timestamp" semantic
+// conventions. It represents the timestamp in milliseconds that the delay
+// message is expected to be delivered to consumer.
+func MessagingRocketmqMessageDeliveryTimestamp(val int) attribute.KeyValue {
+ return MessagingRocketmqMessageDeliveryTimestampKey.Int(val)
+}
+
+// MessagingRocketmqMessageGroup returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.message.group" semantic conventions. It represents the it
+// is essential for FIFO message. Messages that belong to the same message group
+// are always processed one by one within the same consumer group.
+func MessagingRocketmqMessageGroup(val string) attribute.KeyValue {
+ return MessagingRocketmqMessageGroupKey.String(val)
+}
+
+// MessagingRocketmqMessageKeys returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.message.keys" semantic conventions. It represents the
+// key(s) of message, another way to mark message besides message id.
+func MessagingRocketmqMessageKeys(val ...string) attribute.KeyValue {
+ return MessagingRocketmqMessageKeysKey.StringSlice(val)
+}
+
+// MessagingRocketmqMessageTag returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.message.tag" semantic conventions. It represents the
+// secondary classifier of message besides topic.
+func MessagingRocketmqMessageTag(val string) attribute.KeyValue {
+ return MessagingRocketmqMessageTagKey.String(val)
+}
+
+// MessagingRocketmqNamespace returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.namespace" semantic conventions. It represents the
+// namespace of RocketMQ resources, resources in different namespaces are
+// individual.
+func MessagingRocketmqNamespace(val string) attribute.KeyValue {
+ return MessagingRocketmqNamespaceKey.String(val)
+}
+
+// MessagingServicebusMessageDeliveryCount returns an attribute KeyValue
+// conforming to the "messaging.servicebus.message.delivery_count" semantic
+// conventions. It represents the number of deliveries that have been attempted
+// for this message.
+func MessagingServicebusMessageDeliveryCount(val int) attribute.KeyValue {
+ return MessagingServicebusMessageDeliveryCountKey.Int(val)
+}
+
+// MessagingServicebusMessageEnqueuedTime returns an attribute KeyValue
+// conforming to the "messaging.servicebus.message.enqueued_time" semantic
+// conventions. It represents the UTC epoch seconds at which the message has been
+// accepted and stored in the entity.
+func MessagingServicebusMessageEnqueuedTime(val int) attribute.KeyValue {
+ return MessagingServicebusMessageEnqueuedTimeKey.Int(val)
+}
+
+// Enum values for messaging.operation.type
+var (
+ // A message is created. "Create" spans always refer to a single message and are
+ // used to provide a unique creation context for messages in batch sending
+ // scenarios.
+ //
+ // Stability: development
+ MessagingOperationTypeCreate = MessagingOperationTypeKey.String("create")
+ // One or more messages are provided for sending to an intermediary. If a single
+ // message is sent, the context of the "Send" span can be used as the creation
+ // context and no "Create" span needs to be created.
+ //
+ // Stability: development
+ MessagingOperationTypeSend = MessagingOperationTypeKey.String("send")
+ // One or more messages are requested by a consumer. This operation refers to
+ // pull-based scenarios, where consumers explicitly call methods of messaging
+ // SDKs to receive messages.
+ //
+ // Stability: development
+ MessagingOperationTypeReceive = MessagingOperationTypeKey.String("receive")
+ // One or more messages are processed by a consumer.
+ //
+ // Stability: development
+ MessagingOperationTypeProcess = MessagingOperationTypeKey.String("process")
+ // One or more messages are settled.
+ //
+ // Stability: development
+ MessagingOperationTypeSettle = MessagingOperationTypeKey.String("settle")
+ // Deprecated: Replaced by `process`.
+ MessagingOperationTypeDeliver = MessagingOperationTypeKey.String("deliver")
+ // Deprecated: Replaced by `send`.
+ MessagingOperationTypePublish = MessagingOperationTypeKey.String("publish")
+)
+
+// Enum values for messaging.rocketmq.consumption_model
+var (
+ // Clustering consumption model
+ // Stability: development
+ MessagingRocketmqConsumptionModelClustering = MessagingRocketmqConsumptionModelKey.String("clustering")
+ // Broadcasting consumption model
+ // Stability: development
+ MessagingRocketmqConsumptionModelBroadcasting = MessagingRocketmqConsumptionModelKey.String("broadcasting")
+)
+
+// Enum values for messaging.rocketmq.message.type
+var (
+ // Normal message
+ // Stability: development
+ MessagingRocketmqMessageTypeNormal = MessagingRocketmqMessageTypeKey.String("normal")
+ // FIFO message
+ // Stability: development
+ MessagingRocketmqMessageTypeFifo = MessagingRocketmqMessageTypeKey.String("fifo")
+ // Delay message
+ // Stability: development
+ MessagingRocketmqMessageTypeDelay = MessagingRocketmqMessageTypeKey.String("delay")
+ // Transaction message
+ // Stability: development
+ MessagingRocketmqMessageTypeTransaction = MessagingRocketmqMessageTypeKey.String("transaction")
+)
+
+// Enum values for messaging.servicebus.disposition_status
+var (
+ // Message is completed
+ // Stability: development
+ MessagingServicebusDispositionStatusComplete = MessagingServicebusDispositionStatusKey.String("complete")
+ // Message is abandoned
+ // Stability: development
+ MessagingServicebusDispositionStatusAbandon = MessagingServicebusDispositionStatusKey.String("abandon")
+ // Message is sent to dead letter queue
+ // Stability: development
+ MessagingServicebusDispositionStatusDeadLetter = MessagingServicebusDispositionStatusKey.String("dead_letter")
+ // Message is deferred
+ // Stability: development
+ MessagingServicebusDispositionStatusDefer = MessagingServicebusDispositionStatusKey.String("defer")
+)
+
+// Enum values for messaging.system
+var (
+ // Apache ActiveMQ
+ // Stability: development
+ MessagingSystemActivemq = MessagingSystemKey.String("activemq")
+ // Amazon Simple Queue Service (SQS)
+ // Stability: development
+ MessagingSystemAWSSqs = MessagingSystemKey.String("aws_sqs")
+ // Azure Event Grid
+ // Stability: development
+ MessagingSystemEventgrid = MessagingSystemKey.String("eventgrid")
+ // Azure Event Hubs
+ // Stability: development
+ MessagingSystemEventhubs = MessagingSystemKey.String("eventhubs")
+ // Azure Service Bus
+ // Stability: development
+ MessagingSystemServicebus = MessagingSystemKey.String("servicebus")
+ // Google Cloud Pub/Sub
+ // Stability: development
+ MessagingSystemGCPPubsub = MessagingSystemKey.String("gcp_pubsub")
+ // Java Message Service
+ // Stability: development
+ MessagingSystemJms = MessagingSystemKey.String("jms")
+ // Apache Kafka
+ // Stability: development
+ MessagingSystemKafka = MessagingSystemKey.String("kafka")
+ // RabbitMQ
+ // Stability: development
+ MessagingSystemRabbitmq = MessagingSystemKey.String("rabbitmq")
+ // Apache RocketMQ
+ // Stability: development
+ MessagingSystemRocketmq = MessagingSystemKey.String("rocketmq")
+ // Apache Pulsar
+ // Stability: development
+ MessagingSystemPulsar = MessagingSystemKey.String("pulsar")
+)
+
+// Namespace: network
+const (
+ // NetworkCarrierIccKey is the attribute Key conforming to the
+ // "network.carrier.icc" semantic conventions. It represents the ISO 3166-1
+ // alpha-2 2-character country code associated with the mobile carrier network.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: DE
+ NetworkCarrierIccKey = attribute.Key("network.carrier.icc")
+
+ // NetworkCarrierMccKey is the attribute Key conforming to the
+ // "network.carrier.mcc" semantic conventions. It represents the mobile carrier
+ // country code.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 310
+ NetworkCarrierMccKey = attribute.Key("network.carrier.mcc")
+
+ // NetworkCarrierMncKey is the attribute Key conforming to the
+ // "network.carrier.mnc" semantic conventions. It represents the mobile carrier
+ // network code.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 001
+ NetworkCarrierMncKey = attribute.Key("network.carrier.mnc")
+
+ // NetworkCarrierNameKey is the attribute Key conforming to the
+ // "network.carrier.name" semantic conventions. It represents the name of the
+ // mobile carrier.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: sprint
+ NetworkCarrierNameKey = attribute.Key("network.carrier.name")
+
+ // NetworkConnectionStateKey is the attribute Key conforming to the
+ // "network.connection.state" semantic conventions. It represents the state of
+ // network connection.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "close_wait"
+ // Note: Connection states are defined as part of the [rfc9293]
+ //
+ // [rfc9293]: https://datatracker.ietf.org/doc/html/rfc9293#section-3.3.2
+ NetworkConnectionStateKey = attribute.Key("network.connection.state")
+
+ // NetworkConnectionSubtypeKey is the attribute Key conforming to the
+ // "network.connection.subtype" semantic conventions. It represents the this
+ // describes more details regarding the connection.type. It may be the type of
+ // cell technology connection, but it could be used for describing details about
+ // a wifi connection.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: LTE
+ NetworkConnectionSubtypeKey = attribute.Key("network.connection.subtype")
+
+ // NetworkConnectionTypeKey is the attribute Key conforming to the
+ // "network.connection.type" semantic conventions. It represents the internet
+ // connection type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: wifi
+ NetworkConnectionTypeKey = attribute.Key("network.connection.type")
+
+ // NetworkInterfaceNameKey is the attribute Key conforming to the
+ // "network.interface.name" semantic conventions. It represents the network
+ // interface name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "lo", "eth0"
+ NetworkInterfaceNameKey = attribute.Key("network.interface.name")
+
+ // NetworkIoDirectionKey is the attribute Key conforming to the
+ // "network.io.direction" semantic conventions. It represents the network IO
+ // operation direction.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "transmit"
+ NetworkIoDirectionKey = attribute.Key("network.io.direction")
+
+ // NetworkLocalAddressKey is the attribute Key conforming to the
+ // "network.local.address" semantic conventions. It represents the local address
+ // of the network connection - IP address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "10.1.2.80", "/tmp/my.sock"
+ NetworkLocalAddressKey = attribute.Key("network.local.address")
+
+ // NetworkLocalPortKey is the attribute Key conforming to the
+ // "network.local.port" semantic conventions. It represents the local port
+ // number of the network connection.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 65123
+ NetworkLocalPortKey = attribute.Key("network.local.port")
+
+ // NetworkPeerAddressKey is the attribute Key conforming to the
+ // "network.peer.address" semantic conventions. It represents the peer address
+ // of the network connection - IP address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "10.1.2.80", "/tmp/my.sock"
+ NetworkPeerAddressKey = attribute.Key("network.peer.address")
+
+ // NetworkPeerPortKey is the attribute Key conforming to the "network.peer.port"
+ // semantic conventions. It represents the peer port number of the network
+ // connection.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 65123
+ NetworkPeerPortKey = attribute.Key("network.peer.port")
+
+ // NetworkProtocolNameKey is the attribute Key conforming to the
+ // "network.protocol.name" semantic conventions. It represents the
+ // [OSI application layer] or non-OSI equivalent.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "amqp", "http", "mqtt"
+ // Note: The value SHOULD be normalized to lowercase.
+ //
+ // [OSI application layer]: https://wikipedia.org/wiki/Application_layer
+ NetworkProtocolNameKey = attribute.Key("network.protocol.name")
+
+ // NetworkProtocolVersionKey is the attribute Key conforming to the
+ // "network.protocol.version" semantic conventions. It represents the actual
+ // version of the protocol used for network communication.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "1.1", "2"
+ // Note: If protocol version is subject to negotiation (for example using [ALPN]
+ // ), this attribute SHOULD be set to the negotiated version. If the actual
+ // protocol version is not known, this attribute SHOULD NOT be set.
+ //
+ // [ALPN]: https://www.rfc-editor.org/rfc/rfc7301.html
+ NetworkProtocolVersionKey = attribute.Key("network.protocol.version")
+
+ // NetworkTransportKey is the attribute Key conforming to the
+ // "network.transport" semantic conventions. It represents the
+ // [OSI transport layer] or [inter-process communication method].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "tcp", "udp"
+ // Note: The value SHOULD be normalized to lowercase.
+ //
+ // Consider always setting the transport when setting a port number, since
+ // a port number is ambiguous without knowing the transport. For example
+ // different processes could be listening on TCP port 12345 and UDP port 12345.
+ //
+ // [OSI transport layer]: https://wikipedia.org/wiki/Transport_layer
+ // [inter-process communication method]: https://wikipedia.org/wiki/Inter-process_communication
+ NetworkTransportKey = attribute.Key("network.transport")
+
+ // NetworkTypeKey is the attribute Key conforming to the "network.type" semantic
+ // conventions. It represents the [OSI network layer] or non-OSI equivalent.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "ipv4", "ipv6"
+ // Note: The value SHOULD be normalized to lowercase.
+ //
+ // [OSI network layer]: https://wikipedia.org/wiki/Network_layer
+ NetworkTypeKey = attribute.Key("network.type")
+)
+
+// NetworkCarrierIcc returns an attribute KeyValue conforming to the
+// "network.carrier.icc" semantic conventions. It represents the ISO 3166-1
+// alpha-2 2-character country code associated with the mobile carrier network.
+func NetworkCarrierIcc(val string) attribute.KeyValue {
+ return NetworkCarrierIccKey.String(val)
+}
+
+// NetworkCarrierMcc returns an attribute KeyValue conforming to the
+// "network.carrier.mcc" semantic conventions. It represents the mobile carrier
+// country code.
+func NetworkCarrierMcc(val string) attribute.KeyValue {
+ return NetworkCarrierMccKey.String(val)
+}
+
+// NetworkCarrierMnc returns an attribute KeyValue conforming to the
+// "network.carrier.mnc" semantic conventions. It represents the mobile carrier
+// network code.
+func NetworkCarrierMnc(val string) attribute.KeyValue {
+ return NetworkCarrierMncKey.String(val)
+}
+
+// NetworkCarrierName returns an attribute KeyValue conforming to the
+// "network.carrier.name" semantic conventions. It represents the name of the
+// mobile carrier.
+func NetworkCarrierName(val string) attribute.KeyValue {
+ return NetworkCarrierNameKey.String(val)
+}
+
+// NetworkInterfaceName returns an attribute KeyValue conforming to the
+// "network.interface.name" semantic conventions. It represents the network
+// interface name.
+func NetworkInterfaceName(val string) attribute.KeyValue {
+ return NetworkInterfaceNameKey.String(val)
+}
+
+// NetworkLocalAddress returns an attribute KeyValue conforming to the
+// "network.local.address" semantic conventions. It represents the local address
+// of the network connection - IP address or Unix domain socket name.
+func NetworkLocalAddress(val string) attribute.KeyValue {
+ return NetworkLocalAddressKey.String(val)
+}
+
+// NetworkLocalPort returns an attribute KeyValue conforming to the
+// "network.local.port" semantic conventions. It represents the local port number
+// of the network connection.
+func NetworkLocalPort(val int) attribute.KeyValue {
+ return NetworkLocalPortKey.Int(val)
+}
+
+// NetworkPeerAddress returns an attribute KeyValue conforming to the
+// "network.peer.address" semantic conventions. It represents the peer address of
+// the network connection - IP address or Unix domain socket name.
+func NetworkPeerAddress(val string) attribute.KeyValue {
+ return NetworkPeerAddressKey.String(val)
+}
+
+// NetworkPeerPort returns an attribute KeyValue conforming to the
+// "network.peer.port" semantic conventions. It represents the peer port number
+// of the network connection.
+func NetworkPeerPort(val int) attribute.KeyValue {
+ return NetworkPeerPortKey.Int(val)
+}
+
+// NetworkProtocolName returns an attribute KeyValue conforming to the
+// "network.protocol.name" semantic conventions. It represents the
+// [OSI application layer] or non-OSI equivalent.
+//
+// [OSI application layer]: https://wikipedia.org/wiki/Application_layer
+func NetworkProtocolName(val string) attribute.KeyValue {
+ return NetworkProtocolNameKey.String(val)
+}
+
+// NetworkProtocolVersion returns an attribute KeyValue conforming to the
+// "network.protocol.version" semantic conventions. It represents the actual
+// version of the protocol used for network communication.
+func NetworkProtocolVersion(val string) attribute.KeyValue {
+ return NetworkProtocolVersionKey.String(val)
+}
+
+// Enum values for network.connection.state
+var (
+ // closed
+ // Stability: development
+ NetworkConnectionStateClosed = NetworkConnectionStateKey.String("closed")
+ // close_wait
+ // Stability: development
+ NetworkConnectionStateCloseWait = NetworkConnectionStateKey.String("close_wait")
+ // closing
+ // Stability: development
+ NetworkConnectionStateClosing = NetworkConnectionStateKey.String("closing")
+ // established
+ // Stability: development
+ NetworkConnectionStateEstablished = NetworkConnectionStateKey.String("established")
+ // fin_wait_1
+ // Stability: development
+ NetworkConnectionStateFinWait1 = NetworkConnectionStateKey.String("fin_wait_1")
+ // fin_wait_2
+ // Stability: development
+ NetworkConnectionStateFinWait2 = NetworkConnectionStateKey.String("fin_wait_2")
+ // last_ack
+ // Stability: development
+ NetworkConnectionStateLastAck = NetworkConnectionStateKey.String("last_ack")
+ // listen
+ // Stability: development
+ NetworkConnectionStateListen = NetworkConnectionStateKey.String("listen")
+ // syn_received
+ // Stability: development
+ NetworkConnectionStateSynReceived = NetworkConnectionStateKey.String("syn_received")
+ // syn_sent
+ // Stability: development
+ NetworkConnectionStateSynSent = NetworkConnectionStateKey.String("syn_sent")
+ // time_wait
+ // Stability: development
+ NetworkConnectionStateTimeWait = NetworkConnectionStateKey.String("time_wait")
+)
+
+// Enum values for network.connection.subtype
+var (
+ // GPRS
+ // Stability: development
+ NetworkConnectionSubtypeGprs = NetworkConnectionSubtypeKey.String("gprs")
+ // EDGE
+ // Stability: development
+ NetworkConnectionSubtypeEdge = NetworkConnectionSubtypeKey.String("edge")
+ // UMTS
+ // Stability: development
+ NetworkConnectionSubtypeUmts = NetworkConnectionSubtypeKey.String("umts")
+ // CDMA
+ // Stability: development
+ NetworkConnectionSubtypeCdma = NetworkConnectionSubtypeKey.String("cdma")
+ // EVDO Rel. 0
+ // Stability: development
+ NetworkConnectionSubtypeEvdo0 = NetworkConnectionSubtypeKey.String("evdo_0")
+ // EVDO Rev. A
+ // Stability: development
+ NetworkConnectionSubtypeEvdoA = NetworkConnectionSubtypeKey.String("evdo_a")
+ // CDMA2000 1XRTT
+ // Stability: development
+ NetworkConnectionSubtypeCdma20001xrtt = NetworkConnectionSubtypeKey.String("cdma2000_1xrtt")
+ // HSDPA
+ // Stability: development
+ NetworkConnectionSubtypeHsdpa = NetworkConnectionSubtypeKey.String("hsdpa")
+ // HSUPA
+ // Stability: development
+ NetworkConnectionSubtypeHsupa = NetworkConnectionSubtypeKey.String("hsupa")
+ // HSPA
+ // Stability: development
+ NetworkConnectionSubtypeHspa = NetworkConnectionSubtypeKey.String("hspa")
+ // IDEN
+ // Stability: development
+ NetworkConnectionSubtypeIden = NetworkConnectionSubtypeKey.String("iden")
+ // EVDO Rev. B
+ // Stability: development
+ NetworkConnectionSubtypeEvdoB = NetworkConnectionSubtypeKey.String("evdo_b")
+ // LTE
+ // Stability: development
+ NetworkConnectionSubtypeLte = NetworkConnectionSubtypeKey.String("lte")
+ // EHRPD
+ // Stability: development
+ NetworkConnectionSubtypeEhrpd = NetworkConnectionSubtypeKey.String("ehrpd")
+ // HSPAP
+ // Stability: development
+ NetworkConnectionSubtypeHspap = NetworkConnectionSubtypeKey.String("hspap")
+ // GSM
+ // Stability: development
+ NetworkConnectionSubtypeGsm = NetworkConnectionSubtypeKey.String("gsm")
+ // TD-SCDMA
+ // Stability: development
+ NetworkConnectionSubtypeTdScdma = NetworkConnectionSubtypeKey.String("td_scdma")
+ // IWLAN
+ // Stability: development
+ NetworkConnectionSubtypeIwlan = NetworkConnectionSubtypeKey.String("iwlan")
+ // 5G NR (New Radio)
+ // Stability: development
+ NetworkConnectionSubtypeNr = NetworkConnectionSubtypeKey.String("nr")
+ // 5G NRNSA (New Radio Non-Standalone)
+ // Stability: development
+ NetworkConnectionSubtypeNrnsa = NetworkConnectionSubtypeKey.String("nrnsa")
+ // LTE CA
+ // Stability: development
+ NetworkConnectionSubtypeLteCa = NetworkConnectionSubtypeKey.String("lte_ca")
+)
+
+// Enum values for network.connection.type
+var (
+ // wifi
+ // Stability: development
+ NetworkConnectionTypeWifi = NetworkConnectionTypeKey.String("wifi")
+ // wired
+ // Stability: development
+ NetworkConnectionTypeWired = NetworkConnectionTypeKey.String("wired")
+ // cell
+ // Stability: development
+ NetworkConnectionTypeCell = NetworkConnectionTypeKey.String("cell")
+ // unavailable
+ // Stability: development
+ NetworkConnectionTypeUnavailable = NetworkConnectionTypeKey.String("unavailable")
+ // unknown
+ // Stability: development
+ NetworkConnectionTypeUnknown = NetworkConnectionTypeKey.String("unknown")
+)
+
+// Enum values for network.io.direction
+var (
+ // transmit
+ // Stability: development
+ NetworkIoDirectionTransmit = NetworkIoDirectionKey.String("transmit")
+ // receive
+ // Stability: development
+ NetworkIoDirectionReceive = NetworkIoDirectionKey.String("receive")
+)
+
+// Enum values for network.transport
+var (
+ // TCP
+ // Stability: stable
+ NetworkTransportTCP = NetworkTransportKey.String("tcp")
+ // UDP
+ // Stability: stable
+ NetworkTransportUDP = NetworkTransportKey.String("udp")
+ // Named or anonymous pipe.
+ // Stability: stable
+ NetworkTransportPipe = NetworkTransportKey.String("pipe")
+ // Unix domain socket
+ // Stability: stable
+ NetworkTransportUnix = NetworkTransportKey.String("unix")
+ // QUIC
+ // Stability: development
+ NetworkTransportQUIC = NetworkTransportKey.String("quic")
+)
+
+// Enum values for network.type
+var (
+ // IPv4
+ // Stability: stable
+ NetworkTypeIpv4 = NetworkTypeKey.String("ipv4")
+ // IPv6
+ // Stability: stable
+ NetworkTypeIpv6 = NetworkTypeKey.String("ipv6")
+)
+
+// Namespace: oci
+const (
+ // OciManifestDigestKey is the attribute Key conforming to the
+ // "oci.manifest.digest" semantic conventions. It represents the digest of the
+ // OCI image manifest. For container images specifically is the digest by which
+ // the container image is known.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "sha256:e4ca62c0d62f3e886e684806dfe9d4e0cda60d54986898173c1083856cfda0f4"
+ // Note: Follows [OCI Image Manifest Specification], and specifically the
+ // [Digest property].
+ // An example can be found in [Example Image Manifest].
+ //
+ // [OCI Image Manifest Specification]: https://github.com/opencontainers/image-spec/blob/main/manifest.md
+ // [Digest property]: https://github.com/opencontainers/image-spec/blob/main/descriptor.md#digests
+ // [Example Image Manifest]: https://docs.docker.com/registry/spec/manifest-v2-2/#example-image-manifest
+ OciManifestDigestKey = attribute.Key("oci.manifest.digest")
+)
+
+// OciManifestDigest returns an attribute KeyValue conforming to the
+// "oci.manifest.digest" semantic conventions. It represents the digest of the
+// OCI image manifest. For container images specifically is the digest by which
+// the container image is known.
+func OciManifestDigest(val string) attribute.KeyValue {
+ return OciManifestDigestKey.String(val)
+}
+
+// Namespace: opentracing
+const (
+ // OpentracingRefTypeKey is the attribute Key conforming to the
+ // "opentracing.ref_type" semantic conventions. It represents the parent-child
+ // Reference type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: The causal relationship between a child Span and a parent Span.
+ OpentracingRefTypeKey = attribute.Key("opentracing.ref_type")
+)
+
+// Enum values for opentracing.ref_type
+var (
+ // The parent Span depends on the child Span in some capacity
+ // Stability: development
+ OpentracingRefTypeChildOf = OpentracingRefTypeKey.String("child_of")
+ // The parent Span doesn't depend in any way on the result of the child Span
+ // Stability: development
+ OpentracingRefTypeFollowsFrom = OpentracingRefTypeKey.String("follows_from")
+)
+
+// Namespace: os
+const (
+ // OSBuildIDKey is the attribute Key conforming to the "os.build_id" semantic
+ // conventions. It represents the unique identifier for a particular build or
+ // compilation of the operating system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TQ3C.230805.001.B2", "20E247", "22621"
+ OSBuildIDKey = attribute.Key("os.build_id")
+
+ // OSDescriptionKey is the attribute Key conforming to the "os.description"
+ // semantic conventions. It represents the human readable (not intended to be
+ // parsed) OS version information, like e.g. reported by `ver` or
+ // `lsb_release -a` commands.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Microsoft Windows [Version 10.0.18363.778]", "Ubuntu 18.04.1 LTS"
+ OSDescriptionKey = attribute.Key("os.description")
+
+ // OSNameKey is the attribute Key conforming to the "os.name" semantic
+ // conventions. It represents the human readable operating system name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "iOS", "Android", "Ubuntu"
+ OSNameKey = attribute.Key("os.name")
+
+ // OSTypeKey is the attribute Key conforming to the "os.type" semantic
+ // conventions. It represents the operating system type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ OSTypeKey = attribute.Key("os.type")
+
+ // OSVersionKey is the attribute Key conforming to the "os.version" semantic
+ // conventions. It represents the version string of the operating system as
+ // defined in [Version Attributes].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "14.2.1", "18.04.1"
+ //
+ // [Version Attributes]: /docs/resource/README.md#version-attributes
+ OSVersionKey = attribute.Key("os.version")
+)
+
+// OSBuildID returns an attribute KeyValue conforming to the "os.build_id"
+// semantic conventions. It represents the unique identifier for a particular
+// build or compilation of the operating system.
+func OSBuildID(val string) attribute.KeyValue {
+ return OSBuildIDKey.String(val)
+}
+
+// OSDescription returns an attribute KeyValue conforming to the "os.description"
+// semantic conventions. It represents the human readable (not intended to be
+// parsed) OS version information, like e.g. reported by `ver` or
+// `lsb_release -a` commands.
+func OSDescription(val string) attribute.KeyValue {
+ return OSDescriptionKey.String(val)
+}
+
+// OSName returns an attribute KeyValue conforming to the "os.name" semantic
+// conventions. It represents the human readable operating system name.
+func OSName(val string) attribute.KeyValue {
+ return OSNameKey.String(val)
+}
+
+// OSVersion returns an attribute KeyValue conforming to the "os.version"
+// semantic conventions. It represents the version string of the operating system
+// as defined in [Version Attributes].
+//
+// [Version Attributes]: /docs/resource/README.md#version-attributes
+func OSVersion(val string) attribute.KeyValue {
+ return OSVersionKey.String(val)
+}
+
+// Enum values for os.type
+var (
+ // Microsoft Windows
+ // Stability: development
+ OSTypeWindows = OSTypeKey.String("windows")
+ // Linux
+ // Stability: development
+ OSTypeLinux = OSTypeKey.String("linux")
+ // Apple Darwin
+ // Stability: development
+ OSTypeDarwin = OSTypeKey.String("darwin")
+ // FreeBSD
+ // Stability: development
+ OSTypeFreeBSD = OSTypeKey.String("freebsd")
+ // NetBSD
+ // Stability: development
+ OSTypeNetBSD = OSTypeKey.String("netbsd")
+ // OpenBSD
+ // Stability: development
+ OSTypeOpenBSD = OSTypeKey.String("openbsd")
+ // DragonFly BSD
+ // Stability: development
+ OSTypeDragonflyBSD = OSTypeKey.String("dragonflybsd")
+ // HP-UX (Hewlett Packard Unix)
+ // Stability: development
+ OSTypeHPUX = OSTypeKey.String("hpux")
+ // AIX (Advanced Interactive eXecutive)
+ // Stability: development
+ OSTypeAIX = OSTypeKey.String("aix")
+ // SunOS, Oracle Solaris
+ // Stability: development
+ OSTypeSolaris = OSTypeKey.String("solaris")
+ // IBM z/OS
+ // Stability: development
+ OSTypeZOS = OSTypeKey.String("z_os")
+)
+
+// Namespace: otel
+const (
+ // OTelScopeNameKey is the attribute Key conforming to the "otel.scope.name"
+ // semantic conventions. It represents the name of the instrumentation scope - (
+ // `InstrumentationScope.Name` in OTLP).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "io.opentelemetry.contrib.mongodb"
+ OTelScopeNameKey = attribute.Key("otel.scope.name")
+
+ // OTelScopeVersionKey is the attribute Key conforming to the
+ // "otel.scope.version" semantic conventions. It represents the version of the
+ // instrumentation scope - (`InstrumentationScope.Version` in OTLP).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "1.0.0"
+ OTelScopeVersionKey = attribute.Key("otel.scope.version")
+
+ // OTelStatusCodeKey is the attribute Key conforming to the "otel.status_code"
+ // semantic conventions. It represents the name of the code, either "OK" or
+ // "ERROR". MUST NOT be set if the status code is UNSET.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples:
+ OTelStatusCodeKey = attribute.Key("otel.status_code")
+
+ // OTelStatusDescriptionKey is the attribute Key conforming to the
+ // "otel.status_description" semantic conventions. It represents the description
+ // of the Status if it has a value, otherwise not set.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "resource not found"
+ OTelStatusDescriptionKey = attribute.Key("otel.status_description")
+)
+
+// OTelScopeName returns an attribute KeyValue conforming to the
+// "otel.scope.name" semantic conventions. It represents the name of the
+// instrumentation scope - (`InstrumentationScope.Name` in OTLP).
+func OTelScopeName(val string) attribute.KeyValue {
+ return OTelScopeNameKey.String(val)
+}
+
+// OTelScopeVersion returns an attribute KeyValue conforming to the
+// "otel.scope.version" semantic conventions. It represents the version of the
+// instrumentation scope - (`InstrumentationScope.Version` in OTLP).
+func OTelScopeVersion(val string) attribute.KeyValue {
+ return OTelScopeVersionKey.String(val)
+}
+
+// OTelStatusDescription returns an attribute KeyValue conforming to the
+// "otel.status_description" semantic conventions. It represents the description
+// of the Status if it has a value, otherwise not set.
+func OTelStatusDescription(val string) attribute.KeyValue {
+ return OTelStatusDescriptionKey.String(val)
+}
+
+// Enum values for otel.status_code
+var (
+ // The operation has been validated by an Application developer or Operator to
+ // have completed successfully.
+ // Stability: stable
+ OTelStatusCodeOk = OTelStatusCodeKey.String("OK")
+ // The operation contains an error.
+ // Stability: stable
+ OTelStatusCodeError = OTelStatusCodeKey.String("ERROR")
+)
+
+// Namespace: peer
+const (
+ // PeerServiceKey is the attribute Key conforming to the "peer.service" semantic
+ // conventions. It represents the [`service.name`] of the remote service. SHOULD
+ // be equal to the actual `service.name` resource attribute of the remote
+ // service if any.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: AuthTokenCache
+ //
+ // [`service.name`]: /docs/resource/README.md#service
+ PeerServiceKey = attribute.Key("peer.service")
+)
+
+// PeerService returns an attribute KeyValue conforming to the "peer.service"
+// semantic conventions. It represents the [`service.name`] of the remote
+// service. SHOULD be equal to the actual `service.name` resource attribute of
+// the remote service if any.
+//
+// [`service.name`]: /docs/resource/README.md#service
+func PeerService(val string) attribute.KeyValue {
+ return PeerServiceKey.String(val)
+}
+
+// Namespace: process
+const (
+ // ProcessArgsCountKey is the attribute Key conforming to the
+ // "process.args_count" semantic conventions. It represents the length of the
+ // process.command_args array.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 4
+ // Note: This field can be useful for querying or performing bucket analysis on
+ // how many arguments were provided to start a process. More arguments may be an
+ // indication of suspicious activity.
+ ProcessArgsCountKey = attribute.Key("process.args_count")
+
+ // ProcessCommandKey is the attribute Key conforming to the "process.command"
+ // semantic conventions. It represents the command used to launch the process
+ // (i.e. the command name). On Linux based systems, can be set to the zeroth
+ // string in `proc/[pid]/cmdline`. On Windows, can be set to the first parameter
+ // extracted from `GetCommandLineW`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cmd/otelcol"
+ ProcessCommandKey = attribute.Key("process.command")
+
+ // ProcessCommandArgsKey is the attribute Key conforming to the
+ // "process.command_args" semantic conventions. It represents the all the
+ // command arguments (including the command/executable itself) as received by
+ // the process. On Linux-based systems (and some other Unixoid systems
+ // supporting procfs), can be set according to the list of null-delimited
+ // strings extracted from `proc/[pid]/cmdline`. For libc-based executables, this
+ // would be the full argv vector passed to `main`.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cmd/otecol", "--config=config.yaml"
+ ProcessCommandArgsKey = attribute.Key("process.command_args")
+
+ // ProcessCommandLineKey is the attribute Key conforming to the
+ // "process.command_line" semantic conventions. It represents the full command
+ // used to launch the process as a single string representing the full command.
+ // On Windows, can be set to the result of `GetCommandLineW`. Do not set this if
+ // you have to assemble it just for monitoring; use `process.command_args`
+ // instead.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "C:\cmd\otecol --config="my directory\config.yaml""
+ ProcessCommandLineKey = attribute.Key("process.command_line")
+
+ // ProcessContextSwitchTypeKey is the attribute Key conforming to the
+ // "process.context_switch_type" semantic conventions. It represents the
+ // specifies whether the context switches for this data point were voluntary or
+ // involuntary.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ ProcessContextSwitchTypeKey = attribute.Key("process.context_switch_type")
+
+ // ProcessCreationTimeKey is the attribute Key conforming to the
+ // "process.creation.time" semantic conventions. It represents the date and time
+ // the process was created, in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2023-11-21T09:25:34.853Z"
+ ProcessCreationTimeKey = attribute.Key("process.creation.time")
+
+ // ProcessExecutableBuildIDGnuKey is the attribute Key conforming to the
+ // "process.executable.build_id.gnu" semantic conventions. It represents the GNU
+ // build ID as found in the `.note.gnu.build-id` ELF section (hex string).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "c89b11207f6479603b0d49bf291c092c2b719293"
+ ProcessExecutableBuildIDGnuKey = attribute.Key("process.executable.build_id.gnu")
+
+ // ProcessExecutableBuildIDGoKey is the attribute Key conforming to the
+ // "process.executable.build_id.go" semantic conventions. It represents the Go
+ // build ID as retrieved by `go tool buildid `.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "foh3mEXu7BLZjsN9pOwG/kATcXlYVCDEFouRMQed_/WwRFB1hPo9LBkekthSPG/x8hMC8emW2cCjXD0_1aY"
+ ProcessExecutableBuildIDGoKey = attribute.Key("process.executable.build_id.go")
+
+ // ProcessExecutableBuildIDHtlhashKey is the attribute Key conforming to the
+ // "process.executable.build_id.htlhash" semantic conventions. It represents the
+ // profiling specific build ID for executables. See the OTel specification for
+ // Profiles for more information.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "600DCAFE4A110000F2BF38C493F5FB92"
+ ProcessExecutableBuildIDHtlhashKey = attribute.Key("process.executable.build_id.htlhash")
+
+ // ProcessExecutableNameKey is the attribute Key conforming to the
+ // "process.executable.name" semantic conventions. It represents the name of the
+ // process executable. On Linux based systems, can be set to the `Name` in
+ // `proc/[pid]/status`. On Windows, can be set to the base name of
+ // `GetProcessImageFileNameW`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcol"
+ ProcessExecutableNameKey = attribute.Key("process.executable.name")
+
+ // ProcessExecutablePathKey is the attribute Key conforming to the
+ // "process.executable.path" semantic conventions. It represents the full path
+ // to the process executable. On Linux based systems, can be set to the target
+ // of `proc/[pid]/exe`. On Windows, can be set to the result of
+ // `GetProcessImageFileNameW`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/usr/bin/cmd/otelcol"
+ ProcessExecutablePathKey = attribute.Key("process.executable.path")
+
+ // ProcessExitCodeKey is the attribute Key conforming to the "process.exit.code"
+ // semantic conventions. It represents the exit code of the process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 127
+ ProcessExitCodeKey = attribute.Key("process.exit.code")
+
+ // ProcessExitTimeKey is the attribute Key conforming to the "process.exit.time"
+ // semantic conventions. It represents the date and time the process exited, in
+ // ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2023-11-21T09:26:12.315Z"
+ ProcessExitTimeKey = attribute.Key("process.exit.time")
+
+ // ProcessGroupLeaderPIDKey is the attribute Key conforming to the
+ // "process.group_leader.pid" semantic conventions. It represents the PID of the
+ // process's group leader. This is also the process group ID (PGID) of the
+ // process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 23
+ ProcessGroupLeaderPIDKey = attribute.Key("process.group_leader.pid")
+
+ // ProcessInteractiveKey is the attribute Key conforming to the
+ // "process.interactive" semantic conventions. It represents the whether the
+ // process is connected to an interactive shell.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ ProcessInteractiveKey = attribute.Key("process.interactive")
+
+ // ProcessLinuxCgroupKey is the attribute Key conforming to the
+ // "process.linux.cgroup" semantic conventions. It represents the control group
+ // associated with the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1:name=systemd:/user.slice/user-1000.slice/session-3.scope",
+ // "0::/user.slice/user-1000.slice/user@1000.service/tmux-spawn-0267755b-4639-4a27-90ed-f19f88e53748.scope"
+ // Note: Control groups (cgroups) are a kernel feature used to organize and
+ // manage process resources. This attribute provides the path(s) to the
+ // cgroup(s) associated with the process, which should match the contents of the
+ // [/proc/[PID]/cgroup] file.
+ //
+ // [/proc/[PID]/cgroup]: https://man7.org/linux/man-pages/man7/cgroups.7.html
+ ProcessLinuxCgroupKey = attribute.Key("process.linux.cgroup")
+
+ // ProcessOwnerKey is the attribute Key conforming to the "process.owner"
+ // semantic conventions. It represents the username of the user that owns the
+ // process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "root"
+ ProcessOwnerKey = attribute.Key("process.owner")
+
+ // ProcessPagingFaultTypeKey is the attribute Key conforming to the
+ // "process.paging.fault_type" semantic conventions. It represents the type of
+ // page fault for this data point. Type `major` is for major/hard page faults,
+ // and `minor` is for minor/soft page faults.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ ProcessPagingFaultTypeKey = attribute.Key("process.paging.fault_type")
+
+ // ProcessParentPIDKey is the attribute Key conforming to the
+ // "process.parent_pid" semantic conventions. It represents the parent Process
+ // identifier (PPID).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 111
+ ProcessParentPIDKey = attribute.Key("process.parent_pid")
+
+ // ProcessPIDKey is the attribute Key conforming to the "process.pid" semantic
+ // conventions. It represents the process identifier (PID).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1234
+ ProcessPIDKey = attribute.Key("process.pid")
+
+ // ProcessRealUserIDKey is the attribute Key conforming to the
+ // "process.real_user.id" semantic conventions. It represents the real user ID
+ // (RUID) of the process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1000
+ ProcessRealUserIDKey = attribute.Key("process.real_user.id")
+
+ // ProcessRealUserNameKey is the attribute Key conforming to the
+ // "process.real_user.name" semantic conventions. It represents the username of
+ // the real user of the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "operator"
+ ProcessRealUserNameKey = attribute.Key("process.real_user.name")
+
+ // ProcessRuntimeDescriptionKey is the attribute Key conforming to the
+ // "process.runtime.description" semantic conventions. It represents an
+ // additional description about the runtime of the process, for example a
+ // specific vendor customization of the runtime environment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: Eclipse OpenJ9 Eclipse OpenJ9 VM openj9-0.21.0
+ ProcessRuntimeDescriptionKey = attribute.Key("process.runtime.description")
+
+ // ProcessRuntimeNameKey is the attribute Key conforming to the
+ // "process.runtime.name" semantic conventions. It represents the name of the
+ // runtime of this process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "OpenJDK Runtime Environment"
+ ProcessRuntimeNameKey = attribute.Key("process.runtime.name")
+
+ // ProcessRuntimeVersionKey is the attribute Key conforming to the
+ // "process.runtime.version" semantic conventions. It represents the version of
+ // the runtime of this process, as returned by the runtime without modification.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 14.0.2
+ ProcessRuntimeVersionKey = attribute.Key("process.runtime.version")
+
+ // ProcessSavedUserIDKey is the attribute Key conforming to the
+ // "process.saved_user.id" semantic conventions. It represents the saved user ID
+ // (SUID) of the process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1002
+ ProcessSavedUserIDKey = attribute.Key("process.saved_user.id")
+
+ // ProcessSavedUserNameKey is the attribute Key conforming to the
+ // "process.saved_user.name" semantic conventions. It represents the username of
+ // the saved user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "operator"
+ ProcessSavedUserNameKey = attribute.Key("process.saved_user.name")
+
+ // ProcessSessionLeaderPIDKey is the attribute Key conforming to the
+ // "process.session_leader.pid" semantic conventions. It represents the PID of
+ // the process's session leader. This is also the session ID (SID) of the
+ // process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 14
+ ProcessSessionLeaderPIDKey = attribute.Key("process.session_leader.pid")
+
+ // ProcessTitleKey is the attribute Key conforming to the "process.title"
+ // semantic conventions. It represents the process title (proctitle).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cat /etc/hostname", "xfce4-session", "bash"
+ // Note: In many Unix-like systems, process title (proctitle), is the string
+ // that represents the name or command line of a running process, displayed by
+ // system monitoring tools like ps, top, and htop.
+ ProcessTitleKey = attribute.Key("process.title")
+
+ // ProcessUserIDKey is the attribute Key conforming to the "process.user.id"
+ // semantic conventions. It represents the effective user ID (EUID) of the
+ // process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1001
+ ProcessUserIDKey = attribute.Key("process.user.id")
+
+ // ProcessUserNameKey is the attribute Key conforming to the "process.user.name"
+ // semantic conventions. It represents the username of the effective user of the
+ // process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "root"
+ ProcessUserNameKey = attribute.Key("process.user.name")
+
+ // ProcessVpidKey is the attribute Key conforming to the "process.vpid" semantic
+ // conventions. It represents the virtual process identifier.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 12
+ // Note: The process ID within a PID namespace. This is not necessarily unique
+ // across all processes on the host but it is unique within the process
+ // namespace that the process exists within.
+ ProcessVpidKey = attribute.Key("process.vpid")
+
+ // ProcessWorkingDirectoryKey is the attribute Key conforming to the
+ // "process.working_directory" semantic conventions. It represents the working
+ // directory of the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/root"
+ ProcessWorkingDirectoryKey = attribute.Key("process.working_directory")
+)
+
+// ProcessArgsCount returns an attribute KeyValue conforming to the
+// "process.args_count" semantic conventions. It represents the length of the
+// process.command_args array.
+func ProcessArgsCount(val int) attribute.KeyValue {
+ return ProcessArgsCountKey.Int(val)
+}
+
+// ProcessCommand returns an attribute KeyValue conforming to the
+// "process.command" semantic conventions. It represents the command used to
+// launch the process (i.e. the command name). On Linux based systems, can be set
+// to the zeroth string in `proc/[pid]/cmdline`. On Windows, can be set to the
+// first parameter extracted from `GetCommandLineW`.
+func ProcessCommand(val string) attribute.KeyValue {
+ return ProcessCommandKey.String(val)
+}
+
+// ProcessCommandArgs returns an attribute KeyValue conforming to the
+// "process.command_args" semantic conventions. It represents the all the command
+// arguments (including the command/executable itself) as received by the
+// process. On Linux-based systems (and some other Unixoid systems supporting
+// procfs), can be set according to the list of null-delimited strings extracted
+// from `proc/[pid]/cmdline`. For libc-based executables, this would be the full
+// argv vector passed to `main`.
+func ProcessCommandArgs(val ...string) attribute.KeyValue {
+ return ProcessCommandArgsKey.StringSlice(val)
+}
+
+// ProcessCommandLine returns an attribute KeyValue conforming to the
+// "process.command_line" semantic conventions. It represents the full command
+// used to launch the process as a single string representing the full command.
+// On Windows, can be set to the result of `GetCommandLineW`. Do not set this if
+// you have to assemble it just for monitoring; use `process.command_args`
+// instead.
+func ProcessCommandLine(val string) attribute.KeyValue {
+ return ProcessCommandLineKey.String(val)
+}
+
+// ProcessCreationTime returns an attribute KeyValue conforming to the
+// "process.creation.time" semantic conventions. It represents the date and time
+// the process was created, in ISO 8601 format.
+func ProcessCreationTime(val string) attribute.KeyValue {
+ return ProcessCreationTimeKey.String(val)
+}
+
+// ProcessExecutableBuildIDGnu returns an attribute KeyValue conforming to the
+// "process.executable.build_id.gnu" semantic conventions. It represents the GNU
+// build ID as found in the `.note.gnu.build-id` ELF section (hex string).
+func ProcessExecutableBuildIDGnu(val string) attribute.KeyValue {
+ return ProcessExecutableBuildIDGnuKey.String(val)
+}
+
+// ProcessExecutableBuildIDGo returns an attribute KeyValue conforming to the
+// "process.executable.build_id.go" semantic conventions. It represents the Go
+// build ID as retrieved by `go tool buildid `.
+func ProcessExecutableBuildIDGo(val string) attribute.KeyValue {
+ return ProcessExecutableBuildIDGoKey.String(val)
+}
+
+// ProcessExecutableBuildIDHtlhash returns an attribute KeyValue conforming to
+// the "process.executable.build_id.htlhash" semantic conventions. It represents
+// the profiling specific build ID for executables. See the OTel specification
+// for Profiles for more information.
+func ProcessExecutableBuildIDHtlhash(val string) attribute.KeyValue {
+ return ProcessExecutableBuildIDHtlhashKey.String(val)
+}
+
+// ProcessExecutableName returns an attribute KeyValue conforming to the
+// "process.executable.name" semantic conventions. It represents the name of the
+// process executable. On Linux based systems, can be set to the `Name` in
+// `proc/[pid]/status`. On Windows, can be set to the base name of
+// `GetProcessImageFileNameW`.
+func ProcessExecutableName(val string) attribute.KeyValue {
+ return ProcessExecutableNameKey.String(val)
+}
+
+// ProcessExecutablePath returns an attribute KeyValue conforming to the
+// "process.executable.path" semantic conventions. It represents the full path to
+// the process executable. On Linux based systems, can be set to the target of
+// `proc/[pid]/exe`. On Windows, can be set to the result of
+// `GetProcessImageFileNameW`.
+func ProcessExecutablePath(val string) attribute.KeyValue {
+ return ProcessExecutablePathKey.String(val)
+}
+
+// ProcessExitCode returns an attribute KeyValue conforming to the
+// "process.exit.code" semantic conventions. It represents the exit code of the
+// process.
+func ProcessExitCode(val int) attribute.KeyValue {
+ return ProcessExitCodeKey.Int(val)
+}
+
+// ProcessExitTime returns an attribute KeyValue conforming to the
+// "process.exit.time" semantic conventions. It represents the date and time the
+// process exited, in ISO 8601 format.
+func ProcessExitTime(val string) attribute.KeyValue {
+ return ProcessExitTimeKey.String(val)
+}
+
+// ProcessGroupLeaderPID returns an attribute KeyValue conforming to the
+// "process.group_leader.pid" semantic conventions. It represents the PID of the
+// process's group leader. This is also the process group ID (PGID) of the
+// process.
+func ProcessGroupLeaderPID(val int) attribute.KeyValue {
+ return ProcessGroupLeaderPIDKey.Int(val)
+}
+
+// ProcessInteractive returns an attribute KeyValue conforming to the
+// "process.interactive" semantic conventions. It represents the whether the
+// process is connected to an interactive shell.
+func ProcessInteractive(val bool) attribute.KeyValue {
+ return ProcessInteractiveKey.Bool(val)
+}
+
+// ProcessLinuxCgroup returns an attribute KeyValue conforming to the
+// "process.linux.cgroup" semantic conventions. It represents the control group
+// associated with the process.
+func ProcessLinuxCgroup(val string) attribute.KeyValue {
+ return ProcessLinuxCgroupKey.String(val)
+}
+
+// ProcessOwner returns an attribute KeyValue conforming to the "process.owner"
+// semantic conventions. It represents the username of the user that owns the
+// process.
+func ProcessOwner(val string) attribute.KeyValue {
+ return ProcessOwnerKey.String(val)
+}
+
+// ProcessParentPID returns an attribute KeyValue conforming to the
+// "process.parent_pid" semantic conventions. It represents the parent Process
+// identifier (PPID).
+func ProcessParentPID(val int) attribute.KeyValue {
+ return ProcessParentPIDKey.Int(val)
+}
+
+// ProcessPID returns an attribute KeyValue conforming to the "process.pid"
+// semantic conventions. It represents the process identifier (PID).
+func ProcessPID(val int) attribute.KeyValue {
+ return ProcessPIDKey.Int(val)
+}
+
+// ProcessRealUserID returns an attribute KeyValue conforming to the
+// "process.real_user.id" semantic conventions. It represents the real user ID
+// (RUID) of the process.
+func ProcessRealUserID(val int) attribute.KeyValue {
+ return ProcessRealUserIDKey.Int(val)
+}
+
+// ProcessRealUserName returns an attribute KeyValue conforming to the
+// "process.real_user.name" semantic conventions. It represents the username of
+// the real user of the process.
+func ProcessRealUserName(val string) attribute.KeyValue {
+ return ProcessRealUserNameKey.String(val)
+}
+
+// ProcessRuntimeDescription returns an attribute KeyValue conforming to the
+// "process.runtime.description" semantic conventions. It represents an
+// additional description about the runtime of the process, for example a
+// specific vendor customization of the runtime environment.
+func ProcessRuntimeDescription(val string) attribute.KeyValue {
+ return ProcessRuntimeDescriptionKey.String(val)
+}
+
+// ProcessRuntimeName returns an attribute KeyValue conforming to the
+// "process.runtime.name" semantic conventions. It represents the name of the
+// runtime of this process.
+func ProcessRuntimeName(val string) attribute.KeyValue {
+ return ProcessRuntimeNameKey.String(val)
+}
+
+// ProcessRuntimeVersion returns an attribute KeyValue conforming to the
+// "process.runtime.version" semantic conventions. It represents the version of
+// the runtime of this process, as returned by the runtime without modification.
+func ProcessRuntimeVersion(val string) attribute.KeyValue {
+ return ProcessRuntimeVersionKey.String(val)
+}
+
+// ProcessSavedUserID returns an attribute KeyValue conforming to the
+// "process.saved_user.id" semantic conventions. It represents the saved user ID
+// (SUID) of the process.
+func ProcessSavedUserID(val int) attribute.KeyValue {
+ return ProcessSavedUserIDKey.Int(val)
+}
+
+// ProcessSavedUserName returns an attribute KeyValue conforming to the
+// "process.saved_user.name" semantic conventions. It represents the username of
+// the saved user.
+func ProcessSavedUserName(val string) attribute.KeyValue {
+ return ProcessSavedUserNameKey.String(val)
+}
+
+// ProcessSessionLeaderPID returns an attribute KeyValue conforming to the
+// "process.session_leader.pid" semantic conventions. It represents the PID of
+// the process's session leader. This is also the session ID (SID) of the
+// process.
+func ProcessSessionLeaderPID(val int) attribute.KeyValue {
+ return ProcessSessionLeaderPIDKey.Int(val)
+}
+
+// ProcessTitle returns an attribute KeyValue conforming to the "process.title"
+// semantic conventions. It represents the process title (proctitle).
+func ProcessTitle(val string) attribute.KeyValue {
+ return ProcessTitleKey.String(val)
+}
+
+// ProcessUserID returns an attribute KeyValue conforming to the
+// "process.user.id" semantic conventions. It represents the effective user ID
+// (EUID) of the process.
+func ProcessUserID(val int) attribute.KeyValue {
+ return ProcessUserIDKey.Int(val)
+}
+
+// ProcessUserName returns an attribute KeyValue conforming to the
+// "process.user.name" semantic conventions. It represents the username of the
+// effective user of the process.
+func ProcessUserName(val string) attribute.KeyValue {
+ return ProcessUserNameKey.String(val)
+}
+
+// ProcessVpid returns an attribute KeyValue conforming to the "process.vpid"
+// semantic conventions. It represents the virtual process identifier.
+func ProcessVpid(val int) attribute.KeyValue {
+ return ProcessVpidKey.Int(val)
+}
+
+// ProcessWorkingDirectory returns an attribute KeyValue conforming to the
+// "process.working_directory" semantic conventions. It represents the working
+// directory of the process.
+func ProcessWorkingDirectory(val string) attribute.KeyValue {
+ return ProcessWorkingDirectoryKey.String(val)
+}
+
+// Enum values for process.context_switch_type
+var (
+ // voluntary
+ // Stability: development
+ ProcessContextSwitchTypeVoluntary = ProcessContextSwitchTypeKey.String("voluntary")
+ // involuntary
+ // Stability: development
+ ProcessContextSwitchTypeInvoluntary = ProcessContextSwitchTypeKey.String("involuntary")
+)
+
+// Enum values for process.paging.fault_type
+var (
+ // major
+ // Stability: development
+ ProcessPagingFaultTypeMajor = ProcessPagingFaultTypeKey.String("major")
+ // minor
+ // Stability: development
+ ProcessPagingFaultTypeMinor = ProcessPagingFaultTypeKey.String("minor")
+)
+
+// Namespace: profile
+const (
+ // ProfileFrameTypeKey is the attribute Key conforming to the
+ // "profile.frame.type" semantic conventions. It represents the describes the
+ // interpreter or compiler of a single frame.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cpython"
+ ProfileFrameTypeKey = attribute.Key("profile.frame.type")
+)
+
+// Enum values for profile.frame.type
+var (
+ // [.NET]
+ //
+ // Stability: development
+ //
+ // [.NET]: https://wikipedia.org/wiki/.NET
+ ProfileFrameTypeDotnet = ProfileFrameTypeKey.String("dotnet")
+ // [JVM]
+ //
+ // Stability: development
+ //
+ // [JVM]: https://wikipedia.org/wiki/Java_virtual_machine
+ ProfileFrameTypeJVM = ProfileFrameTypeKey.String("jvm")
+ // [Kernel]
+ //
+ // Stability: development
+ //
+ // [Kernel]: https://wikipedia.org/wiki/Kernel_(operating_system)
+ ProfileFrameTypeKernel = ProfileFrameTypeKey.String("kernel")
+ // [C], [C++], [Go], [Rust]
+ //
+ // Stability: development
+ //
+ // [C]: https://wikipedia.org/wiki/C_(programming_language)
+ // [C++]: https://wikipedia.org/wiki/C%2B%2B
+ // [Go]: https://wikipedia.org/wiki/Go_(programming_language)
+ // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language)
+ ProfileFrameTypeNative = ProfileFrameTypeKey.String("native")
+ // [Perl]
+ //
+ // Stability: development
+ //
+ // [Perl]: https://wikipedia.org/wiki/Perl
+ ProfileFrameTypePerl = ProfileFrameTypeKey.String("perl")
+ // [PHP]
+ //
+ // Stability: development
+ //
+ // [PHP]: https://wikipedia.org/wiki/PHP
+ ProfileFrameTypePHP = ProfileFrameTypeKey.String("php")
+ // [Python]
+ //
+ // Stability: development
+ //
+ // [Python]: https://wikipedia.org/wiki/Python_(programming_language)
+ ProfileFrameTypeCpython = ProfileFrameTypeKey.String("cpython")
+ // [Ruby]
+ //
+ // Stability: development
+ //
+ // [Ruby]: https://wikipedia.org/wiki/Ruby_(programming_language)
+ ProfileFrameTypeRuby = ProfileFrameTypeKey.String("ruby")
+ // [V8JS]
+ //
+ // Stability: development
+ //
+ // [V8JS]: https://wikipedia.org/wiki/V8_(JavaScript_engine)
+ ProfileFrameTypeV8JS = ProfileFrameTypeKey.String("v8js")
+ // [Erlang]
+ //
+ // Stability: development
+ //
+ // [Erlang]: https://en.wikipedia.org/wiki/BEAM_(Erlang_virtual_machine)
+ ProfileFrameTypeBeam = ProfileFrameTypeKey.String("beam")
+)
+
+// Namespace: rpc
+const (
+ // RPCConnectRPCErrorCodeKey is the attribute Key conforming to the
+ // "rpc.connect_rpc.error_code" semantic conventions. It represents the
+ // [error codes] of the Connect request. Error codes are always string values.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [error codes]: https://connect.build/docs/protocol/#error-codes
+ RPCConnectRPCErrorCodeKey = attribute.Key("rpc.connect_rpc.error_code")
+
+ // RPCGRPCStatusCodeKey is the attribute Key conforming to the
+ // "rpc.grpc.status_code" semantic conventions. It represents the
+ // [numeric status code] of the gRPC request.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [numeric status code]: https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md
+ RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code")
+
+ // RPCJsonrpcErrorCodeKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code`
+ // property of response if it is an error response.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: -32700, 100
+ RPCJsonrpcErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code")
+
+ // RPCJsonrpcErrorMessageKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.error_message" semantic conventions. It represents the
+ // `error.message` property of response if it is an error response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Parse error", "User already exists"
+ RPCJsonrpcErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message")
+
+ // RPCJsonrpcRequestIDKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id`
+ // property of request or response. Since protocol allows id to be int, string,
+ // `null` or missing (for notifications), value is expected to be cast to string
+ // for simplicity. Use empty string in case of `null` value. Omit entirely if
+ // this is a notification.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "10", "request-7", ""
+ RPCJsonrpcRequestIDKey = attribute.Key("rpc.jsonrpc.request_id")
+
+ // RPCJsonrpcVersionKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.version" semantic conventions. It represents the protocol
+ // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0
+ // doesn't specify this, the value can be omitted.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2.0", "1.0"
+ RPCJsonrpcVersionKey = attribute.Key("rpc.jsonrpc.version")
+
+ // RPCMessageCompressedSizeKey is the attribute Key conforming to the
+ // "rpc.message.compressed_size" semantic conventions. It represents the
+ // compressed size of the message in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCMessageCompressedSizeKey = attribute.Key("rpc.message.compressed_size")
+
+ // RPCMessageIDKey is the attribute Key conforming to the "rpc.message.id"
+ // semantic conventions. It represents the mUST be calculated as two different
+ // counters starting from `1` one for sent messages and one for received
+ // message.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: This way we guarantee that the values will be consistent between
+ // different implementations.
+ RPCMessageIDKey = attribute.Key("rpc.message.id")
+
+ // RPCMessageTypeKey is the attribute Key conforming to the "rpc.message.type"
+ // semantic conventions. It represents the whether this is a received or sent
+ // message.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCMessageTypeKey = attribute.Key("rpc.message.type")
+
+ // RPCMessageUncompressedSizeKey is the attribute Key conforming to the
+ // "rpc.message.uncompressed_size" semantic conventions. It represents the
+ // uncompressed size of the message in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCMessageUncompressedSizeKey = attribute.Key("rpc.message.uncompressed_size")
+
+ // RPCMethodKey is the attribute Key conforming to the "rpc.method" semantic
+ // conventions. It represents the name of the (logical) method being called,
+ // must be equal to the $method part in the span name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: exampleMethod
+ // Note: This is the logical name of the method from the RPC interface
+ // perspective, which can be different from the name of any implementing
+ // method/function. The `code.function.name` attribute may be used to store the
+ // latter (e.g., method actually executing the call on the server side, RPC
+ // client stub method on the client side).
+ RPCMethodKey = attribute.Key("rpc.method")
+
+ // RPCServiceKey is the attribute Key conforming to the "rpc.service" semantic
+ // conventions. It represents the full (logical) name of the service being
+ // called, including its package name, if applicable.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myservice.EchoService
+ // Note: This is the logical name of the service from the RPC interface
+ // perspective, which can be different from the name of any implementing class.
+ // The `code.namespace` attribute may be used to store the latter (despite the
+ // attribute name, it may include a class name; e.g., class with method actually
+ // executing the call on the server side, RPC client stub class on the client
+ // side).
+ RPCServiceKey = attribute.Key("rpc.service")
+
+ // RPCSystemKey is the attribute Key conforming to the "rpc.system" semantic
+ // conventions. It represents a string identifying the remoting system. See
+ // below for a list of well-known identifiers.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCSystemKey = attribute.Key("rpc.system")
+)
+
+// RPCJsonrpcErrorCode returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code`
+// property of response if it is an error response.
+func RPCJsonrpcErrorCode(val int) attribute.KeyValue {
+ return RPCJsonrpcErrorCodeKey.Int(val)
+}
+
+// RPCJsonrpcErrorMessage returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.error_message" semantic conventions. It represents the
+// `error.message` property of response if it is an error response.
+func RPCJsonrpcErrorMessage(val string) attribute.KeyValue {
+ return RPCJsonrpcErrorMessageKey.String(val)
+}
+
+// RPCJsonrpcRequestID returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` property
+// of request or response. Since protocol allows id to be int, string, `null` or
+// missing (for notifications), value is expected to be cast to string for
+// simplicity. Use empty string in case of `null` value. Omit entirely if this is
+// a notification.
+func RPCJsonrpcRequestID(val string) attribute.KeyValue {
+ return RPCJsonrpcRequestIDKey.String(val)
+}
+
+// RPCJsonrpcVersion returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.version" semantic conventions. It represents the protocol version
+// as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 doesn't
+// specify this, the value can be omitted.
+func RPCJsonrpcVersion(val string) attribute.KeyValue {
+ return RPCJsonrpcVersionKey.String(val)
+}
+
+// RPCMessageCompressedSize returns an attribute KeyValue conforming to the
+// "rpc.message.compressed_size" semantic conventions. It represents the
+// compressed size of the message in bytes.
+func RPCMessageCompressedSize(val int) attribute.KeyValue {
+ return RPCMessageCompressedSizeKey.Int(val)
+}
+
+// RPCMessageID returns an attribute KeyValue conforming to the "rpc.message.id"
+// semantic conventions. It represents the mUST be calculated as two different
+// counters starting from `1` one for sent messages and one for received message.
+func RPCMessageID(val int) attribute.KeyValue {
+ return RPCMessageIDKey.Int(val)
+}
+
+// RPCMessageUncompressedSize returns an attribute KeyValue conforming to the
+// "rpc.message.uncompressed_size" semantic conventions. It represents the
+// uncompressed size of the message in bytes.
+func RPCMessageUncompressedSize(val int) attribute.KeyValue {
+ return RPCMessageUncompressedSizeKey.Int(val)
+}
+
+// RPCMethod returns an attribute KeyValue conforming to the "rpc.method"
+// semantic conventions. It represents the name of the (logical) method being
+// called, must be equal to the $method part in the span name.
+func RPCMethod(val string) attribute.KeyValue {
+ return RPCMethodKey.String(val)
+}
+
+// RPCService returns an attribute KeyValue conforming to the "rpc.service"
+// semantic conventions. It represents the full (logical) name of the service
+// being called, including its package name, if applicable.
+func RPCService(val string) attribute.KeyValue {
+ return RPCServiceKey.String(val)
+}
+
+// Enum values for rpc.connect_rpc.error_code
+var (
+ // cancelled
+ // Stability: development
+ RPCConnectRPCErrorCodeCancelled = RPCConnectRPCErrorCodeKey.String("cancelled")
+ // unknown
+ // Stability: development
+ RPCConnectRPCErrorCodeUnknown = RPCConnectRPCErrorCodeKey.String("unknown")
+ // invalid_argument
+ // Stability: development
+ RPCConnectRPCErrorCodeInvalidArgument = RPCConnectRPCErrorCodeKey.String("invalid_argument")
+ // deadline_exceeded
+ // Stability: development
+ RPCConnectRPCErrorCodeDeadlineExceeded = RPCConnectRPCErrorCodeKey.String("deadline_exceeded")
+ // not_found
+ // Stability: development
+ RPCConnectRPCErrorCodeNotFound = RPCConnectRPCErrorCodeKey.String("not_found")
+ // already_exists
+ // Stability: development
+ RPCConnectRPCErrorCodeAlreadyExists = RPCConnectRPCErrorCodeKey.String("already_exists")
+ // permission_denied
+ // Stability: development
+ RPCConnectRPCErrorCodePermissionDenied = RPCConnectRPCErrorCodeKey.String("permission_denied")
+ // resource_exhausted
+ // Stability: development
+ RPCConnectRPCErrorCodeResourceExhausted = RPCConnectRPCErrorCodeKey.String("resource_exhausted")
+ // failed_precondition
+ // Stability: development
+ RPCConnectRPCErrorCodeFailedPrecondition = RPCConnectRPCErrorCodeKey.String("failed_precondition")
+ // aborted
+ // Stability: development
+ RPCConnectRPCErrorCodeAborted = RPCConnectRPCErrorCodeKey.String("aborted")
+ // out_of_range
+ // Stability: development
+ RPCConnectRPCErrorCodeOutOfRange = RPCConnectRPCErrorCodeKey.String("out_of_range")
+ // unimplemented
+ // Stability: development
+ RPCConnectRPCErrorCodeUnimplemented = RPCConnectRPCErrorCodeKey.String("unimplemented")
+ // internal
+ // Stability: development
+ RPCConnectRPCErrorCodeInternal = RPCConnectRPCErrorCodeKey.String("internal")
+ // unavailable
+ // Stability: development
+ RPCConnectRPCErrorCodeUnavailable = RPCConnectRPCErrorCodeKey.String("unavailable")
+ // data_loss
+ // Stability: development
+ RPCConnectRPCErrorCodeDataLoss = RPCConnectRPCErrorCodeKey.String("data_loss")
+ // unauthenticated
+ // Stability: development
+ RPCConnectRPCErrorCodeUnauthenticated = RPCConnectRPCErrorCodeKey.String("unauthenticated")
+)
+
+// Enum values for rpc.grpc.status_code
+var (
+ // OK
+ // Stability: development
+ RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0)
+ // CANCELLED
+ // Stability: development
+ RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1)
+ // UNKNOWN
+ // Stability: development
+ RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2)
+ // INVALID_ARGUMENT
+ // Stability: development
+ RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3)
+ // DEADLINE_EXCEEDED
+ // Stability: development
+ RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4)
+ // NOT_FOUND
+ // Stability: development
+ RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5)
+ // ALREADY_EXISTS
+ // Stability: development
+ RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6)
+ // PERMISSION_DENIED
+ // Stability: development
+ RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7)
+ // RESOURCE_EXHAUSTED
+ // Stability: development
+ RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8)
+ // FAILED_PRECONDITION
+ // Stability: development
+ RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9)
+ // ABORTED
+ // Stability: development
+ RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10)
+ // OUT_OF_RANGE
+ // Stability: development
+ RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11)
+ // UNIMPLEMENTED
+ // Stability: development
+ RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12)
+ // INTERNAL
+ // Stability: development
+ RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13)
+ // UNAVAILABLE
+ // Stability: development
+ RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14)
+ // DATA_LOSS
+ // Stability: development
+ RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15)
+ // UNAUTHENTICATED
+ // Stability: development
+ RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16)
+)
+
+// Enum values for rpc.message.type
+var (
+ // sent
+ // Stability: development
+ RPCMessageTypeSent = RPCMessageTypeKey.String("SENT")
+ // received
+ // Stability: development
+ RPCMessageTypeReceived = RPCMessageTypeKey.String("RECEIVED")
+)
+
+// Enum values for rpc.system
+var (
+ // gRPC
+ // Stability: development
+ RPCSystemGRPC = RPCSystemKey.String("grpc")
+ // Java RMI
+ // Stability: development
+ RPCSystemJavaRmi = RPCSystemKey.String("java_rmi")
+ // .NET WCF
+ // Stability: development
+ RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf")
+ // Apache Dubbo
+ // Stability: development
+ RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo")
+ // Connect RPC
+ // Stability: development
+ RPCSystemConnectRPC = RPCSystemKey.String("connect_rpc")
+)
+
+// Namespace: security_rule
+const (
+ // SecurityRuleCategoryKey is the attribute Key conforming to the
+ // "security_rule.category" semantic conventions. It represents a categorization
+ // value keyword used by the entity using the rule for detection of this event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Attempted Information Leak"
+ SecurityRuleCategoryKey = attribute.Key("security_rule.category")
+
+ // SecurityRuleDescriptionKey is the attribute Key conforming to the
+ // "security_rule.description" semantic conventions. It represents the
+ // description of the rule generating the event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Block requests to public DNS over HTTPS / TLS protocols"
+ SecurityRuleDescriptionKey = attribute.Key("security_rule.description")
+
+ // SecurityRuleLicenseKey is the attribute Key conforming to the
+ // "security_rule.license" semantic conventions. It represents the name of the
+ // license under which the rule used to generate this event is made available.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Apache 2.0"
+ SecurityRuleLicenseKey = attribute.Key("security_rule.license")
+
+ // SecurityRuleNameKey is the attribute Key conforming to the
+ // "security_rule.name" semantic conventions. It represents the name of the rule
+ // or signature generating the event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "BLOCK_DNS_over_TLS"
+ SecurityRuleNameKey = attribute.Key("security_rule.name")
+
+ // SecurityRuleReferenceKey is the attribute Key conforming to the
+ // "security_rule.reference" semantic conventions. It represents the reference
+ // URL to additional information about the rule used to generate this event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://en.wikipedia.org/wiki/DNS_over_TLS"
+ // Note: The URL can point to the vendor’s documentation about the rule. If
+ // that’s not available, it can also be a link to a more general page
+ // describing this type of alert.
+ SecurityRuleReferenceKey = attribute.Key("security_rule.reference")
+
+ // SecurityRuleRulesetNameKey is the attribute Key conforming to the
+ // "security_rule.ruleset.name" semantic conventions. It represents the name of
+ // the ruleset, policy, group, or parent category in which the rule used to
+ // generate this event is a member.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Standard_Protocol_Filters"
+ SecurityRuleRulesetNameKey = attribute.Key("security_rule.ruleset.name")
+
+ // SecurityRuleUUIDKey is the attribute Key conforming to the
+ // "security_rule.uuid" semantic conventions. It represents a rule ID that is
+ // unique within the scope of a set or group of agents, observers, or other
+ // entities using the rule for detection of this event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "550e8400-e29b-41d4-a716-446655440000", "1100110011"
+ SecurityRuleUUIDKey = attribute.Key("security_rule.uuid")
+
+ // SecurityRuleVersionKey is the attribute Key conforming to the
+ // "security_rule.version" semantic conventions. It represents the version /
+ // revision of the rule being used for analysis.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1.0.0"
+ SecurityRuleVersionKey = attribute.Key("security_rule.version")
+)
+
+// SecurityRuleCategory returns an attribute KeyValue conforming to the
+// "security_rule.category" semantic conventions. It represents a categorization
+// value keyword used by the entity using the rule for detection of this event.
+func SecurityRuleCategory(val string) attribute.KeyValue {
+ return SecurityRuleCategoryKey.String(val)
+}
+
+// SecurityRuleDescription returns an attribute KeyValue conforming to the
+// "security_rule.description" semantic conventions. It represents the
+// description of the rule generating the event.
+func SecurityRuleDescription(val string) attribute.KeyValue {
+ return SecurityRuleDescriptionKey.String(val)
+}
+
+// SecurityRuleLicense returns an attribute KeyValue conforming to the
+// "security_rule.license" semantic conventions. It represents the name of the
+// license under which the rule used to generate this event is made available.
+func SecurityRuleLicense(val string) attribute.KeyValue {
+ return SecurityRuleLicenseKey.String(val)
+}
+
+// SecurityRuleName returns an attribute KeyValue conforming to the
+// "security_rule.name" semantic conventions. It represents the name of the rule
+// or signature generating the event.
+func SecurityRuleName(val string) attribute.KeyValue {
+ return SecurityRuleNameKey.String(val)
+}
+
+// SecurityRuleReference returns an attribute KeyValue conforming to the
+// "security_rule.reference" semantic conventions. It represents the reference
+// URL to additional information about the rule used to generate this event.
+func SecurityRuleReference(val string) attribute.KeyValue {
+ return SecurityRuleReferenceKey.String(val)
+}
+
+// SecurityRuleRulesetName returns an attribute KeyValue conforming to the
+// "security_rule.ruleset.name" semantic conventions. It represents the name of
+// the ruleset, policy, group, or parent category in which the rule used to
+// generate this event is a member.
+func SecurityRuleRulesetName(val string) attribute.KeyValue {
+ return SecurityRuleRulesetNameKey.String(val)
+}
+
+// SecurityRuleUUID returns an attribute KeyValue conforming to the
+// "security_rule.uuid" semantic conventions. It represents a rule ID that is
+// unique within the scope of a set or group of agents, observers, or other
+// entities using the rule for detection of this event.
+func SecurityRuleUUID(val string) attribute.KeyValue {
+ return SecurityRuleUUIDKey.String(val)
+}
+
+// SecurityRuleVersion returns an attribute KeyValue conforming to the
+// "security_rule.version" semantic conventions. It represents the version /
+// revision of the rule being used for analysis.
+func SecurityRuleVersion(val string) attribute.KeyValue {
+ return SecurityRuleVersionKey.String(val)
+}
+
+// Namespace: server
+const (
+ // ServerAddressKey is the attribute Key conforming to the "server.address"
+ // semantic conventions. It represents the server domain name if available
+ // without reverse DNS lookup; otherwise, IP address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the client side, and when communicating through an
+ // intermediary, `server.address` SHOULD represent the server address behind any
+ // intermediaries, for example proxies, if it's available.
+ ServerAddressKey = attribute.Key("server.address")
+
+ // ServerPortKey is the attribute Key conforming to the "server.port" semantic
+ // conventions. It represents the server port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 80, 8080, 443
+ // Note: When observed from the client side, and when communicating through an
+ // intermediary, `server.port` SHOULD represent the server port behind any
+ // intermediaries, for example proxies, if it's available.
+ ServerPortKey = attribute.Key("server.port")
+)
+
+// ServerAddress returns an attribute KeyValue conforming to the "server.address"
+// semantic conventions. It represents the server domain name if available
+// without reverse DNS lookup; otherwise, IP address or Unix domain socket name.
+func ServerAddress(val string) attribute.KeyValue {
+ return ServerAddressKey.String(val)
+}
+
+// ServerPort returns an attribute KeyValue conforming to the "server.port"
+// semantic conventions. It represents the server port number.
+func ServerPort(val int) attribute.KeyValue {
+ return ServerPortKey.Int(val)
+}
+
+// Namespace: service
+const (
+ // ServiceInstanceIDKey is the attribute Key conforming to the
+ // "service.instance.id" semantic conventions. It represents the string ID of
+ // the service instance.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "627cc493-f310-47de-96bd-71410b7dec09"
+ // Note: MUST be unique for each instance of the same
+ // `service.namespace,service.name` pair (in other words
+ // `service.namespace,service.name,service.instance.id` triplet MUST be globally
+ // unique). The ID helps to
+ // distinguish instances of the same service that exist at the same time (e.g.
+ // instances of a horizontally scaled
+ // service).
+ //
+ // Implementations, such as SDKs, are recommended to generate a random Version 1
+ // or Version 4 [RFC
+ // 4122] UUID, but are free to use an inherent unique ID as
+ // the source of
+ // this value if stability is desirable. In that case, the ID SHOULD be used as
+ // source of a UUID Version 5 and
+ // SHOULD use the following UUID as the namespace:
+ // `4d63009a-8d0f-11ee-aad7-4c796ed8e320`.
+ //
+ // UUIDs are typically recommended, as only an opaque value for the purposes of
+ // identifying a service instance is
+ // needed. Similar to what can be seen in the man page for the
+ // [`/etc/machine-id`] file, the underlying
+ // data, such as pod name and namespace should be treated as confidential, being
+ // the user's choice to expose it
+ // or not via another resource attribute.
+ //
+ // For applications running behind an application server (like unicorn), we do
+ // not recommend using one identifier
+ // for all processes participating in the application. Instead, it's recommended
+ // each division (e.g. a worker
+ // thread in unicorn) to have its own instance.id.
+ //
+ // It's not recommended for a Collector to set `service.instance.id` if it can't
+ // unambiguously determine the
+ // service instance that is generating that telemetry. For instance, creating an
+ // UUID based on `pod.name` will
+ // likely be wrong, as the Collector might not know from which container within
+ // that pod the telemetry originated.
+ // However, Collectors can set the `service.instance.id` if they can
+ // unambiguously determine the service instance
+ // for that telemetry. This is typically the case for scraping receivers, as
+ // they know the target address and
+ // port.
+ //
+ // [RFC
+ // 4122]: https://www.ietf.org/rfc/rfc4122.txt
+ // [`/etc/machine-id`]: https://www.freedesktop.org/software/systemd/man/latest/machine-id.html
+ ServiceInstanceIDKey = attribute.Key("service.instance.id")
+
+ // ServiceNameKey is the attribute Key conforming to the "service.name" semantic
+ // conventions. It represents the logical name of the service.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "shoppingcart"
+ // Note: MUST be the same for all instances of horizontally scaled services. If
+ // the value was not specified, SDKs MUST fallback to `unknown_service:`
+ // concatenated with [`process.executable.name`], e.g. `unknown_service:bash`.
+ // If `process.executable.name` is not available, the value MUST be set to
+ // `unknown_service`.
+ //
+ // [`process.executable.name`]: process.md
+ ServiceNameKey = attribute.Key("service.name")
+
+ // ServiceNamespaceKey is the attribute Key conforming to the
+ // "service.namespace" semantic conventions. It represents a namespace for
+ // `service.name`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Shop"
+ // Note: A string value having a meaning that helps to distinguish a group of
+ // services, for example the team name that owns a group of services.
+ // `service.name` is expected to be unique within the same namespace. If
+ // `service.namespace` is not specified in the Resource then `service.name` is
+ // expected to be unique for all services that have no explicit namespace
+ // defined (so the empty/unspecified namespace is simply one more valid
+ // namespace). Zero-length namespace string is assumed equal to unspecified
+ // namespace.
+ ServiceNamespaceKey = attribute.Key("service.namespace")
+
+ // ServiceVersionKey is the attribute Key conforming to the "service.version"
+ // semantic conventions. It represents the version string of the service API or
+ // implementation. The format is not defined by these conventions.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "2.0.0", "a01dbef8a"
+ ServiceVersionKey = attribute.Key("service.version")
+)
+
+// ServiceInstanceID returns an attribute KeyValue conforming to the
+// "service.instance.id" semantic conventions. It represents the string ID of the
+// service instance.
+func ServiceInstanceID(val string) attribute.KeyValue {
+ return ServiceInstanceIDKey.String(val)
+}
+
+// ServiceName returns an attribute KeyValue conforming to the "service.name"
+// semantic conventions. It represents the logical name of the service.
+func ServiceName(val string) attribute.KeyValue {
+ return ServiceNameKey.String(val)
+}
+
+// ServiceNamespace returns an attribute KeyValue conforming to the
+// "service.namespace" semantic conventions. It represents a namespace for
+// `service.name`.
+func ServiceNamespace(val string) attribute.KeyValue {
+ return ServiceNamespaceKey.String(val)
+}
+
+// ServiceVersion returns an attribute KeyValue conforming to the
+// "service.version" semantic conventions. It represents the version string of
+// the service API or implementation. The format is not defined by these
+// conventions.
+func ServiceVersion(val string) attribute.KeyValue {
+ return ServiceVersionKey.String(val)
+}
+
+// Namespace: session
+const (
+ // SessionIDKey is the attribute Key conforming to the "session.id" semantic
+ // conventions. It represents a unique id to identify a session.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 00112233-4455-6677-8899-aabbccddeeff
+ SessionIDKey = attribute.Key("session.id")
+
+ // SessionPreviousIDKey is the attribute Key conforming to the
+ // "session.previous_id" semantic conventions. It represents the previous
+ // `session.id` for this user, when known.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 00112233-4455-6677-8899-aabbccddeeff
+ SessionPreviousIDKey = attribute.Key("session.previous_id")
+)
+
+// SessionID returns an attribute KeyValue conforming to the "session.id"
+// semantic conventions. It represents a unique id to identify a session.
+func SessionID(val string) attribute.KeyValue {
+ return SessionIDKey.String(val)
+}
+
+// SessionPreviousID returns an attribute KeyValue conforming to the
+// "session.previous_id" semantic conventions. It represents the previous
+// `session.id` for this user, when known.
+func SessionPreviousID(val string) attribute.KeyValue {
+ return SessionPreviousIDKey.String(val)
+}
+
+// Namespace: signalr
+const (
+ // SignalrConnectionStatusKey is the attribute Key conforming to the
+ // "signalr.connection.status" semantic conventions. It represents the signalR
+ // HTTP connection closure status.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "app_shutdown", "timeout"
+ SignalrConnectionStatusKey = attribute.Key("signalr.connection.status")
+
+ // SignalrTransportKey is the attribute Key conforming to the
+ // "signalr.transport" semantic conventions. It represents the
+ // [SignalR transport type].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "web_sockets", "long_polling"
+ //
+ // [SignalR transport type]: https://github.com/dotnet/aspnetcore/blob/main/src/SignalR/docs/specs/TransportProtocols.md
+ SignalrTransportKey = attribute.Key("signalr.transport")
+)
+
+// Enum values for signalr.connection.status
+var (
+ // The connection was closed normally.
+ // Stability: stable
+ SignalrConnectionStatusNormalClosure = SignalrConnectionStatusKey.String("normal_closure")
+ // The connection was closed due to a timeout.
+ // Stability: stable
+ SignalrConnectionStatusTimeout = SignalrConnectionStatusKey.String("timeout")
+ // The connection was closed because the app is shutting down.
+ // Stability: stable
+ SignalrConnectionStatusAppShutdown = SignalrConnectionStatusKey.String("app_shutdown")
+)
+
+// Enum values for signalr.transport
+var (
+ // ServerSentEvents protocol
+ // Stability: stable
+ SignalrTransportServerSentEvents = SignalrTransportKey.String("server_sent_events")
+ // LongPolling protocol
+ // Stability: stable
+ SignalrTransportLongPolling = SignalrTransportKey.String("long_polling")
+ // WebSockets protocol
+ // Stability: stable
+ SignalrTransportWebSockets = SignalrTransportKey.String("web_sockets")
+)
+
+// Namespace: source
+const (
+ // SourceAddressKey is the attribute Key conforming to the "source.address"
+ // semantic conventions. It represents the source address - domain name if
+ // available without reverse DNS lookup; otherwise, IP address or Unix domain
+ // socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "source.example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the destination side, and when communicating through
+ // an intermediary, `source.address` SHOULD represent the source address behind
+ // any intermediaries, for example proxies, if it's available.
+ SourceAddressKey = attribute.Key("source.address")
+
+ // SourcePortKey is the attribute Key conforming to the "source.port" semantic
+ // conventions. It represents the source port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 3389, 2888
+ SourcePortKey = attribute.Key("source.port")
+)
+
+// SourceAddress returns an attribute KeyValue conforming to the "source.address"
+// semantic conventions. It represents the source address - domain name if
+// available without reverse DNS lookup; otherwise, IP address or Unix domain
+// socket name.
+func SourceAddress(val string) attribute.KeyValue {
+ return SourceAddressKey.String(val)
+}
+
+// SourcePort returns an attribute KeyValue conforming to the "source.port"
+// semantic conventions. It represents the source port number.
+func SourcePort(val int) attribute.KeyValue {
+ return SourcePortKey.Int(val)
+}
+
+// Namespace: system
+const (
+ // SystemCPULogicalNumberKey is the attribute Key conforming to the
+ // "system.cpu.logical_number" semantic conventions. It represents the logical
+ // CPU number [0..n-1].
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1
+ SystemCPULogicalNumberKey = attribute.Key("system.cpu.logical_number")
+
+ // SystemDeviceKey is the attribute Key conforming to the "system.device"
+ // semantic conventions. It represents the device identifier.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "(identifier)"
+ SystemDeviceKey = attribute.Key("system.device")
+
+ // SystemFilesystemModeKey is the attribute Key conforming to the
+ // "system.filesystem.mode" semantic conventions. It represents the filesystem
+ // mode.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "rw, ro"
+ SystemFilesystemModeKey = attribute.Key("system.filesystem.mode")
+
+ // SystemFilesystemMountpointKey is the attribute Key conforming to the
+ // "system.filesystem.mountpoint" semantic conventions. It represents the
+ // filesystem mount path.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/mnt/data"
+ SystemFilesystemMountpointKey = attribute.Key("system.filesystem.mountpoint")
+
+ // SystemFilesystemStateKey is the attribute Key conforming to the
+ // "system.filesystem.state" semantic conventions. It represents the filesystem
+ // state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "used"
+ SystemFilesystemStateKey = attribute.Key("system.filesystem.state")
+
+ // SystemFilesystemTypeKey is the attribute Key conforming to the
+ // "system.filesystem.type" semantic conventions. It represents the filesystem
+ // type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ext4"
+ SystemFilesystemTypeKey = attribute.Key("system.filesystem.type")
+
+ // SystemMemoryStateKey is the attribute Key conforming to the
+ // "system.memory.state" semantic conventions. It represents the memory state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "free", "cached"
+ SystemMemoryStateKey = attribute.Key("system.memory.state")
+
+ // SystemPagingDirectionKey is the attribute Key conforming to the
+ // "system.paging.direction" semantic conventions. It represents the paging
+ // access direction.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "in"
+ SystemPagingDirectionKey = attribute.Key("system.paging.direction")
+
+ // SystemPagingStateKey is the attribute Key conforming to the
+ // "system.paging.state" semantic conventions. It represents the memory paging
+ // state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "free"
+ SystemPagingStateKey = attribute.Key("system.paging.state")
+
+ // SystemPagingTypeKey is the attribute Key conforming to the
+ // "system.paging.type" semantic conventions. It represents the memory paging
+ // type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "minor"
+ SystemPagingTypeKey = attribute.Key("system.paging.type")
+
+ // SystemProcessStatusKey is the attribute Key conforming to the
+ // "system.process.status" semantic conventions. It represents the process
+ // state, e.g., [Linux Process State Codes].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "running"
+ //
+ // [Linux Process State Codes]: https://man7.org/linux/man-pages/man1/ps.1.html#PROCESS_STATE_CODES
+ SystemProcessStatusKey = attribute.Key("system.process.status")
+)
+
+// SystemCPULogicalNumber returns an attribute KeyValue conforming to the
+// "system.cpu.logical_number" semantic conventions. It represents the logical
+// CPU number [0..n-1].
+func SystemCPULogicalNumber(val int) attribute.KeyValue {
+ return SystemCPULogicalNumberKey.Int(val)
+}
+
+// SystemDevice returns an attribute KeyValue conforming to the "system.device"
+// semantic conventions. It represents the device identifier.
+func SystemDevice(val string) attribute.KeyValue {
+ return SystemDeviceKey.String(val)
+}
+
+// SystemFilesystemMode returns an attribute KeyValue conforming to the
+// "system.filesystem.mode" semantic conventions. It represents the filesystem
+// mode.
+func SystemFilesystemMode(val string) attribute.KeyValue {
+ return SystemFilesystemModeKey.String(val)
+}
+
+// SystemFilesystemMountpoint returns an attribute KeyValue conforming to the
+// "system.filesystem.mountpoint" semantic conventions. It represents the
+// filesystem mount path.
+func SystemFilesystemMountpoint(val string) attribute.KeyValue {
+ return SystemFilesystemMountpointKey.String(val)
+}
+
+// Enum values for system.filesystem.state
+var (
+ // used
+ // Stability: development
+ SystemFilesystemStateUsed = SystemFilesystemStateKey.String("used")
+ // free
+ // Stability: development
+ SystemFilesystemStateFree = SystemFilesystemStateKey.String("free")
+ // reserved
+ // Stability: development
+ SystemFilesystemStateReserved = SystemFilesystemStateKey.String("reserved")
+)
+
+// Enum values for system.filesystem.type
+var (
+ // fat32
+ // Stability: development
+ SystemFilesystemTypeFat32 = SystemFilesystemTypeKey.String("fat32")
+ // exfat
+ // Stability: development
+ SystemFilesystemTypeExfat = SystemFilesystemTypeKey.String("exfat")
+ // ntfs
+ // Stability: development
+ SystemFilesystemTypeNtfs = SystemFilesystemTypeKey.String("ntfs")
+ // refs
+ // Stability: development
+ SystemFilesystemTypeRefs = SystemFilesystemTypeKey.String("refs")
+ // hfsplus
+ // Stability: development
+ SystemFilesystemTypeHfsplus = SystemFilesystemTypeKey.String("hfsplus")
+ // ext4
+ // Stability: development
+ SystemFilesystemTypeExt4 = SystemFilesystemTypeKey.String("ext4")
+)
+
+// Enum values for system.memory.state
+var (
+ // used
+ // Stability: development
+ SystemMemoryStateUsed = SystemMemoryStateKey.String("used")
+ // free
+ // Stability: development
+ SystemMemoryStateFree = SystemMemoryStateKey.String("free")
+ // Deprecated: Removed, report shared memory usage with
+ // `metric.system.memory.shared` metric.
+ SystemMemoryStateShared = SystemMemoryStateKey.String("shared")
+ // buffers
+ // Stability: development
+ SystemMemoryStateBuffers = SystemMemoryStateKey.String("buffers")
+ // cached
+ // Stability: development
+ SystemMemoryStateCached = SystemMemoryStateKey.String("cached")
+)
+
+// Enum values for system.paging.direction
+var (
+ // in
+ // Stability: development
+ SystemPagingDirectionIn = SystemPagingDirectionKey.String("in")
+ // out
+ // Stability: development
+ SystemPagingDirectionOut = SystemPagingDirectionKey.String("out")
+)
+
+// Enum values for system.paging.state
+var (
+ // used
+ // Stability: development
+ SystemPagingStateUsed = SystemPagingStateKey.String("used")
+ // free
+ // Stability: development
+ SystemPagingStateFree = SystemPagingStateKey.String("free")
+)
+
+// Enum values for system.paging.type
+var (
+ // major
+ // Stability: development
+ SystemPagingTypeMajor = SystemPagingTypeKey.String("major")
+ // minor
+ // Stability: development
+ SystemPagingTypeMinor = SystemPagingTypeKey.String("minor")
+)
+
+// Enum values for system.process.status
+var (
+ // running
+ // Stability: development
+ SystemProcessStatusRunning = SystemProcessStatusKey.String("running")
+ // sleeping
+ // Stability: development
+ SystemProcessStatusSleeping = SystemProcessStatusKey.String("sleeping")
+ // stopped
+ // Stability: development
+ SystemProcessStatusStopped = SystemProcessStatusKey.String("stopped")
+ // defunct
+ // Stability: development
+ SystemProcessStatusDefunct = SystemProcessStatusKey.String("defunct")
+)
+
+// Namespace: telemetry
+const (
+ // TelemetryDistroNameKey is the attribute Key conforming to the
+ // "telemetry.distro.name" semantic conventions. It represents the name of the
+ // auto instrumentation agent or distribution, if used.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "parts-unlimited-java"
+ // Note: Official auto instrumentation agents and distributions SHOULD set the
+ // `telemetry.distro.name` attribute to
+ // a string starting with `opentelemetry-`, e.g.
+ // `opentelemetry-java-instrumentation`.
+ TelemetryDistroNameKey = attribute.Key("telemetry.distro.name")
+
+ // TelemetryDistroVersionKey is the attribute Key conforming to the
+ // "telemetry.distro.version" semantic conventions. It represents the version
+ // string of the auto instrumentation agent or distribution, if used.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1.2.3"
+ TelemetryDistroVersionKey = attribute.Key("telemetry.distro.version")
+
+ // TelemetrySDKLanguageKey is the attribute Key conforming to the
+ // "telemetry.sdk.language" semantic conventions. It represents the language of
+ // the telemetry SDK.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples:
+ TelemetrySDKLanguageKey = attribute.Key("telemetry.sdk.language")
+
+ // TelemetrySDKNameKey is the attribute Key conforming to the
+ // "telemetry.sdk.name" semantic conventions. It represents the name of the
+ // telemetry SDK as defined above.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "opentelemetry"
+ // Note: The OpenTelemetry SDK MUST set the `telemetry.sdk.name` attribute to
+ // `opentelemetry`.
+ // If another SDK, like a fork or a vendor-provided implementation, is used,
+ // this SDK MUST set the
+ // `telemetry.sdk.name` attribute to the fully-qualified class or module name of
+ // this SDK's main entry point
+ // or another suitable identifier depending on the language.
+ // The identifier `opentelemetry` is reserved and MUST NOT be used in this case.
+ // All custom identifiers SHOULD be stable across different versions of an
+ // implementation.
+ TelemetrySDKNameKey = attribute.Key("telemetry.sdk.name")
+
+ // TelemetrySDKVersionKey is the attribute Key conforming to the
+ // "telemetry.sdk.version" semantic conventions. It represents the version
+ // string of the telemetry SDK.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "1.2.3"
+ TelemetrySDKVersionKey = attribute.Key("telemetry.sdk.version")
+)
+
+// TelemetryDistroName returns an attribute KeyValue conforming to the
+// "telemetry.distro.name" semantic conventions. It represents the name of the
+// auto instrumentation agent or distribution, if used.
+func TelemetryDistroName(val string) attribute.KeyValue {
+ return TelemetryDistroNameKey.String(val)
+}
+
+// TelemetryDistroVersion returns an attribute KeyValue conforming to the
+// "telemetry.distro.version" semantic conventions. It represents the version
+// string of the auto instrumentation agent or distribution, if used.
+func TelemetryDistroVersion(val string) attribute.KeyValue {
+ return TelemetryDistroVersionKey.String(val)
+}
+
+// TelemetrySDKName returns an attribute KeyValue conforming to the
+// "telemetry.sdk.name" semantic conventions. It represents the name of the
+// telemetry SDK as defined above.
+func TelemetrySDKName(val string) attribute.KeyValue {
+ return TelemetrySDKNameKey.String(val)
+}
+
+// TelemetrySDKVersion returns an attribute KeyValue conforming to the
+// "telemetry.sdk.version" semantic conventions. It represents the version string
+// of the telemetry SDK.
+func TelemetrySDKVersion(val string) attribute.KeyValue {
+ return TelemetrySDKVersionKey.String(val)
+}
+
+// Enum values for telemetry.sdk.language
+var (
+ // cpp
+ // Stability: stable
+ TelemetrySDKLanguageCPP = TelemetrySDKLanguageKey.String("cpp")
+ // dotnet
+ // Stability: stable
+ TelemetrySDKLanguageDotnet = TelemetrySDKLanguageKey.String("dotnet")
+ // erlang
+ // Stability: stable
+ TelemetrySDKLanguageErlang = TelemetrySDKLanguageKey.String("erlang")
+ // go
+ // Stability: stable
+ TelemetrySDKLanguageGo = TelemetrySDKLanguageKey.String("go")
+ // java
+ // Stability: stable
+ TelemetrySDKLanguageJava = TelemetrySDKLanguageKey.String("java")
+ // nodejs
+ // Stability: stable
+ TelemetrySDKLanguageNodejs = TelemetrySDKLanguageKey.String("nodejs")
+ // php
+ // Stability: stable
+ TelemetrySDKLanguagePHP = TelemetrySDKLanguageKey.String("php")
+ // python
+ // Stability: stable
+ TelemetrySDKLanguagePython = TelemetrySDKLanguageKey.String("python")
+ // ruby
+ // Stability: stable
+ TelemetrySDKLanguageRuby = TelemetrySDKLanguageKey.String("ruby")
+ // rust
+ // Stability: stable
+ TelemetrySDKLanguageRust = TelemetrySDKLanguageKey.String("rust")
+ // swift
+ // Stability: stable
+ TelemetrySDKLanguageSwift = TelemetrySDKLanguageKey.String("swift")
+ // webjs
+ // Stability: stable
+ TelemetrySDKLanguageWebjs = TelemetrySDKLanguageKey.String("webjs")
+)
+
+// Namespace: test
+const (
+ // TestCaseNameKey is the attribute Key conforming to the "test.case.name"
+ // semantic conventions. It represents the fully qualified human readable name
+ // of the [test case].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "org.example.TestCase1.test1", "example/tests/TestCase1.test1",
+ // "ExampleTestCase1_test1"
+ //
+ // [test case]: https://wikipedia.org/wiki/Test_case
+ TestCaseNameKey = attribute.Key("test.case.name")
+
+ // TestCaseResultStatusKey is the attribute Key conforming to the
+ // "test.case.result.status" semantic conventions. It represents the status of
+ // the actual test case result from test execution.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pass", "fail"
+ TestCaseResultStatusKey = attribute.Key("test.case.result.status")
+
+ // TestSuiteNameKey is the attribute Key conforming to the "test.suite.name"
+ // semantic conventions. It represents the human readable name of a [test suite]
+ // .
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TestSuite1"
+ //
+ // [test suite]: https://wikipedia.org/wiki/Test_suite
+ TestSuiteNameKey = attribute.Key("test.suite.name")
+
+ // TestSuiteRunStatusKey is the attribute Key conforming to the
+ // "test.suite.run.status" semantic conventions. It represents the status of the
+ // test suite run.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "success", "failure", "skipped", "aborted", "timed_out",
+ // "in_progress"
+ TestSuiteRunStatusKey = attribute.Key("test.suite.run.status")
+)
+
+// TestCaseName returns an attribute KeyValue conforming to the "test.case.name"
+// semantic conventions. It represents the fully qualified human readable name of
+// the [test case].
+//
+// [test case]: https://wikipedia.org/wiki/Test_case
+func TestCaseName(val string) attribute.KeyValue {
+ return TestCaseNameKey.String(val)
+}
+
+// TestSuiteName returns an attribute KeyValue conforming to the
+// "test.suite.name" semantic conventions. It represents the human readable name
+// of a [test suite].
+//
+// [test suite]: https://wikipedia.org/wiki/Test_suite
+func TestSuiteName(val string) attribute.KeyValue {
+ return TestSuiteNameKey.String(val)
+}
+
+// Enum values for test.case.result.status
+var (
+ // pass
+ // Stability: development
+ TestCaseResultStatusPass = TestCaseResultStatusKey.String("pass")
+ // fail
+ // Stability: development
+ TestCaseResultStatusFail = TestCaseResultStatusKey.String("fail")
+)
+
+// Enum values for test.suite.run.status
+var (
+ // success
+ // Stability: development
+ TestSuiteRunStatusSuccess = TestSuiteRunStatusKey.String("success")
+ // failure
+ // Stability: development
+ TestSuiteRunStatusFailure = TestSuiteRunStatusKey.String("failure")
+ // skipped
+ // Stability: development
+ TestSuiteRunStatusSkipped = TestSuiteRunStatusKey.String("skipped")
+ // aborted
+ // Stability: development
+ TestSuiteRunStatusAborted = TestSuiteRunStatusKey.String("aborted")
+ // timed_out
+ // Stability: development
+ TestSuiteRunStatusTimedOut = TestSuiteRunStatusKey.String("timed_out")
+ // in_progress
+ // Stability: development
+ TestSuiteRunStatusInProgress = TestSuiteRunStatusKey.String("in_progress")
+)
+
+// Namespace: thread
+const (
+ // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic
+ // conventions. It represents the current "managed" thread ID (as opposed to OS
+ // thread ID).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ ThreadIDKey = attribute.Key("thread.id")
+
+ // ThreadNameKey is the attribute Key conforming to the "thread.name" semantic
+ // conventions. It represents the current thread name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: main
+ ThreadNameKey = attribute.Key("thread.name")
+)
+
+// ThreadID returns an attribute KeyValue conforming to the "thread.id" semantic
+// conventions. It represents the current "managed" thread ID (as opposed to OS
+// thread ID).
+func ThreadID(val int) attribute.KeyValue {
+ return ThreadIDKey.Int(val)
+}
+
+// ThreadName returns an attribute KeyValue conforming to the "thread.name"
+// semantic conventions. It represents the current thread name.
+func ThreadName(val string) attribute.KeyValue {
+ return ThreadNameKey.String(val)
+}
+
+// Namespace: tls
+const (
+ // TLSCipherKey is the attribute Key conforming to the "tls.cipher" semantic
+ // conventions. It represents the string indicating the [cipher] used during the
+ // current connection.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TLS_RSA_WITH_3DES_EDE_CBC_SHA",
+ // "TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256"
+ // Note: The values allowed for `tls.cipher` MUST be one of the `Descriptions`
+ // of the [registered TLS Cipher Suits].
+ //
+ // [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5
+ // [registered TLS Cipher Suits]: https://www.iana.org/assignments/tls-parameters/tls-parameters.xhtml#table-tls-parameters-4
+ TLSCipherKey = attribute.Key("tls.cipher")
+
+ // TLSClientCertificateKey is the attribute Key conforming to the
+ // "tls.client.certificate" semantic conventions. It represents the pEM-encoded
+ // stand-alone certificate offered by the client. This is usually
+ // mutually-exclusive of `client.certificate_chain` since this value also exists
+ // in that list.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII..."
+ TLSClientCertificateKey = attribute.Key("tls.client.certificate")
+
+ // TLSClientCertificateChainKey is the attribute Key conforming to the
+ // "tls.client.certificate_chain" semantic conventions. It represents the array
+ // of PEM-encoded certificates that make up the certificate chain offered by the
+ // client. This is usually mutually-exclusive of `client.certificate` since that
+ // value should be the first certificate in the chain.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII...", "MI..."
+ TLSClientCertificateChainKey = attribute.Key("tls.client.certificate_chain")
+
+ // TLSClientHashMd5Key is the attribute Key conforming to the
+ // "tls.client.hash.md5" semantic conventions. It represents the certificate
+ // fingerprint using the MD5 digest of DER-encoded version of certificate
+ // offered by the client. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC"
+ TLSClientHashMd5Key = attribute.Key("tls.client.hash.md5")
+
+ // TLSClientHashSha1Key is the attribute Key conforming to the
+ // "tls.client.hash.sha1" semantic conventions. It represents the certificate
+ // fingerprint using the SHA1 digest of DER-encoded version of certificate
+ // offered by the client. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A"
+ TLSClientHashSha1Key = attribute.Key("tls.client.hash.sha1")
+
+ // TLSClientHashSha256Key is the attribute Key conforming to the
+ // "tls.client.hash.sha256" semantic conventions. It represents the certificate
+ // fingerprint using the SHA256 digest of DER-encoded version of certificate
+ // offered by the client. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0"
+ TLSClientHashSha256Key = attribute.Key("tls.client.hash.sha256")
+
+ // TLSClientIssuerKey is the attribute Key conforming to the "tls.client.issuer"
+ // semantic conventions. It represents the distinguished name of [subject] of
+ // the issuer of the x.509 certificate presented by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com"
+ //
+ // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+ TLSClientIssuerKey = attribute.Key("tls.client.issuer")
+
+ // TLSClientJa3Key is the attribute Key conforming to the "tls.client.ja3"
+ // semantic conventions. It represents a hash that identifies clients based on
+ // how they perform an SSL/TLS handshake.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "d4e5b18d6b55c71272893221c96ba240"
+ TLSClientJa3Key = attribute.Key("tls.client.ja3")
+
+ // TLSClientNotAfterKey is the attribute Key conforming to the
+ // "tls.client.not_after" semantic conventions. It represents the date/Time
+ // indicating when client certificate is no longer considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T00:00:00.000Z"
+ TLSClientNotAfterKey = attribute.Key("tls.client.not_after")
+
+ // TLSClientNotBeforeKey is the attribute Key conforming to the
+ // "tls.client.not_before" semantic conventions. It represents the date/Time
+ // indicating when client certificate is first considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1970-01-01T00:00:00.000Z"
+ TLSClientNotBeforeKey = attribute.Key("tls.client.not_before")
+
+ // TLSClientSubjectKey is the attribute Key conforming to the
+ // "tls.client.subject" semantic conventions. It represents the distinguished
+ // name of subject of the x.509 certificate presented by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=myclient, OU=Documentation Team, DC=example, DC=com"
+ TLSClientSubjectKey = attribute.Key("tls.client.subject")
+
+ // TLSClientSupportedCiphersKey is the attribute Key conforming to the
+ // "tls.client.supported_ciphers" semantic conventions. It represents the array
+ // of ciphers offered by the client during the client hello.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384",
+ // "TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384"
+ TLSClientSupportedCiphersKey = attribute.Key("tls.client.supported_ciphers")
+
+ // TLSCurveKey is the attribute Key conforming to the "tls.curve" semantic
+ // conventions. It represents the string indicating the curve used for the given
+ // cipher, when applicable.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "secp256r1"
+ TLSCurveKey = attribute.Key("tls.curve")
+
+ // TLSEstablishedKey is the attribute Key conforming to the "tls.established"
+ // semantic conventions. It represents the boolean flag indicating if the TLS
+ // negotiation was successful and transitioned to an encrypted tunnel.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: true
+ TLSEstablishedKey = attribute.Key("tls.established")
+
+ // TLSNextProtocolKey is the attribute Key conforming to the "tls.next_protocol"
+ // semantic conventions. It represents the string indicating the protocol being
+ // tunneled. Per the values in the [IANA registry], this string should be lower
+ // case.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "http/1.1"
+ //
+ // [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids
+ TLSNextProtocolKey = attribute.Key("tls.next_protocol")
+
+ // TLSProtocolNameKey is the attribute Key conforming to the "tls.protocol.name"
+ // semantic conventions. It represents the normalized lowercase protocol name
+ // parsed from original string of the negotiated [SSL/TLS protocol version].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [SSL/TLS protocol version]: https://www.openssl.org/docs/man1.1.1/man3/SSL_get_version.html#RETURN-VALUES
+ TLSProtocolNameKey = attribute.Key("tls.protocol.name")
+
+ // TLSProtocolVersionKey is the attribute Key conforming to the
+ // "tls.protocol.version" semantic conventions. It represents the numeric part
+ // of the version parsed from the original string of the negotiated
+ // [SSL/TLS protocol version].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1.2", "3"
+ //
+ // [SSL/TLS protocol version]: https://www.openssl.org/docs/man1.1.1/man3/SSL_get_version.html#RETURN-VALUES
+ TLSProtocolVersionKey = attribute.Key("tls.protocol.version")
+
+ // TLSResumedKey is the attribute Key conforming to the "tls.resumed" semantic
+ // conventions. It represents the boolean flag indicating if this TLS connection
+ // was resumed from an existing TLS negotiation.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: true
+ TLSResumedKey = attribute.Key("tls.resumed")
+
+ // TLSServerCertificateKey is the attribute Key conforming to the
+ // "tls.server.certificate" semantic conventions. It represents the pEM-encoded
+ // stand-alone certificate offered by the server. This is usually
+ // mutually-exclusive of `server.certificate_chain` since this value also exists
+ // in that list.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII..."
+ TLSServerCertificateKey = attribute.Key("tls.server.certificate")
+
+ // TLSServerCertificateChainKey is the attribute Key conforming to the
+ // "tls.server.certificate_chain" semantic conventions. It represents the array
+ // of PEM-encoded certificates that make up the certificate chain offered by the
+ // server. This is usually mutually-exclusive of `server.certificate` since that
+ // value should be the first certificate in the chain.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII...", "MI..."
+ TLSServerCertificateChainKey = attribute.Key("tls.server.certificate_chain")
+
+ // TLSServerHashMd5Key is the attribute Key conforming to the
+ // "tls.server.hash.md5" semantic conventions. It represents the certificate
+ // fingerprint using the MD5 digest of DER-encoded version of certificate
+ // offered by the server. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC"
+ TLSServerHashMd5Key = attribute.Key("tls.server.hash.md5")
+
+ // TLSServerHashSha1Key is the attribute Key conforming to the
+ // "tls.server.hash.sha1" semantic conventions. It represents the certificate
+ // fingerprint using the SHA1 digest of DER-encoded version of certificate
+ // offered by the server. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A"
+ TLSServerHashSha1Key = attribute.Key("tls.server.hash.sha1")
+
+ // TLSServerHashSha256Key is the attribute Key conforming to the
+ // "tls.server.hash.sha256" semantic conventions. It represents the certificate
+ // fingerprint using the SHA256 digest of DER-encoded version of certificate
+ // offered by the server. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0"
+ TLSServerHashSha256Key = attribute.Key("tls.server.hash.sha256")
+
+ // TLSServerIssuerKey is the attribute Key conforming to the "tls.server.issuer"
+ // semantic conventions. It represents the distinguished name of [subject] of
+ // the issuer of the x.509 certificate presented by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com"
+ //
+ // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+ TLSServerIssuerKey = attribute.Key("tls.server.issuer")
+
+ // TLSServerJa3sKey is the attribute Key conforming to the "tls.server.ja3s"
+ // semantic conventions. It represents a hash that identifies servers based on
+ // how they perform an SSL/TLS handshake.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "d4e5b18d6b55c71272893221c96ba240"
+ TLSServerJa3sKey = attribute.Key("tls.server.ja3s")
+
+ // TLSServerNotAfterKey is the attribute Key conforming to the
+ // "tls.server.not_after" semantic conventions. It represents the date/Time
+ // indicating when server certificate is no longer considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T00:00:00.000Z"
+ TLSServerNotAfterKey = attribute.Key("tls.server.not_after")
+
+ // TLSServerNotBeforeKey is the attribute Key conforming to the
+ // "tls.server.not_before" semantic conventions. It represents the date/Time
+ // indicating when server certificate is first considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1970-01-01T00:00:00.000Z"
+ TLSServerNotBeforeKey = attribute.Key("tls.server.not_before")
+
+ // TLSServerSubjectKey is the attribute Key conforming to the
+ // "tls.server.subject" semantic conventions. It represents the distinguished
+ // name of subject of the x.509 certificate presented by the server.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=myserver, OU=Documentation Team, DC=example, DC=com"
+ TLSServerSubjectKey = attribute.Key("tls.server.subject")
+)
+
+// TLSCipher returns an attribute KeyValue conforming to the "tls.cipher"
+// semantic conventions. It represents the string indicating the [cipher] used
+// during the current connection.
+//
+// [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5
+func TLSCipher(val string) attribute.KeyValue {
+ return TLSCipherKey.String(val)
+}
+
+// TLSClientCertificate returns an attribute KeyValue conforming to the
+// "tls.client.certificate" semantic conventions. It represents the pEM-encoded
+// stand-alone certificate offered by the client. This is usually
+// mutually-exclusive of `client.certificate_chain` since this value also exists
+// in that list.
+func TLSClientCertificate(val string) attribute.KeyValue {
+ return TLSClientCertificateKey.String(val)
+}
+
+// TLSClientCertificateChain returns an attribute KeyValue conforming to the
+// "tls.client.certificate_chain" semantic conventions. It represents the array
+// of PEM-encoded certificates that make up the certificate chain offered by the
+// client. This is usually mutually-exclusive of `client.certificate` since that
+// value should be the first certificate in the chain.
+func TLSClientCertificateChain(val ...string) attribute.KeyValue {
+ return TLSClientCertificateChainKey.StringSlice(val)
+}
+
+// TLSClientHashMd5 returns an attribute KeyValue conforming to the
+// "tls.client.hash.md5" semantic conventions. It represents the certificate
+// fingerprint using the MD5 digest of DER-encoded version of certificate offered
+// by the client. For consistency with other hash values, this value should be
+// formatted as an uppercase hash.
+func TLSClientHashMd5(val string) attribute.KeyValue {
+ return TLSClientHashMd5Key.String(val)
+}
+
+// TLSClientHashSha1 returns an attribute KeyValue conforming to the
+// "tls.client.hash.sha1" semantic conventions. It represents the certificate
+// fingerprint using the SHA1 digest of DER-encoded version of certificate
+// offered by the client. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSClientHashSha1(val string) attribute.KeyValue {
+ return TLSClientHashSha1Key.String(val)
+}
+
+// TLSClientHashSha256 returns an attribute KeyValue conforming to the
+// "tls.client.hash.sha256" semantic conventions. It represents the certificate
+// fingerprint using the SHA256 digest of DER-encoded version of certificate
+// offered by the client. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSClientHashSha256(val string) attribute.KeyValue {
+ return TLSClientHashSha256Key.String(val)
+}
+
+// TLSClientIssuer returns an attribute KeyValue conforming to the
+// "tls.client.issuer" semantic conventions. It represents the distinguished name
+// of [subject] of the issuer of the x.509 certificate presented by the client.
+//
+// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+func TLSClientIssuer(val string) attribute.KeyValue {
+ return TLSClientIssuerKey.String(val)
+}
+
+// TLSClientJa3 returns an attribute KeyValue conforming to the "tls.client.ja3"
+// semantic conventions. It represents a hash that identifies clients based on
+// how they perform an SSL/TLS handshake.
+func TLSClientJa3(val string) attribute.KeyValue {
+ return TLSClientJa3Key.String(val)
+}
+
+// TLSClientNotAfter returns an attribute KeyValue conforming to the
+// "tls.client.not_after" semantic conventions. It represents the date/Time
+// indicating when client certificate is no longer considered valid.
+func TLSClientNotAfter(val string) attribute.KeyValue {
+ return TLSClientNotAfterKey.String(val)
+}
+
+// TLSClientNotBefore returns an attribute KeyValue conforming to the
+// "tls.client.not_before" semantic conventions. It represents the date/Time
+// indicating when client certificate is first considered valid.
+func TLSClientNotBefore(val string) attribute.KeyValue {
+ return TLSClientNotBeforeKey.String(val)
+}
+
+// TLSClientSubject returns an attribute KeyValue conforming to the
+// "tls.client.subject" semantic conventions. It represents the distinguished
+// name of subject of the x.509 certificate presented by the client.
+func TLSClientSubject(val string) attribute.KeyValue {
+ return TLSClientSubjectKey.String(val)
+}
+
+// TLSClientSupportedCiphers returns an attribute KeyValue conforming to the
+// "tls.client.supported_ciphers" semantic conventions. It represents the array
+// of ciphers offered by the client during the client hello.
+func TLSClientSupportedCiphers(val ...string) attribute.KeyValue {
+ return TLSClientSupportedCiphersKey.StringSlice(val)
+}
+
+// TLSCurve returns an attribute KeyValue conforming to the "tls.curve" semantic
+// conventions. It represents the string indicating the curve used for the given
+// cipher, when applicable.
+func TLSCurve(val string) attribute.KeyValue {
+ return TLSCurveKey.String(val)
+}
+
+// TLSEstablished returns an attribute KeyValue conforming to the
+// "tls.established" semantic conventions. It represents the boolean flag
+// indicating if the TLS negotiation was successful and transitioned to an
+// encrypted tunnel.
+func TLSEstablished(val bool) attribute.KeyValue {
+ return TLSEstablishedKey.Bool(val)
+}
+
+// TLSNextProtocol returns an attribute KeyValue conforming to the
+// "tls.next_protocol" semantic conventions. It represents the string indicating
+// the protocol being tunneled. Per the values in the [IANA registry], this
+// string should be lower case.
+//
+// [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids
+func TLSNextProtocol(val string) attribute.KeyValue {
+ return TLSNextProtocolKey.String(val)
+}
+
+// TLSProtocolVersion returns an attribute KeyValue conforming to the
+// "tls.protocol.version" semantic conventions. It represents the numeric part of
+// the version parsed from the original string of the negotiated
+// [SSL/TLS protocol version].
+//
+// [SSL/TLS protocol version]: https://www.openssl.org/docs/man1.1.1/man3/SSL_get_version.html#RETURN-VALUES
+func TLSProtocolVersion(val string) attribute.KeyValue {
+ return TLSProtocolVersionKey.String(val)
+}
+
+// TLSResumed returns an attribute KeyValue conforming to the "tls.resumed"
+// semantic conventions. It represents the boolean flag indicating if this TLS
+// connection was resumed from an existing TLS negotiation.
+func TLSResumed(val bool) attribute.KeyValue {
+ return TLSResumedKey.Bool(val)
+}
+
+// TLSServerCertificate returns an attribute KeyValue conforming to the
+// "tls.server.certificate" semantic conventions. It represents the pEM-encoded
+// stand-alone certificate offered by the server. This is usually
+// mutually-exclusive of `server.certificate_chain` since this value also exists
+// in that list.
+func TLSServerCertificate(val string) attribute.KeyValue {
+ return TLSServerCertificateKey.String(val)
+}
+
+// TLSServerCertificateChain returns an attribute KeyValue conforming to the
+// "tls.server.certificate_chain" semantic conventions. It represents the array
+// of PEM-encoded certificates that make up the certificate chain offered by the
+// server. This is usually mutually-exclusive of `server.certificate` since that
+// value should be the first certificate in the chain.
+func TLSServerCertificateChain(val ...string) attribute.KeyValue {
+ return TLSServerCertificateChainKey.StringSlice(val)
+}
+
+// TLSServerHashMd5 returns an attribute KeyValue conforming to the
+// "tls.server.hash.md5" semantic conventions. It represents the certificate
+// fingerprint using the MD5 digest of DER-encoded version of certificate offered
+// by the server. For consistency with other hash values, this value should be
+// formatted as an uppercase hash.
+func TLSServerHashMd5(val string) attribute.KeyValue {
+ return TLSServerHashMd5Key.String(val)
+}
+
+// TLSServerHashSha1 returns an attribute KeyValue conforming to the
+// "tls.server.hash.sha1" semantic conventions. It represents the certificate
+// fingerprint using the SHA1 digest of DER-encoded version of certificate
+// offered by the server. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSServerHashSha1(val string) attribute.KeyValue {
+ return TLSServerHashSha1Key.String(val)
+}
+
+// TLSServerHashSha256 returns an attribute KeyValue conforming to the
+// "tls.server.hash.sha256" semantic conventions. It represents the certificate
+// fingerprint using the SHA256 digest of DER-encoded version of certificate
+// offered by the server. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSServerHashSha256(val string) attribute.KeyValue {
+ return TLSServerHashSha256Key.String(val)
+}
+
+// TLSServerIssuer returns an attribute KeyValue conforming to the
+// "tls.server.issuer" semantic conventions. It represents the distinguished name
+// of [subject] of the issuer of the x.509 certificate presented by the client.
+//
+// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+func TLSServerIssuer(val string) attribute.KeyValue {
+ return TLSServerIssuerKey.String(val)
+}
+
+// TLSServerJa3s returns an attribute KeyValue conforming to the
+// "tls.server.ja3s" semantic conventions. It represents a hash that identifies
+// servers based on how they perform an SSL/TLS handshake.
+func TLSServerJa3s(val string) attribute.KeyValue {
+ return TLSServerJa3sKey.String(val)
+}
+
+// TLSServerNotAfter returns an attribute KeyValue conforming to the
+// "tls.server.not_after" semantic conventions. It represents the date/Time
+// indicating when server certificate is no longer considered valid.
+func TLSServerNotAfter(val string) attribute.KeyValue {
+ return TLSServerNotAfterKey.String(val)
+}
+
+// TLSServerNotBefore returns an attribute KeyValue conforming to the
+// "tls.server.not_before" semantic conventions. It represents the date/Time
+// indicating when server certificate is first considered valid.
+func TLSServerNotBefore(val string) attribute.KeyValue {
+ return TLSServerNotBeforeKey.String(val)
+}
+
+// TLSServerSubject returns an attribute KeyValue conforming to the
+// "tls.server.subject" semantic conventions. It represents the distinguished
+// name of subject of the x.509 certificate presented by the server.
+func TLSServerSubject(val string) attribute.KeyValue {
+ return TLSServerSubjectKey.String(val)
+}
+
+// Enum values for tls.protocol.name
+var (
+ // ssl
+ // Stability: development
+ TLSProtocolNameSsl = TLSProtocolNameKey.String("ssl")
+ // tls
+ // Stability: development
+ TLSProtocolNameTLS = TLSProtocolNameKey.String("tls")
+)
+
+// Namespace: url
+const (
+ // URLDomainKey is the attribute Key conforming to the "url.domain" semantic
+ // conventions. It represents the domain extracted from the `url.full`, such as
+ // "opentelemetry.io".
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "www.foo.bar", "opentelemetry.io", "3.12.167.2",
+ // "[1080:0:0:0:8:800:200C:417A]"
+ // Note: In some cases a URL may refer to an IP and/or port directly, without a
+ // domain name. In this case, the IP address would go to the domain field. If
+ // the URL contains a [literal IPv6 address] enclosed by `[` and `]`, the `[`
+ // and `]` characters should also be captured in the domain field.
+ //
+ // [literal IPv6 address]: https://www.rfc-editor.org/rfc/rfc2732#section-2
+ URLDomainKey = attribute.Key("url.domain")
+
+ // URLExtensionKey is the attribute Key conforming to the "url.extension"
+ // semantic conventions. It represents the file extension extracted from the
+ // `url.full`, excluding the leading dot.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "png", "gz"
+ // Note: The file extension is only set if it exists, as not every url has a
+ // file extension. When the file name has multiple extensions `example.tar.gz`,
+ // only the last one should be captured `gz`, not `tar.gz`.
+ URLExtensionKey = attribute.Key("url.extension")
+
+ // URLFragmentKey is the attribute Key conforming to the "url.fragment" semantic
+ // conventions. It represents the [URI fragment] component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "SemConv"
+ //
+ // [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5
+ URLFragmentKey = attribute.Key("url.fragment")
+
+ // URLFullKey is the attribute Key conforming to the "url.full" semantic
+ // conventions. It represents the absolute URL describing a network resource
+ // according to [RFC3986].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", "//localhost"
+ // Note: For network calls, URL usually has
+ // `scheme://host[:port][path][?query][#fragment]` format, where the fragment
+ // is not transmitted over HTTP, but if it is known, it SHOULD be included
+ // nevertheless.
+ //
+ // `url.full` MUST NOT contain credentials passed via URL in form of
+ // `https://username:password@www.example.com/`.
+ // In such case username and password SHOULD be redacted and attribute's value
+ // SHOULD be `https://REDACTED:REDACTED@www.example.com/`.
+ //
+ // `url.full` SHOULD capture the absolute URL when it is available (or can be
+ // reconstructed).
+ //
+ // Sensitive content provided in `url.full` SHOULD be scrubbed when
+ // instrumentations can identify it.
+ //
+ //
+ // Query string values for the following keys SHOULD be redacted by default and
+ // replaced by the
+ // value `REDACTED`:
+ //
+ // - [`AWSAccessKeyId`]
+ // - [`Signature`]
+ // - [`sig`]
+ // - [`X-Goog-Signature`]
+ //
+ // This list is subject to change over time.
+ //
+ // When a query string value is redacted, the query string key SHOULD still be
+ // preserved, e.g.
+ // `https://www.example.com/path?color=blue&sig=REDACTED`.
+ //
+ // [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986
+ // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token
+ // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls
+ URLFullKey = attribute.Key("url.full")
+
+ // URLOriginalKey is the attribute Key conforming to the "url.original" semantic
+ // conventions. It represents the unmodified original URL as seen in the event
+ // source.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv",
+ // "search?q=OpenTelemetry"
+ // Note: In network monitoring, the observed URL may be a full URL, whereas in
+ // access logs, the URL is often just represented as a path. This field is meant
+ // to represent the URL as it was observed, complete or not.
+ // `url.original` might contain credentials passed via URL in form of
+ // `https://username:password@www.example.com/`. In such case password and
+ // username SHOULD NOT be redacted and attribute's value SHOULD remain the same.
+ URLOriginalKey = attribute.Key("url.original")
+
+ // URLPathKey is the attribute Key conforming to the "url.path" semantic
+ // conventions. It represents the [URI path] component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "/search"
+ // Note: Sensitive content provided in `url.path` SHOULD be scrubbed when
+ // instrumentations can identify it.
+ //
+ // [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3
+ URLPathKey = attribute.Key("url.path")
+
+ // URLPortKey is the attribute Key conforming to the "url.port" semantic
+ // conventions. It represents the port extracted from the `url.full`.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 443
+ URLPortKey = attribute.Key("url.port")
+
+ // URLQueryKey is the attribute Key conforming to the "url.query" semantic
+ // conventions. It represents the [URI query] component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "q=OpenTelemetry"
+ // Note: Sensitive content provided in `url.query` SHOULD be scrubbed when
+ // instrumentations can identify it.
+ //
+ //
+ // Query string values for the following keys SHOULD be redacted by default and
+ // replaced by the value `REDACTED`:
+ //
+ // - [`AWSAccessKeyId`]
+ // - [`Signature`]
+ // - [`sig`]
+ // - [`X-Goog-Signature`]
+ //
+ // This list is subject to change over time.
+ //
+ // When a query string value is redacted, the query string key SHOULD still be
+ // preserved, e.g.
+ // `q=OpenTelemetry&sig=REDACTED`.
+ //
+ // [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4
+ // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token
+ // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls
+ URLQueryKey = attribute.Key("url.query")
+
+ // URLRegisteredDomainKey is the attribute Key conforming to the
+ // "url.registered_domain" semantic conventions. It represents the highest
+ // registered url domain, stripped of the subdomain.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "example.com", "foo.co.uk"
+ // Note: This value can be determined precisely with the [public suffix list].
+ // For example, the registered domain for `foo.example.com` is `example.com`.
+ // Trying to approximate this by simply taking the last two labels will not work
+ // well for TLDs such as `co.uk`.
+ //
+ // [public suffix list]: http://publicsuffix.org
+ URLRegisteredDomainKey = attribute.Key("url.registered_domain")
+
+ // URLSchemeKey is the attribute Key conforming to the "url.scheme" semantic
+ // conventions. It represents the [URI scheme] component identifying the used
+ // protocol.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "https", "ftp", "telnet"
+ //
+ // [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1
+ URLSchemeKey = attribute.Key("url.scheme")
+
+ // URLSubdomainKey is the attribute Key conforming to the "url.subdomain"
+ // semantic conventions. It represents the subdomain portion of a fully
+ // qualified domain name includes all of the names except the host name under
+ // the registered_domain. In a partially qualified domain, or if the
+ // qualification level of the full name cannot be determined, subdomain contains
+ // all of the names below the registered domain.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "east", "sub2.sub1"
+ // Note: The subdomain portion of `www.east.mydomain.co.uk` is `east`. If the
+ // domain has multiple levels of subdomain, such as `sub2.sub1.example.com`, the
+ // subdomain field should contain `sub2.sub1`, with no trailing period.
+ URLSubdomainKey = attribute.Key("url.subdomain")
+
+ // URLTemplateKey is the attribute Key conforming to the "url.template" semantic
+ // conventions. It represents the low-cardinality template of an
+ // [absolute path reference].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/users/{id}", "/users/:id", "/users?id={id}"
+ //
+ // [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2
+ URLTemplateKey = attribute.Key("url.template")
+
+ // URLTopLevelDomainKey is the attribute Key conforming to the
+ // "url.top_level_domain" semantic conventions. It represents the effective top
+ // level domain (eTLD), also known as the domain suffix, is the last part of the
+ // domain name. For example, the top level domain for example.com is `com`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "com", "co.uk"
+ // Note: This value can be determined precisely with the [public suffix list].
+ //
+ // [public suffix list]: http://publicsuffix.org
+ URLTopLevelDomainKey = attribute.Key("url.top_level_domain")
+)
+
+// URLDomain returns an attribute KeyValue conforming to the "url.domain"
+// semantic conventions. It represents the domain extracted from the `url.full`,
+// such as "opentelemetry.io".
+func URLDomain(val string) attribute.KeyValue {
+ return URLDomainKey.String(val)
+}
+
+// URLExtension returns an attribute KeyValue conforming to the "url.extension"
+// semantic conventions. It represents the file extension extracted from the
+// `url.full`, excluding the leading dot.
+func URLExtension(val string) attribute.KeyValue {
+ return URLExtensionKey.String(val)
+}
+
+// URLFragment returns an attribute KeyValue conforming to the "url.fragment"
+// semantic conventions. It represents the [URI fragment] component.
+//
+// [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5
+func URLFragment(val string) attribute.KeyValue {
+ return URLFragmentKey.String(val)
+}
+
+// URLFull returns an attribute KeyValue conforming to the "url.full" semantic
+// conventions. It represents the absolute URL describing a network resource
+// according to [RFC3986].
+//
+// [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986
+func URLFull(val string) attribute.KeyValue {
+ return URLFullKey.String(val)
+}
+
+// URLOriginal returns an attribute KeyValue conforming to the "url.original"
+// semantic conventions. It represents the unmodified original URL as seen in the
+// event source.
+func URLOriginal(val string) attribute.KeyValue {
+ return URLOriginalKey.String(val)
+}
+
+// URLPath returns an attribute KeyValue conforming to the "url.path" semantic
+// conventions. It represents the [URI path] component.
+//
+// [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3
+func URLPath(val string) attribute.KeyValue {
+ return URLPathKey.String(val)
+}
+
+// URLPort returns an attribute KeyValue conforming to the "url.port" semantic
+// conventions. It represents the port extracted from the `url.full`.
+func URLPort(val int) attribute.KeyValue {
+ return URLPortKey.Int(val)
+}
+
+// URLQuery returns an attribute KeyValue conforming to the "url.query" semantic
+// conventions. It represents the [URI query] component.
+//
+// [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4
+func URLQuery(val string) attribute.KeyValue {
+ return URLQueryKey.String(val)
+}
+
+// URLRegisteredDomain returns an attribute KeyValue conforming to the
+// "url.registered_domain" semantic conventions. It represents the highest
+// registered url domain, stripped of the subdomain.
+func URLRegisteredDomain(val string) attribute.KeyValue {
+ return URLRegisteredDomainKey.String(val)
+}
+
+// URLScheme returns an attribute KeyValue conforming to the "url.scheme"
+// semantic conventions. It represents the [URI scheme] component identifying the
+// used protocol.
+//
+// [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1
+func URLScheme(val string) attribute.KeyValue {
+ return URLSchemeKey.String(val)
+}
+
+// URLSubdomain returns an attribute KeyValue conforming to the "url.subdomain"
+// semantic conventions. It represents the subdomain portion of a fully qualified
+// domain name includes all of the names except the host name under the
+// registered_domain. In a partially qualified domain, or if the qualification
+// level of the full name cannot be determined, subdomain contains all of the
+// names below the registered domain.
+func URLSubdomain(val string) attribute.KeyValue {
+ return URLSubdomainKey.String(val)
+}
+
+// URLTemplate returns an attribute KeyValue conforming to the "url.template"
+// semantic conventions. It represents the low-cardinality template of an
+// [absolute path reference].
+//
+// [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2
+func URLTemplate(val string) attribute.KeyValue {
+ return URLTemplateKey.String(val)
+}
+
+// URLTopLevelDomain returns an attribute KeyValue conforming to the
+// "url.top_level_domain" semantic conventions. It represents the effective top
+// level domain (eTLD), also known as the domain suffix, is the last part of the
+// domain name. For example, the top level domain for example.com is `com`.
+func URLTopLevelDomain(val string) attribute.KeyValue {
+ return URLTopLevelDomainKey.String(val)
+}
+
+// Namespace: user
+const (
+ // UserEmailKey is the attribute Key conforming to the "user.email" semantic
+ // conventions. It represents the user email address.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "a.einstein@example.com"
+ UserEmailKey = attribute.Key("user.email")
+
+ // UserFullNameKey is the attribute Key conforming to the "user.full_name"
+ // semantic conventions. It represents the user's full name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Albert Einstein"
+ UserFullNameKey = attribute.Key("user.full_name")
+
+ // UserHashKey is the attribute Key conforming to the "user.hash" semantic
+ // conventions. It represents the unique user hash to correlate information for
+ // a user in anonymized form.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "364fc68eaf4c8acec74a4e52d7d1feaa"
+ // Note: Useful if `user.id` or `user.name` contain confidential information and
+ // cannot be used.
+ UserHashKey = attribute.Key("user.hash")
+
+ // UserIDKey is the attribute Key conforming to the "user.id" semantic
+ // conventions. It represents the unique identifier of the user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "S-1-5-21-202424912787-2692429404-2351956786-1000"
+ UserIDKey = attribute.Key("user.id")
+
+ // UserNameKey is the attribute Key conforming to the "user.name" semantic
+ // conventions. It represents the short name or login/username of the user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "a.einstein"
+ UserNameKey = attribute.Key("user.name")
+
+ // UserRolesKey is the attribute Key conforming to the "user.roles" semantic
+ // conventions. It represents the array of user roles at the time of the event.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "admin", "reporting_user"
+ UserRolesKey = attribute.Key("user.roles")
+)
+
+// UserEmail returns an attribute KeyValue conforming to the "user.email"
+// semantic conventions. It represents the user email address.
+func UserEmail(val string) attribute.KeyValue {
+ return UserEmailKey.String(val)
+}
+
+// UserFullName returns an attribute KeyValue conforming to the "user.full_name"
+// semantic conventions. It represents the user's full name.
+func UserFullName(val string) attribute.KeyValue {
+ return UserFullNameKey.String(val)
+}
+
+// UserHash returns an attribute KeyValue conforming to the "user.hash" semantic
+// conventions. It represents the unique user hash to correlate information for a
+// user in anonymized form.
+func UserHash(val string) attribute.KeyValue {
+ return UserHashKey.String(val)
+}
+
+// UserID returns an attribute KeyValue conforming to the "user.id" semantic
+// conventions. It represents the unique identifier of the user.
+func UserID(val string) attribute.KeyValue {
+ return UserIDKey.String(val)
+}
+
+// UserName returns an attribute KeyValue conforming to the "user.name" semantic
+// conventions. It represents the short name or login/username of the user.
+func UserName(val string) attribute.KeyValue {
+ return UserNameKey.String(val)
+}
+
+// UserRoles returns an attribute KeyValue conforming to the "user.roles"
+// semantic conventions. It represents the array of user roles at the time of the
+// event.
+func UserRoles(val ...string) attribute.KeyValue {
+ return UserRolesKey.StringSlice(val)
+}
+
+// Namespace: user_agent
+const (
+ // UserAgentNameKey is the attribute Key conforming to the "user_agent.name"
+ // semantic conventions. It represents the name of the user-agent extracted from
+ // original. Usually refers to the browser's name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Safari", "YourApp"
+ // Note: [Example] of extracting browser's name from original string. In the
+ // case of using a user-agent for non-browser products, such as microservices
+ // with multiple names/versions inside the `user_agent.original`, the most
+ // significant name SHOULD be selected. In such a scenario it should align with
+ // `user_agent.version`
+ //
+ // [Example]: https://www.whatsmyua.info
+ UserAgentNameKey = attribute.Key("user_agent.name")
+
+ // UserAgentOriginalKey is the attribute Key conforming to the
+ // "user_agent.original" semantic conventions. It represents the value of the
+ // [HTTP User-Agent] header sent by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "CERN-LineMode/2.15 libwww/2.17b3", "Mozilla/5.0 (iPhone; CPU
+ // iPhone OS 14_7_1 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko)
+ // Version/14.1.2 Mobile/15E148 Safari/604.1", "YourApp/1.0.0
+ // grpc-java-okhttp/1.27.2"
+ //
+ // [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent
+ UserAgentOriginalKey = attribute.Key("user_agent.original")
+
+ // UserAgentSyntheticTypeKey is the attribute Key conforming to the
+ // "user_agent.synthetic.type" semantic conventions. It represents the specifies
+ // the category of synthetic traffic, such as tests or bots.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: This attribute MAY be derived from the contents of the
+ // `user_agent.original` attribute. Components that populate the attribute are
+ // responsible for determining what they consider to be synthetic bot or test
+ // traffic. This attribute can either be set for self-identification purposes,
+ // or on telemetry detected to be generated as a result of a synthetic request.
+ // This attribute is useful for distinguishing between genuine client traffic
+ // and synthetic traffic generated by bots or tests.
+ UserAgentSyntheticTypeKey = attribute.Key("user_agent.synthetic.type")
+
+ // UserAgentVersionKey is the attribute Key conforming to the
+ // "user_agent.version" semantic conventions. It represents the version of the
+ // user-agent extracted from original. Usually refers to the browser's version.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "14.1.2", "1.0.0"
+ // Note: [Example] of extracting browser's version from original string. In the
+ // case of using a user-agent for non-browser products, such as microservices
+ // with multiple names/versions inside the `user_agent.original`, the most
+ // significant version SHOULD be selected. In such a scenario it should align
+ // with `user_agent.name`
+ //
+ // [Example]: https://www.whatsmyua.info
+ UserAgentVersionKey = attribute.Key("user_agent.version")
+)
+
+// UserAgentName returns an attribute KeyValue conforming to the
+// "user_agent.name" semantic conventions. It represents the name of the
+// user-agent extracted from original. Usually refers to the browser's name.
+func UserAgentName(val string) attribute.KeyValue {
+ return UserAgentNameKey.String(val)
+}
+
+// UserAgentOriginal returns an attribute KeyValue conforming to the
+// "user_agent.original" semantic conventions. It represents the value of the
+// [HTTP User-Agent] header sent by the client.
+//
+// [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent
+func UserAgentOriginal(val string) attribute.KeyValue {
+ return UserAgentOriginalKey.String(val)
+}
+
+// UserAgentVersion returns an attribute KeyValue conforming to the
+// "user_agent.version" semantic conventions. It represents the version of the
+// user-agent extracted from original. Usually refers to the browser's version.
+func UserAgentVersion(val string) attribute.KeyValue {
+ return UserAgentVersionKey.String(val)
+}
+
+// Enum values for user_agent.synthetic.type
+var (
+ // Bot source.
+ // Stability: development
+ UserAgentSyntheticTypeBot = UserAgentSyntheticTypeKey.String("bot")
+ // Synthetic test source.
+ // Stability: development
+ UserAgentSyntheticTypeTest = UserAgentSyntheticTypeKey.String("test")
+)
+
+// Namespace: vcs
+const (
+ // VCSChangeIDKey is the attribute Key conforming to the "vcs.change.id"
+ // semantic conventions. It represents the ID of the change (pull request/merge
+ // request/changelist) if applicable. This is usually a unique (within
+ // repository) identifier generated by the VCS system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "123"
+ VCSChangeIDKey = attribute.Key("vcs.change.id")
+
+ // VCSChangeStateKey is the attribute Key conforming to the "vcs.change.state"
+ // semantic conventions. It represents the state of the change (pull
+ // request/merge request/changelist).
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "open", "closed", "merged"
+ VCSChangeStateKey = attribute.Key("vcs.change.state")
+
+ // VCSChangeTitleKey is the attribute Key conforming to the "vcs.change.title"
+ // semantic conventions. It represents the human readable title of the change
+ // (pull request/merge request/changelist). This title is often a brief summary
+ // of the change and may get merged in to a ref as the commit summary.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Fixes broken thing", "feat: add my new feature", "[chore] update
+ // dependency"
+ VCSChangeTitleKey = attribute.Key("vcs.change.title")
+
+ // VCSLineChangeTypeKey is the attribute Key conforming to the
+ // "vcs.line_change.type" semantic conventions. It represents the type of line
+ // change being measured on a branch or change.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "added", "removed"
+ VCSLineChangeTypeKey = attribute.Key("vcs.line_change.type")
+
+ // VCSRefBaseNameKey is the attribute Key conforming to the "vcs.ref.base.name"
+ // semantic conventions. It represents the name of the [reference] such as
+ // **branch** or **tag** in the repository.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-feature-branch", "tag-1-test"
+ // Note: `base` refers to the starting point of a change. For example, `main`
+ // would be the base reference of type branch if you've created a new
+ // reference of type branch from it and created new commits.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefBaseNameKey = attribute.Key("vcs.ref.base.name")
+
+ // VCSRefBaseRevisionKey is the attribute Key conforming to the
+ // "vcs.ref.base.revision" semantic conventions. It represents the revision,
+ // literally [revised version], The revision most often refers to a commit
+ // object in Git, or a revision number in SVN.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc",
+ // "main", "123", "HEAD"
+ // Note: `base` refers to the starting point of a change. For example, `main`
+ // would be the base reference of type branch if you've created a new
+ // reference of type branch from it and created new commits. The
+ // revision can be a full [hash value (see
+ // glossary)],
+ // of the recorded change to a ref within a repository pointing to a
+ // commit [commit] object. It does
+ // not necessarily have to be a hash; it can simply define a [revision
+ // number]
+ // which is an integer that is monotonically increasing. In cases where
+ // it is identical to the `ref.base.name`, it SHOULD still be included.
+ // It is up to the implementer to decide which value to set as the
+ // revision based on the VCS system and situational context.
+ //
+ // [revised version]: https://www.merriam-webster.com/dictionary/revision
+ // [hash value (see
+ // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ // [commit]: https://git-scm.com/docs/git-commit
+ // [revision
+ // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html
+ VCSRefBaseRevisionKey = attribute.Key("vcs.ref.base.revision")
+
+ // VCSRefBaseTypeKey is the attribute Key conforming to the "vcs.ref.base.type"
+ // semantic conventions. It represents the type of the [reference] in the
+ // repository.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "branch", "tag"
+ // Note: `base` refers to the starting point of a change. For example, `main`
+ // would be the base reference of type branch if you've created a new
+ // reference of type branch from it and created new commits.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefBaseTypeKey = attribute.Key("vcs.ref.base.type")
+
+ // VCSRefHeadNameKey is the attribute Key conforming to the "vcs.ref.head.name"
+ // semantic conventions. It represents the name of the [reference] such as
+ // **branch** or **tag** in the repository.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-feature-branch", "tag-1-test"
+ // Note: `head` refers to where you are right now; the current reference at a
+ // given time.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefHeadNameKey = attribute.Key("vcs.ref.head.name")
+
+ // VCSRefHeadRevisionKey is the attribute Key conforming to the
+ // "vcs.ref.head.revision" semantic conventions. It represents the revision,
+ // literally [revised version], The revision most often refers to a commit
+ // object in Git, or a revision number in SVN.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc",
+ // "main", "123", "HEAD"
+ // Note: `head` refers to where you are right now; the current reference at a
+ // given time.The revision can be a full [hash value (see
+ // glossary)],
+ // of the recorded change to a ref within a repository pointing to a
+ // commit [commit] object. It does
+ // not necessarily have to be a hash; it can simply define a [revision
+ // number]
+ // which is an integer that is monotonically increasing. In cases where
+ // it is identical to the `ref.head.name`, it SHOULD still be included.
+ // It is up to the implementer to decide which value to set as the
+ // revision based on the VCS system and situational context.
+ //
+ // [revised version]: https://www.merriam-webster.com/dictionary/revision
+ // [hash value (see
+ // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ // [commit]: https://git-scm.com/docs/git-commit
+ // [revision
+ // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html
+ VCSRefHeadRevisionKey = attribute.Key("vcs.ref.head.revision")
+
+ // VCSRefHeadTypeKey is the attribute Key conforming to the "vcs.ref.head.type"
+ // semantic conventions. It represents the type of the [reference] in the
+ // repository.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "branch", "tag"
+ // Note: `head` refers to where you are right now; the current reference at a
+ // given time.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefHeadTypeKey = attribute.Key("vcs.ref.head.type")
+
+ // VCSRefTypeKey is the attribute Key conforming to the "vcs.ref.type" semantic
+ // conventions. It represents the type of the [reference] in the repository.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "branch", "tag"
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefTypeKey = attribute.Key("vcs.ref.type")
+
+ // VCSRepositoryNameKey is the attribute Key conforming to the
+ // "vcs.repository.name" semantic conventions. It represents the human readable
+ // name of the repository. It SHOULD NOT include any additional identifier like
+ // Group/SubGroup in GitLab or organization in GitHub.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "semantic-conventions", "my-cool-repo"
+ // Note: Due to it only being the name, it can clash with forks of the same
+ // repository if collecting telemetry across multiple orgs or groups in
+ // the same backends.
+ VCSRepositoryNameKey = attribute.Key("vcs.repository.name")
+
+ // VCSRepositoryURLFullKey is the attribute Key conforming to the
+ // "vcs.repository.url.full" semantic conventions. It represents the
+ // [canonical URL] of the repository providing the complete HTTP(S) address in
+ // order to locate and identify the repository through a browser.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "https://github.com/opentelemetry/open-telemetry-collector-contrib",
+ // "https://gitlab.com/my-org/my-project/my-projects-project/repo"
+ // Note: In Git Version Control Systems, the canonical URL SHOULD NOT include
+ // the `.git` extension.
+ //
+ // [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical.
+ VCSRepositoryURLFullKey = attribute.Key("vcs.repository.url.full")
+
+ // VCSRevisionDeltaDirectionKey is the attribute Key conforming to the
+ // "vcs.revision_delta.direction" semantic conventions. It represents the type
+ // of revision comparison.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ahead", "behind"
+ VCSRevisionDeltaDirectionKey = attribute.Key("vcs.revision_delta.direction")
+)
+
+// VCSChangeID returns an attribute KeyValue conforming to the "vcs.change.id"
+// semantic conventions. It represents the ID of the change (pull request/merge
+// request/changelist) if applicable. This is usually a unique (within
+// repository) identifier generated by the VCS system.
+func VCSChangeID(val string) attribute.KeyValue {
+ return VCSChangeIDKey.String(val)
+}
+
+// VCSChangeTitle returns an attribute KeyValue conforming to the
+// "vcs.change.title" semantic conventions. It represents the human readable
+// title of the change (pull request/merge request/changelist). This title is
+// often a brief summary of the change and may get merged in to a ref as the
+// commit summary.
+func VCSChangeTitle(val string) attribute.KeyValue {
+ return VCSChangeTitleKey.String(val)
+}
+
+// VCSRefBaseName returns an attribute KeyValue conforming to the
+// "vcs.ref.base.name" semantic conventions. It represents the name of the
+// [reference] such as **branch** or **tag** in the repository.
+//
+// [reference]: https://git-scm.com/docs/gitglossary#def_ref
+func VCSRefBaseName(val string) attribute.KeyValue {
+ return VCSRefBaseNameKey.String(val)
+}
+
+// VCSRefBaseRevision returns an attribute KeyValue conforming to the
+// "vcs.ref.base.revision" semantic conventions. It represents the revision,
+// literally [revised version], The revision most often refers to a commit object
+// in Git, or a revision number in SVN.
+//
+// [revised version]: https://www.merriam-webster.com/dictionary/revision
+func VCSRefBaseRevision(val string) attribute.KeyValue {
+ return VCSRefBaseRevisionKey.String(val)
+}
+
+// VCSRefHeadName returns an attribute KeyValue conforming to the
+// "vcs.ref.head.name" semantic conventions. It represents the name of the
+// [reference] such as **branch** or **tag** in the repository.
+//
+// [reference]: https://git-scm.com/docs/gitglossary#def_ref
+func VCSRefHeadName(val string) attribute.KeyValue {
+ return VCSRefHeadNameKey.String(val)
+}
+
+// VCSRefHeadRevision returns an attribute KeyValue conforming to the
+// "vcs.ref.head.revision" semantic conventions. It represents the revision,
+// literally [revised version], The revision most often refers to a commit object
+// in Git, or a revision number in SVN.
+//
+// [revised version]: https://www.merriam-webster.com/dictionary/revision
+func VCSRefHeadRevision(val string) attribute.KeyValue {
+ return VCSRefHeadRevisionKey.String(val)
+}
+
+// VCSRepositoryName returns an attribute KeyValue conforming to the
+// "vcs.repository.name" semantic conventions. It represents the human readable
+// name of the repository. It SHOULD NOT include any additional identifier like
+// Group/SubGroup in GitLab or organization in GitHub.
+func VCSRepositoryName(val string) attribute.KeyValue {
+ return VCSRepositoryNameKey.String(val)
+}
+
+// VCSRepositoryURLFull returns an attribute KeyValue conforming to the
+// "vcs.repository.url.full" semantic conventions. It represents the
+// [canonical URL] of the repository providing the complete HTTP(S) address in
+// order to locate and identify the repository through a browser.
+//
+// [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical.
+func VCSRepositoryURLFull(val string) attribute.KeyValue {
+ return VCSRepositoryURLFullKey.String(val)
+}
+
+// Enum values for vcs.change.state
+var (
+ // Open means the change is currently active and under review. It hasn't been
+ // merged into the target branch yet, and it's still possible to make changes or
+ // add comments.
+ // Stability: development
+ VCSChangeStateOpen = VCSChangeStateKey.String("open")
+ // WIP (work-in-progress, draft) means the change is still in progress and not
+ // yet ready for a full review. It might still undergo significant changes.
+ // Stability: development
+ VCSChangeStateWip = VCSChangeStateKey.String("wip")
+ // Closed means the merge request has been closed without merging. This can
+ // happen for various reasons, such as the changes being deemed unnecessary, the
+ // issue being resolved in another way, or the author deciding to withdraw the
+ // request.
+ // Stability: development
+ VCSChangeStateClosed = VCSChangeStateKey.String("closed")
+ // Merged indicates that the change has been successfully integrated into the
+ // target codebase.
+ // Stability: development
+ VCSChangeStateMerged = VCSChangeStateKey.String("merged")
+)
+
+// Enum values for vcs.line_change.type
+var (
+ // How many lines were added.
+ // Stability: development
+ VCSLineChangeTypeAdded = VCSLineChangeTypeKey.String("added")
+ // How many lines were removed.
+ // Stability: development
+ VCSLineChangeTypeRemoved = VCSLineChangeTypeKey.String("removed")
+)
+
+// Enum values for vcs.ref.base.type
+var (
+ // [branch]
+ // Stability: development
+ //
+ // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch
+ VCSRefBaseTypeBranch = VCSRefBaseTypeKey.String("branch")
+ // [tag]
+ // Stability: development
+ //
+ // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag
+ VCSRefBaseTypeTag = VCSRefBaseTypeKey.String("tag")
+)
+
+// Enum values for vcs.ref.head.type
+var (
+ // [branch]
+ // Stability: development
+ //
+ // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch
+ VCSRefHeadTypeBranch = VCSRefHeadTypeKey.String("branch")
+ // [tag]
+ // Stability: development
+ //
+ // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag
+ VCSRefHeadTypeTag = VCSRefHeadTypeKey.String("tag")
+)
+
+// Enum values for vcs.ref.type
+var (
+ // [branch]
+ // Stability: development
+ //
+ // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch
+ VCSRefTypeBranch = VCSRefTypeKey.String("branch")
+ // [tag]
+ // Stability: development
+ //
+ // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag
+ VCSRefTypeTag = VCSRefTypeKey.String("tag")
+)
+
+// Enum values for vcs.revision_delta.direction
+var (
+ // How many revisions the change is behind the target ref.
+ // Stability: development
+ VCSRevisionDeltaDirectionBehind = VCSRevisionDeltaDirectionKey.String("behind")
+ // How many revisions the change is ahead of the target ref.
+ // Stability: development
+ VCSRevisionDeltaDirectionAhead = VCSRevisionDeltaDirectionKey.String("ahead")
+)
+
+// Namespace: webengine
+const (
+ // WebEngineDescriptionKey is the attribute Key conforming to the
+ // "webengine.description" semantic conventions. It represents the additional
+ // description of the web engine (e.g. detailed version and edition
+ // information).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "WildFly Full 21.0.0.Final (WildFly Core 13.0.1.Final) -
+ // 2.2.2.Final"
+ WebEngineDescriptionKey = attribute.Key("webengine.description")
+
+ // WebEngineNameKey is the attribute Key conforming to the "webengine.name"
+ // semantic conventions. It represents the name of the web engine.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "WildFly"
+ WebEngineNameKey = attribute.Key("webengine.name")
+
+ // WebEngineVersionKey is the attribute Key conforming to the
+ // "webengine.version" semantic conventions. It represents the version of the
+ // web engine.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "21.0.0"
+ WebEngineVersionKey = attribute.Key("webengine.version")
+)
+
+// WebEngineDescription returns an attribute KeyValue conforming to the
+// "webengine.description" semantic conventions. It represents the additional
+// description of the web engine (e.g. detailed version and edition information).
+func WebEngineDescription(val string) attribute.KeyValue {
+ return WebEngineDescriptionKey.String(val)
+}
+
+// WebEngineName returns an attribute KeyValue conforming to the "webengine.name"
+// semantic conventions. It represents the name of the web engine.
+func WebEngineName(val string) attribute.KeyValue {
+ return WebEngineNameKey.String(val)
+}
+
+// WebEngineVersion returns an attribute KeyValue conforming to the
+// "webengine.version" semantic conventions. It represents the version of the web
+// engine.
+func WebEngineVersion(val string) attribute.KeyValue {
+ return WebEngineVersionKey.String(val)
+}
\ No newline at end of file
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/doc.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/doc.go
similarity index 65%
rename from vendor/go.opentelemetry.io/otel/semconv/v1.17.0/doc.go
rename to vendor/go.opentelemetry.io/otel/semconv/v1.30.0/doc.go
index e087c9c04..787f5b0f4 100644
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/doc.go
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/doc.go
@@ -4,6 +4,6 @@
// Package semconv implements OpenTelemetry semantic conventions.
//
// OpenTelemetry semantic conventions are agreed standardized naming
-// patterns for OpenTelemetry things. This package represents the conventions
-// as of the v1.17.0 version of the OpenTelemetry specification.
-package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0"
+// patterns for OpenTelemetry things. This package represents the v1.30.0
+// version of the OpenTelemetry semantic conventions.
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0"
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/exception.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/exception.go
similarity index 74%
rename from vendor/go.opentelemetry.io/otel/semconv/v1.17.0/exception.go
rename to vendor/go.opentelemetry.io/otel/semconv/v1.30.0/exception.go
index 137acc67d..4332a795f 100644
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/exception.go
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/exception.go
@@ -1,7 +1,7 @@
// Copyright The OpenTelemetry Authors
// SPDX-License-Identifier: Apache-2.0
-package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0"
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0"
const (
// ExceptionEventName is the name of the Span event representing an exception.
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/metric.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/metric.go
new file mode 100644
index 000000000..fe6beb91d
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/metric.go
@@ -0,0 +1,1750 @@
+// Copyright The OpenTelemetry Authors
+// SPDX-License-Identifier: Apache-2.0
+
+// Code generated from semantic convention specification. DO NOT EDIT.
+
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0"
+
+const (
+ // AzureCosmosDBClientActiveInstanceCount is the metric conforming to the
+ // "azure.cosmosdb.client.active_instance.count" semantic conventions. It
+ // represents the number of active client instances.
+ // Instrument: updowncounter
+ // Unit: {instance}
+ // Stability: development
+ AzureCosmosDBClientActiveInstanceCountName = "azure.cosmosdb.client.active_instance.count"
+ AzureCosmosDBClientActiveInstanceCountUnit = "{instance}"
+ AzureCosmosDBClientActiveInstanceCountDescription = "Number of active client instances"
+ // AzureCosmosDBClientOperationRequestCharge is the metric conforming to the
+ // "azure.cosmosdb.client.operation.request_charge" semantic conventions. It
+ // represents the [Request units] consumed by the operation.
+ //
+ // [Request units]: https://learn.microsoft.com/azure/cosmos-db/request-units
+ // Instrument: histogram
+ // Unit: {request_unit}
+ // Stability: development
+ AzureCosmosDBClientOperationRequestChargeName = "azure.cosmosdb.client.operation.request_charge"
+ AzureCosmosDBClientOperationRequestChargeUnit = "{request_unit}"
+ AzureCosmosDBClientOperationRequestChargeDescription = "[Request units](https://learn.microsoft.com/azure/cosmos-db/request-units) consumed by the operation"
+ // CICDPipelineRunActive is the metric conforming to the
+ // "cicd.pipeline.run.active" semantic conventions. It represents the number of
+ // pipeline runs currently active in the system by state.
+ // Instrument: updowncounter
+ // Unit: {run}
+ // Stability: development
+ CICDPipelineRunActiveName = "cicd.pipeline.run.active"
+ CICDPipelineRunActiveUnit = "{run}"
+ CICDPipelineRunActiveDescription = "The number of pipeline runs currently active in the system by state."
+ // CICDPipelineRunDuration is the metric conforming to the
+ // "cicd.pipeline.run.duration" semantic conventions. It represents the
+ // duration of a pipeline run grouped by pipeline, state and result.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ CICDPipelineRunDurationName = "cicd.pipeline.run.duration"
+ CICDPipelineRunDurationUnit = "s"
+ CICDPipelineRunDurationDescription = "Duration of a pipeline run grouped by pipeline, state and result."
+ // CICDPipelineRunErrors is the metric conforming to the
+ // "cicd.pipeline.run.errors" semantic conventions. It represents the number of
+ // errors encountered in pipeline runs (eg. compile, test failures).
+ // Instrument: counter
+ // Unit: {error}
+ // Stability: development
+ CICDPipelineRunErrorsName = "cicd.pipeline.run.errors"
+ CICDPipelineRunErrorsUnit = "{error}"
+ CICDPipelineRunErrorsDescription = "The number of errors encountered in pipeline runs (eg. compile, test failures)."
+ // CICDSystemErrors is the metric conforming to the "cicd.system.errors"
+ // semantic conventions. It represents the number of errors in a component of
+ // the CICD system (eg. controller, scheduler, agent).
+ // Instrument: counter
+ // Unit: {error}
+ // Stability: development
+ CICDSystemErrorsName = "cicd.system.errors"
+ CICDSystemErrorsUnit = "{error}"
+ CICDSystemErrorsDescription = "The number of errors in a component of the CICD system (eg. controller, scheduler, agent)."
+ // CICDWorkerCount is the metric conforming to the "cicd.worker.count" semantic
+ // conventions. It represents the number of workers on the CICD system by
+ // state.
+ // Instrument: updowncounter
+ // Unit: {count}
+ // Stability: development
+ CICDWorkerCountName = "cicd.worker.count"
+ CICDWorkerCountUnit = "{count}"
+ CICDWorkerCountDescription = "The number of workers on the CICD system by state."
+ // ContainerCPUTime is the metric conforming to the "container.cpu.time"
+ // semantic conventions. It represents the total CPU time consumed.
+ // Instrument: counter
+ // Unit: s
+ // Stability: development
+ ContainerCPUTimeName = "container.cpu.time"
+ ContainerCPUTimeUnit = "s"
+ ContainerCPUTimeDescription = "Total CPU time consumed"
+ // ContainerCPUUsage is the metric conforming to the "container.cpu.usage"
+ // semantic conventions. It represents the container's CPU usage, measured in
+ // cpus. Range from 0 to the number of allocatable CPUs.
+ // Instrument: gauge
+ // Unit: {cpu}
+ // Stability: development
+ ContainerCPUUsageName = "container.cpu.usage"
+ ContainerCPUUsageUnit = "{cpu}"
+ ContainerCPUUsageDescription = "Container's CPU usage, measured in cpus. Range from 0 to the number of allocatable CPUs"
+ // ContainerDiskIo is the metric conforming to the "container.disk.io" semantic
+ // conventions. It represents the disk bytes for the container.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ ContainerDiskIoName = "container.disk.io"
+ ContainerDiskIoUnit = "By"
+ ContainerDiskIoDescription = "Disk bytes for the container."
+ // ContainerMemoryUsage is the metric conforming to the
+ // "container.memory.usage" semantic conventions. It represents the memory
+ // usage of the container.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ ContainerMemoryUsageName = "container.memory.usage"
+ ContainerMemoryUsageUnit = "By"
+ ContainerMemoryUsageDescription = "Memory usage of the container."
+ // ContainerNetworkIo is the metric conforming to the "container.network.io"
+ // semantic conventions. It represents the network bytes for the container.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ ContainerNetworkIoName = "container.network.io"
+ ContainerNetworkIoUnit = "By"
+ ContainerNetworkIoDescription = "Network bytes for the container."
+ // ContainerUptime is the metric conforming to the "container.uptime" semantic
+ // conventions. It represents the time the container has been running.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ ContainerUptimeName = "container.uptime"
+ ContainerUptimeUnit = "s"
+ ContainerUptimeDescription = "The time the container has been running"
+ // DBClientConnectionCount is the metric conforming to the
+ // "db.client.connection.count" semantic conventions. It represents the number
+ // of connections that are currently in state described by the `state`
+ // attribute.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ DBClientConnectionCountName = "db.client.connection.count"
+ DBClientConnectionCountUnit = "{connection}"
+ DBClientConnectionCountDescription = "The number of connections that are currently in state described by the `state` attribute"
+ // DBClientConnectionCreateTime is the metric conforming to the
+ // "db.client.connection.create_time" semantic conventions. It represents the
+ // time it took to create a new connection.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ DBClientConnectionCreateTimeName = "db.client.connection.create_time"
+ DBClientConnectionCreateTimeUnit = "s"
+ DBClientConnectionCreateTimeDescription = "The time it took to create a new connection"
+ // DBClientConnectionIdleMax is the metric conforming to the
+ // "db.client.connection.idle.max" semantic conventions. It represents the
+ // maximum number of idle open connections allowed.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ DBClientConnectionIdleMaxName = "db.client.connection.idle.max"
+ DBClientConnectionIdleMaxUnit = "{connection}"
+ DBClientConnectionIdleMaxDescription = "The maximum number of idle open connections allowed"
+ // DBClientConnectionIdleMin is the metric conforming to the
+ // "db.client.connection.idle.min" semantic conventions. It represents the
+ // minimum number of idle open connections allowed.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ DBClientConnectionIdleMinName = "db.client.connection.idle.min"
+ DBClientConnectionIdleMinUnit = "{connection}"
+ DBClientConnectionIdleMinDescription = "The minimum number of idle open connections allowed"
+ // DBClientConnectionMax is the metric conforming to the
+ // "db.client.connection.max" semantic conventions. It represents the maximum
+ // number of open connections allowed.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ DBClientConnectionMaxName = "db.client.connection.max"
+ DBClientConnectionMaxUnit = "{connection}"
+ DBClientConnectionMaxDescription = "The maximum number of open connections allowed"
+ // DBClientConnectionPendingRequests is the metric conforming to the
+ // "db.client.connection.pending_requests" semantic conventions. It represents
+ // the number of current pending requests for an open connection.
+ // Instrument: updowncounter
+ // Unit: {request}
+ // Stability: development
+ DBClientConnectionPendingRequestsName = "db.client.connection.pending_requests"
+ DBClientConnectionPendingRequestsUnit = "{request}"
+ DBClientConnectionPendingRequestsDescription = "The number of current pending requests for an open connection"
+ // DBClientConnectionTimeouts is the metric conforming to the
+ // "db.client.connection.timeouts" semantic conventions. It represents the
+ // number of connection timeouts that have occurred trying to obtain a
+ // connection from the pool.
+ // Instrument: counter
+ // Unit: {timeout}
+ // Stability: development
+ DBClientConnectionTimeoutsName = "db.client.connection.timeouts"
+ DBClientConnectionTimeoutsUnit = "{timeout}"
+ DBClientConnectionTimeoutsDescription = "The number of connection timeouts that have occurred trying to obtain a connection from the pool"
+ // DBClientConnectionUseTime is the metric conforming to the
+ // "db.client.connection.use_time" semantic conventions. It represents the time
+ // between borrowing a connection and returning it to the pool.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ DBClientConnectionUseTimeName = "db.client.connection.use_time"
+ DBClientConnectionUseTimeUnit = "s"
+ DBClientConnectionUseTimeDescription = "The time between borrowing a connection and returning it to the pool"
+ // DBClientConnectionWaitTime is the metric conforming to the
+ // "db.client.connection.wait_time" semantic conventions. It represents the
+ // time it took to obtain an open connection from the pool.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ DBClientConnectionWaitTimeName = "db.client.connection.wait_time"
+ DBClientConnectionWaitTimeUnit = "s"
+ DBClientConnectionWaitTimeDescription = "The time it took to obtain an open connection from the pool"
+ // DBClientConnectionsCreateTime is the metric conforming to the
+ // "db.client.connections.create_time" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.create_time` instead. Note: the unit
+ // also changed from `ms` to `s`.
+ // Instrument: histogram
+ // Unit: ms
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.create_time`. Note: the unit also changed from `ms` to `s`.
+ DBClientConnectionsCreateTimeName = "db.client.connections.create_time"
+ DBClientConnectionsCreateTimeUnit = "ms"
+ DBClientConnectionsCreateTimeDescription = "Deprecated, use `db.client.connection.create_time` instead. Note: the unit also changed from `ms` to `s`."
+ // DBClientConnectionsIdleMax is the metric conforming to the
+ // "db.client.connections.idle.max" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.idle.max` instead.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.idle.max`.
+ DBClientConnectionsIdleMaxName = "db.client.connections.idle.max"
+ DBClientConnectionsIdleMaxUnit = "{connection}"
+ DBClientConnectionsIdleMaxDescription = "Deprecated, use `db.client.connection.idle.max` instead."
+ // DBClientConnectionsIdleMin is the metric conforming to the
+ // "db.client.connections.idle.min" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.idle.min` instead.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.idle.min`.
+ DBClientConnectionsIdleMinName = "db.client.connections.idle.min"
+ DBClientConnectionsIdleMinUnit = "{connection}"
+ DBClientConnectionsIdleMinDescription = "Deprecated, use `db.client.connection.idle.min` instead."
+ // DBClientConnectionsMax is the metric conforming to the
+ // "db.client.connections.max" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.max` instead.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.max`.
+ DBClientConnectionsMaxName = "db.client.connections.max"
+ DBClientConnectionsMaxUnit = "{connection}"
+ DBClientConnectionsMaxDescription = "Deprecated, use `db.client.connection.max` instead."
+ // DBClientConnectionsPendingRequests is the metric conforming to the
+ // "db.client.connections.pending_requests" semantic conventions. It represents
+ // the deprecated, use `db.client.connection.pending_requests` instead.
+ // Instrument: updowncounter
+ // Unit: {request}
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.pending_requests`.
+ DBClientConnectionsPendingRequestsName = "db.client.connections.pending_requests"
+ DBClientConnectionsPendingRequestsUnit = "{request}"
+ DBClientConnectionsPendingRequestsDescription = "Deprecated, use `db.client.connection.pending_requests` instead."
+ // DBClientConnectionsTimeouts is the metric conforming to the
+ // "db.client.connections.timeouts" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.timeouts` instead.
+ // Instrument: counter
+ // Unit: {timeout}
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.timeouts`.
+ DBClientConnectionsTimeoutsName = "db.client.connections.timeouts"
+ DBClientConnectionsTimeoutsUnit = "{timeout}"
+ DBClientConnectionsTimeoutsDescription = "Deprecated, use `db.client.connection.timeouts` instead."
+ // DBClientConnectionsUsage is the metric conforming to the
+ // "db.client.connections.usage" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.count` instead.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.count`.
+ DBClientConnectionsUsageName = "db.client.connections.usage"
+ DBClientConnectionsUsageUnit = "{connection}"
+ DBClientConnectionsUsageDescription = "Deprecated, use `db.client.connection.count` instead."
+ // DBClientConnectionsUseTime is the metric conforming to the
+ // "db.client.connections.use_time" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.use_time` instead. Note: the unit also
+ // changed from `ms` to `s`.
+ // Instrument: histogram
+ // Unit: ms
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.use_time`. Note: the unit also changed from `ms` to `s`.
+ DBClientConnectionsUseTimeName = "db.client.connections.use_time"
+ DBClientConnectionsUseTimeUnit = "ms"
+ DBClientConnectionsUseTimeDescription = "Deprecated, use `db.client.connection.use_time` instead. Note: the unit also changed from `ms` to `s`."
+ // DBClientConnectionsWaitTime is the metric conforming to the
+ // "db.client.connections.wait_time" semantic conventions. It represents the
+ // deprecated, use `db.client.connection.wait_time` instead. Note: the unit
+ // also changed from `ms` to `s`.
+ // Instrument: histogram
+ // Unit: ms
+ // Stability: development
+ // Deprecated: Replaced by `db.client.connection.wait_time`. Note: the unit also changed from `ms` to `s`.
+ DBClientConnectionsWaitTimeName = "db.client.connections.wait_time"
+ DBClientConnectionsWaitTimeUnit = "ms"
+ DBClientConnectionsWaitTimeDescription = "Deprecated, use `db.client.connection.wait_time` instead. Note: the unit also changed from `ms` to `s`."
+ // DBClientCosmosDBActiveInstanceCount is the metric conforming to the
+ // "db.client.cosmosdb.active_instance.count" semantic conventions. It
+ // represents the deprecated, use `azure.cosmosdb.client.active_instance.count`
+ // instead.
+ // Instrument: updowncounter
+ // Unit: {instance}
+ // Stability: development
+ // Deprecated: Replaced by `azure.cosmosdb.client.active_instance.count`.
+ DBClientCosmosDBActiveInstanceCountName = "db.client.cosmosdb.active_instance.count"
+ DBClientCosmosDBActiveInstanceCountUnit = "{instance}"
+ DBClientCosmosDBActiveInstanceCountDescription = "Deprecated, use `azure.cosmosdb.client.active_instance.count` instead."
+ // DBClientCosmosDBOperationRequestCharge is the metric conforming to the
+ // "db.client.cosmosdb.operation.request_charge" semantic conventions. It
+ // represents the deprecated, use
+ // `azure.cosmosdb.client.operation.request_charge` instead.
+ // Instrument: histogram
+ // Unit: {request_unit}
+ // Stability: development
+ // Deprecated: Replaced by `azure.cosmosdb.client.operation.request_charge`.
+ DBClientCosmosDBOperationRequestChargeName = "db.client.cosmosdb.operation.request_charge"
+ DBClientCosmosDBOperationRequestChargeUnit = "{request_unit}"
+ DBClientCosmosDBOperationRequestChargeDescription = "Deprecated, use `azure.cosmosdb.client.operation.request_charge` instead."
+ // DBClientOperationDuration is the metric conforming to the
+ // "db.client.operation.duration" semantic conventions. It represents the
+ // duration of database client operations.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: release_candidate
+ DBClientOperationDurationName = "db.client.operation.duration"
+ DBClientOperationDurationUnit = "s"
+ DBClientOperationDurationDescription = "Duration of database client operations."
+ // DBClientResponseReturnedRows is the metric conforming to the
+ // "db.client.response.returned_rows" semantic conventions. It represents the
+ // actual number of records returned by the database operation.
+ // Instrument: histogram
+ // Unit: {row}
+ // Stability: development
+ DBClientResponseReturnedRowsName = "db.client.response.returned_rows"
+ DBClientResponseReturnedRowsUnit = "{row}"
+ DBClientResponseReturnedRowsDescription = "The actual number of records returned by the database operation."
+ // DNSLookupDuration is the metric conforming to the "dns.lookup.duration"
+ // semantic conventions. It represents the measures the time taken to perform a
+ // DNS lookup.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ DNSLookupDurationName = "dns.lookup.duration"
+ DNSLookupDurationUnit = "s"
+ DNSLookupDurationDescription = "Measures the time taken to perform a DNS lookup."
+ // FaaSColdstarts is the metric conforming to the "faas.coldstarts" semantic
+ // conventions. It represents the number of invocation cold starts.
+ // Instrument: counter
+ // Unit: {coldstart}
+ // Stability: development
+ FaaSColdstartsName = "faas.coldstarts"
+ FaaSColdstartsUnit = "{coldstart}"
+ FaaSColdstartsDescription = "Number of invocation cold starts"
+ // FaaSCPUUsage is the metric conforming to the "faas.cpu_usage" semantic
+ // conventions. It represents the distribution of CPU usage per invocation.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ FaaSCPUUsageName = "faas.cpu_usage"
+ FaaSCPUUsageUnit = "s"
+ FaaSCPUUsageDescription = "Distribution of CPU usage per invocation"
+ // FaaSErrors is the metric conforming to the "faas.errors" semantic
+ // conventions. It represents the number of invocation errors.
+ // Instrument: counter
+ // Unit: {error}
+ // Stability: development
+ FaaSErrorsName = "faas.errors"
+ FaaSErrorsUnit = "{error}"
+ FaaSErrorsDescription = "Number of invocation errors"
+ // FaaSInitDuration is the metric conforming to the "faas.init_duration"
+ // semantic conventions. It represents the measures the duration of the
+ // function's initialization, such as a cold start.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ FaaSInitDurationName = "faas.init_duration"
+ FaaSInitDurationUnit = "s"
+ FaaSInitDurationDescription = "Measures the duration of the function's initialization, such as a cold start"
+ // FaaSInvocations is the metric conforming to the "faas.invocations" semantic
+ // conventions. It represents the number of successful invocations.
+ // Instrument: counter
+ // Unit: {invocation}
+ // Stability: development
+ FaaSInvocationsName = "faas.invocations"
+ FaaSInvocationsUnit = "{invocation}"
+ FaaSInvocationsDescription = "Number of successful invocations"
+ // FaaSInvokeDuration is the metric conforming to the "faas.invoke_duration"
+ // semantic conventions. It represents the measures the duration of the
+ // function's logic execution.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ FaaSInvokeDurationName = "faas.invoke_duration"
+ FaaSInvokeDurationUnit = "s"
+ FaaSInvokeDurationDescription = "Measures the duration of the function's logic execution"
+ // FaaSMemUsage is the metric conforming to the "faas.mem_usage" semantic
+ // conventions. It represents the distribution of max memory usage per
+ // invocation.
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ FaaSMemUsageName = "faas.mem_usage"
+ FaaSMemUsageUnit = "By"
+ FaaSMemUsageDescription = "Distribution of max memory usage per invocation"
+ // FaaSNetIo is the metric conforming to the "faas.net_io" semantic
+ // conventions. It represents the distribution of net I/O usage per invocation.
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ FaaSNetIoName = "faas.net_io"
+ FaaSNetIoUnit = "By"
+ FaaSNetIoDescription = "Distribution of net I/O usage per invocation"
+ // FaaSTimeouts is the metric conforming to the "faas.timeouts" semantic
+ // conventions. It represents the number of invocation timeouts.
+ // Instrument: counter
+ // Unit: {timeout}
+ // Stability: development
+ FaaSTimeoutsName = "faas.timeouts"
+ FaaSTimeoutsUnit = "{timeout}"
+ FaaSTimeoutsDescription = "Number of invocation timeouts"
+ // GenAIClientOperationDuration is the metric conforming to the
+ // "gen_ai.client.operation.duration" semantic conventions. It represents the
+ // genAI operation duration.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ GenAIClientOperationDurationName = "gen_ai.client.operation.duration"
+ GenAIClientOperationDurationUnit = "s"
+ GenAIClientOperationDurationDescription = "GenAI operation duration"
+ // GenAIClientTokenUsage is the metric conforming to the
+ // "gen_ai.client.token.usage" semantic conventions. It represents the measures
+ // number of input and output tokens used.
+ // Instrument: histogram
+ // Unit: {token}
+ // Stability: development
+ GenAIClientTokenUsageName = "gen_ai.client.token.usage"
+ GenAIClientTokenUsageUnit = "{token}"
+ GenAIClientTokenUsageDescription = "Measures number of input and output tokens used"
+ // GenAIServerRequestDuration is the metric conforming to the
+ // "gen_ai.server.request.duration" semantic conventions. It represents the
+ // generative AI server request duration such as time-to-last byte or last
+ // output token.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ GenAIServerRequestDurationName = "gen_ai.server.request.duration"
+ GenAIServerRequestDurationUnit = "s"
+ GenAIServerRequestDurationDescription = "Generative AI server request duration such as time-to-last byte or last output token"
+ // GenAIServerTimePerOutputToken is the metric conforming to the
+ // "gen_ai.server.time_per_output_token" semantic conventions. It represents
+ // the time per output token generated after the first token for successful
+ // responses.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ GenAIServerTimePerOutputTokenName = "gen_ai.server.time_per_output_token"
+ GenAIServerTimePerOutputTokenUnit = "s"
+ GenAIServerTimePerOutputTokenDescription = "Time per output token generated after the first token for successful responses"
+ // GenAIServerTimeToFirstToken is the metric conforming to the
+ // "gen_ai.server.time_to_first_token" semantic conventions. It represents the
+ // time to generate first token for successful responses.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ GenAIServerTimeToFirstTokenName = "gen_ai.server.time_to_first_token"
+ GenAIServerTimeToFirstTokenUnit = "s"
+ GenAIServerTimeToFirstTokenDescription = "Time to generate first token for successful responses"
+ // GoConfigGogc is the metric conforming to the "go.config.gogc" semantic
+ // conventions. It represents the heap size target percentage configured by the
+ // user, otherwise 100.
+ // Instrument: updowncounter
+ // Unit: %
+ // Stability: development
+ GoConfigGogcName = "go.config.gogc"
+ GoConfigGogcUnit = "%"
+ GoConfigGogcDescription = "Heap size target percentage configured by the user, otherwise 100."
+ // GoGoroutineCount is the metric conforming to the "go.goroutine.count"
+ // semantic conventions. It represents the count of live goroutines.
+ // Instrument: updowncounter
+ // Unit: {goroutine}
+ // Stability: development
+ GoGoroutineCountName = "go.goroutine.count"
+ GoGoroutineCountUnit = "{goroutine}"
+ GoGoroutineCountDescription = "Count of live goroutines."
+ // GoMemoryAllocated is the metric conforming to the "go.memory.allocated"
+ // semantic conventions. It represents the memory allocated to the heap by the
+ // application.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ GoMemoryAllocatedName = "go.memory.allocated"
+ GoMemoryAllocatedUnit = "By"
+ GoMemoryAllocatedDescription = "Memory allocated to the heap by the application."
+ // GoMemoryAllocations is the metric conforming to the "go.memory.allocations"
+ // semantic conventions. It represents the count of allocations to the heap by
+ // the application.
+ // Instrument: counter
+ // Unit: {allocation}
+ // Stability: development
+ GoMemoryAllocationsName = "go.memory.allocations"
+ GoMemoryAllocationsUnit = "{allocation}"
+ GoMemoryAllocationsDescription = "Count of allocations to the heap by the application."
+ // GoMemoryGCGoal is the metric conforming to the "go.memory.gc.goal" semantic
+ // conventions. It represents the heap size target for the end of the GC cycle.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ GoMemoryGCGoalName = "go.memory.gc.goal"
+ GoMemoryGCGoalUnit = "By"
+ GoMemoryGCGoalDescription = "Heap size target for the end of the GC cycle."
+ // GoMemoryLimit is the metric conforming to the "go.memory.limit" semantic
+ // conventions. It represents the go runtime memory limit configured by the
+ // user, if a limit exists.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ GoMemoryLimitName = "go.memory.limit"
+ GoMemoryLimitUnit = "By"
+ GoMemoryLimitDescription = "Go runtime memory limit configured by the user, if a limit exists."
+ // GoMemoryUsed is the metric conforming to the "go.memory.used" semantic
+ // conventions. It represents the memory used by the Go runtime.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ GoMemoryUsedName = "go.memory.used"
+ GoMemoryUsedUnit = "By"
+ GoMemoryUsedDescription = "Memory used by the Go runtime."
+ // GoProcessorLimit is the metric conforming to the "go.processor.limit"
+ // semantic conventions. It represents the number of OS threads that can
+ // execute user-level Go code simultaneously.
+ // Instrument: updowncounter
+ // Unit: {thread}
+ // Stability: development
+ GoProcessorLimitName = "go.processor.limit"
+ GoProcessorLimitUnit = "{thread}"
+ GoProcessorLimitDescription = "The number of OS threads that can execute user-level Go code simultaneously."
+ // GoScheduleDuration is the metric conforming to the "go.schedule.duration"
+ // semantic conventions. It represents the time goroutines have spent in the
+ // scheduler in a runnable state before actually running.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ GoScheduleDurationName = "go.schedule.duration"
+ GoScheduleDurationUnit = "s"
+ GoScheduleDurationDescription = "The time goroutines have spent in the scheduler in a runnable state before actually running."
+ // HTTPClientActiveRequests is the metric conforming to the
+ // "http.client.active_requests" semantic conventions. It represents the number
+ // of active HTTP requests.
+ // Instrument: updowncounter
+ // Unit: {request}
+ // Stability: development
+ HTTPClientActiveRequestsName = "http.client.active_requests"
+ HTTPClientActiveRequestsUnit = "{request}"
+ HTTPClientActiveRequestsDescription = "Number of active HTTP requests."
+ // HTTPClientConnectionDuration is the metric conforming to the
+ // "http.client.connection.duration" semantic conventions. It represents the
+ // duration of the successfully established outbound HTTP connections.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ HTTPClientConnectionDurationName = "http.client.connection.duration"
+ HTTPClientConnectionDurationUnit = "s"
+ HTTPClientConnectionDurationDescription = "The duration of the successfully established outbound HTTP connections."
+ // HTTPClientOpenConnections is the metric conforming to the
+ // "http.client.open_connections" semantic conventions. It represents the
+ // number of outbound HTTP connections that are currently active or idle on the
+ // client.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ HTTPClientOpenConnectionsName = "http.client.open_connections"
+ HTTPClientOpenConnectionsUnit = "{connection}"
+ HTTPClientOpenConnectionsDescription = "Number of outbound HTTP connections that are currently active or idle on the client."
+ // HTTPClientRequestBodySize is the metric conforming to the
+ // "http.client.request.body.size" semantic conventions. It represents the size
+ // of HTTP client request bodies.
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ HTTPClientRequestBodySizeName = "http.client.request.body.size"
+ HTTPClientRequestBodySizeUnit = "By"
+ HTTPClientRequestBodySizeDescription = "Size of HTTP client request bodies."
+ // HTTPClientRequestDuration is the metric conforming to the
+ // "http.client.request.duration" semantic conventions. It represents the
+ // duration of HTTP client requests.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: stable
+ HTTPClientRequestDurationName = "http.client.request.duration"
+ HTTPClientRequestDurationUnit = "s"
+ HTTPClientRequestDurationDescription = "Duration of HTTP client requests."
+ // HTTPClientResponseBodySize is the metric conforming to the
+ // "http.client.response.body.size" semantic conventions. It represents the
+ // size of HTTP client response bodies.
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ HTTPClientResponseBodySizeName = "http.client.response.body.size"
+ HTTPClientResponseBodySizeUnit = "By"
+ HTTPClientResponseBodySizeDescription = "Size of HTTP client response bodies."
+ // HTTPServerActiveRequests is the metric conforming to the
+ // "http.server.active_requests" semantic conventions. It represents the number
+ // of active HTTP server requests.
+ // Instrument: updowncounter
+ // Unit: {request}
+ // Stability: development
+ HTTPServerActiveRequestsName = "http.server.active_requests"
+ HTTPServerActiveRequestsUnit = "{request}"
+ HTTPServerActiveRequestsDescription = "Number of active HTTP server requests."
+ // HTTPServerRequestBodySize is the metric conforming to the
+ // "http.server.request.body.size" semantic conventions. It represents the size
+ // of HTTP server request bodies.
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ HTTPServerRequestBodySizeName = "http.server.request.body.size"
+ HTTPServerRequestBodySizeUnit = "By"
+ HTTPServerRequestBodySizeDescription = "Size of HTTP server request bodies."
+ // HTTPServerRequestDuration is the metric conforming to the
+ // "http.server.request.duration" semantic conventions. It represents the
+ // duration of HTTP server requests.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: stable
+ HTTPServerRequestDurationName = "http.server.request.duration"
+ HTTPServerRequestDurationUnit = "s"
+ HTTPServerRequestDurationDescription = "Duration of HTTP server requests."
+ // HTTPServerResponseBodySize is the metric conforming to the
+ // "http.server.response.body.size" semantic conventions. It represents the
+ // size of HTTP server response bodies.
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ HTTPServerResponseBodySizeName = "http.server.response.body.size"
+ HTTPServerResponseBodySizeUnit = "By"
+ HTTPServerResponseBodySizeDescription = "Size of HTTP server response bodies."
+ // HwEnergy is the metric conforming to the "hw.energy" semantic conventions.
+ // It represents the energy consumed by the component.
+ // Instrument: counter
+ // Unit: J
+ // Stability: development
+ HwEnergyName = "hw.energy"
+ HwEnergyUnit = "J"
+ HwEnergyDescription = "Energy consumed by the component"
+ // HwErrors is the metric conforming to the "hw.errors" semantic conventions.
+ // It represents the number of errors encountered by the component.
+ // Instrument: counter
+ // Unit: {error}
+ // Stability: development
+ HwErrorsName = "hw.errors"
+ HwErrorsUnit = "{error}"
+ HwErrorsDescription = "Number of errors encountered by the component"
+ // HwPower is the metric conforming to the "hw.power" semantic conventions. It
+ // represents the instantaneous power consumed by the component.
+ // Instrument: gauge
+ // Unit: W
+ // Stability: development
+ HwPowerName = "hw.power"
+ HwPowerUnit = "W"
+ HwPowerDescription = "Instantaneous power consumed by the component"
+ // HwStatus is the metric conforming to the "hw.status" semantic conventions.
+ // It represents the operational status: `1` (true) or `0` (false) for each of
+ // the possible states.
+ // Instrument: updowncounter
+ // Unit: 1
+ // Stability: development
+ HwStatusName = "hw.status"
+ HwStatusUnit = "1"
+ HwStatusDescription = "Operational status: `1` (true) or `0` (false) for each of the possible states"
+ // K8SCronJobActiveJobs is the metric conforming to the
+ // "k8s.cronjob.active_jobs" semantic conventions. It represents the number of
+ // actively running jobs for a cronjob.
+ // Instrument: updowncounter
+ // Unit: {job}
+ // Stability: development
+ K8SCronJobActiveJobsName = "k8s.cronjob.active_jobs"
+ K8SCronJobActiveJobsUnit = "{job}"
+ K8SCronJobActiveJobsDescription = "The number of actively running jobs for a cronjob"
+ // K8SDaemonSetCurrentScheduledNodes is the metric conforming to the
+ // "k8s.daemonset.current_scheduled_nodes" semantic conventions. It represents
+ // the number of nodes that are running at least 1 daemon pod and are supposed
+ // to run the daemon pod.
+ // Instrument: updowncounter
+ // Unit: {node}
+ // Stability: development
+ K8SDaemonSetCurrentScheduledNodesName = "k8s.daemonset.current_scheduled_nodes"
+ K8SDaemonSetCurrentScheduledNodesUnit = "{node}"
+ K8SDaemonSetCurrentScheduledNodesDescription = "Number of nodes that are running at least 1 daemon pod and are supposed to run the daemon pod"
+ // K8SDaemonSetDesiredScheduledNodes is the metric conforming to the
+ // "k8s.daemonset.desired_scheduled_nodes" semantic conventions. It represents
+ // the number of nodes that should be running the daemon pod (including nodes
+ // currently running the daemon pod).
+ // Instrument: updowncounter
+ // Unit: {node}
+ // Stability: development
+ K8SDaemonSetDesiredScheduledNodesName = "k8s.daemonset.desired_scheduled_nodes"
+ K8SDaemonSetDesiredScheduledNodesUnit = "{node}"
+ K8SDaemonSetDesiredScheduledNodesDescription = "Number of nodes that should be running the daemon pod (including nodes currently running the daemon pod)"
+ // K8SDaemonSetMisscheduledNodes is the metric conforming to the
+ // "k8s.daemonset.misscheduled_nodes" semantic conventions. It represents the
+ // number of nodes that are running the daemon pod, but are not supposed to run
+ // the daemon pod.
+ // Instrument: updowncounter
+ // Unit: {node}
+ // Stability: development
+ K8SDaemonSetMisscheduledNodesName = "k8s.daemonset.misscheduled_nodes"
+ K8SDaemonSetMisscheduledNodesUnit = "{node}"
+ K8SDaemonSetMisscheduledNodesDescription = "Number of nodes that are running the daemon pod, but are not supposed to run the daemon pod"
+ // K8SDaemonSetReadyNodes is the metric conforming to the
+ // "k8s.daemonset.ready_nodes" semantic conventions. It represents the number
+ // of nodes that should be running the daemon pod and have one or more of the
+ // daemon pod running and ready.
+ // Instrument: updowncounter
+ // Unit: {node}
+ // Stability: development
+ K8SDaemonSetReadyNodesName = "k8s.daemonset.ready_nodes"
+ K8SDaemonSetReadyNodesUnit = "{node}"
+ K8SDaemonSetReadyNodesDescription = "Number of nodes that should be running the daemon pod and have one or more of the daemon pod running and ready"
+ // K8SDeploymentAvailablePods is the metric conforming to the
+ // "k8s.deployment.available_pods" semantic conventions. It represents the
+ // total number of available replica pods (ready for at least minReadySeconds)
+ // targeted by this deployment.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SDeploymentAvailablePodsName = "k8s.deployment.available_pods"
+ K8SDeploymentAvailablePodsUnit = "{pod}"
+ K8SDeploymentAvailablePodsDescription = "Total number of available replica pods (ready for at least minReadySeconds) targeted by this deployment"
+ // K8SDeploymentDesiredPods is the metric conforming to the
+ // "k8s.deployment.desired_pods" semantic conventions. It represents the number
+ // of desired replica pods in this deployment.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SDeploymentDesiredPodsName = "k8s.deployment.desired_pods"
+ K8SDeploymentDesiredPodsUnit = "{pod}"
+ K8SDeploymentDesiredPodsDescription = "Number of desired replica pods in this deployment"
+ // K8SHpaCurrentPods is the metric conforming to the "k8s.hpa.current_pods"
+ // semantic conventions. It represents the current number of replica pods
+ // managed by this horizontal pod autoscaler, as last seen by the autoscaler.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SHpaCurrentPodsName = "k8s.hpa.current_pods"
+ K8SHpaCurrentPodsUnit = "{pod}"
+ K8SHpaCurrentPodsDescription = "Current number of replica pods managed by this horizontal pod autoscaler, as last seen by the autoscaler"
+ // K8SHpaDesiredPods is the metric conforming to the "k8s.hpa.desired_pods"
+ // semantic conventions. It represents the desired number of replica pods
+ // managed by this horizontal pod autoscaler, as last calculated by the
+ // autoscaler.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SHpaDesiredPodsName = "k8s.hpa.desired_pods"
+ K8SHpaDesiredPodsUnit = "{pod}"
+ K8SHpaDesiredPodsDescription = "Desired number of replica pods managed by this horizontal pod autoscaler, as last calculated by the autoscaler"
+ // K8SHpaMaxPods is the metric conforming to the "k8s.hpa.max_pods" semantic
+ // conventions. It represents the upper limit for the number of replica pods to
+ // which the autoscaler can scale up.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SHpaMaxPodsName = "k8s.hpa.max_pods"
+ K8SHpaMaxPodsUnit = "{pod}"
+ K8SHpaMaxPodsDescription = "The upper limit for the number of replica pods to which the autoscaler can scale up"
+ // K8SHpaMinPods is the metric conforming to the "k8s.hpa.min_pods" semantic
+ // conventions. It represents the lower limit for the number of replica pods to
+ // which the autoscaler can scale down.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SHpaMinPodsName = "k8s.hpa.min_pods"
+ K8SHpaMinPodsUnit = "{pod}"
+ K8SHpaMinPodsDescription = "The lower limit for the number of replica pods to which the autoscaler can scale down"
+ // K8SJobActivePods is the metric conforming to the "k8s.job.active_pods"
+ // semantic conventions. It represents the number of pending and actively
+ // running pods for a job.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SJobActivePodsName = "k8s.job.active_pods"
+ K8SJobActivePodsUnit = "{pod}"
+ K8SJobActivePodsDescription = "The number of pending and actively running pods for a job"
+ // K8SJobDesiredSuccessfulPods is the metric conforming to the
+ // "k8s.job.desired_successful_pods" semantic conventions. It represents the
+ // desired number of successfully finished pods the job should be run with.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SJobDesiredSuccessfulPodsName = "k8s.job.desired_successful_pods"
+ K8SJobDesiredSuccessfulPodsUnit = "{pod}"
+ K8SJobDesiredSuccessfulPodsDescription = "The desired number of successfully finished pods the job should be run with"
+ // K8SJobFailedPods is the metric conforming to the "k8s.job.failed_pods"
+ // semantic conventions. It represents the number of pods which reached phase
+ // Failed for a job.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SJobFailedPodsName = "k8s.job.failed_pods"
+ K8SJobFailedPodsUnit = "{pod}"
+ K8SJobFailedPodsDescription = "The number of pods which reached phase Failed for a job"
+ // K8SJobMaxParallelPods is the metric conforming to the
+ // "k8s.job.max_parallel_pods" semantic conventions. It represents the max
+ // desired number of pods the job should run at any given time.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SJobMaxParallelPodsName = "k8s.job.max_parallel_pods"
+ K8SJobMaxParallelPodsUnit = "{pod}"
+ K8SJobMaxParallelPodsDescription = "The max desired number of pods the job should run at any given time"
+ // K8SJobSuccessfulPods is the metric conforming to the
+ // "k8s.job.successful_pods" semantic conventions. It represents the number of
+ // pods which reached phase Succeeded for a job.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SJobSuccessfulPodsName = "k8s.job.successful_pods"
+ K8SJobSuccessfulPodsUnit = "{pod}"
+ K8SJobSuccessfulPodsDescription = "The number of pods which reached phase Succeeded for a job"
+ // K8SNamespacePhase is the metric conforming to the "k8s.namespace.phase"
+ // semantic conventions. It represents the describes number of K8s namespaces
+ // that are currently in a given phase.
+ // Instrument: updowncounter
+ // Unit: {namespace}
+ // Stability: development
+ K8SNamespacePhaseName = "k8s.namespace.phase"
+ K8SNamespacePhaseUnit = "{namespace}"
+ K8SNamespacePhaseDescription = "Describes number of K8s namespaces that are currently in a given phase."
+ // K8SNodeCPUTime is the metric conforming to the "k8s.node.cpu.time" semantic
+ // conventions. It represents the total CPU time consumed.
+ // Instrument: counter
+ // Unit: s
+ // Stability: development
+ K8SNodeCPUTimeName = "k8s.node.cpu.time"
+ K8SNodeCPUTimeUnit = "s"
+ K8SNodeCPUTimeDescription = "Total CPU time consumed"
+ // K8SNodeCPUUsage is the metric conforming to the "k8s.node.cpu.usage"
+ // semantic conventions. It represents the node's CPU usage, measured in cpus.
+ // Range from 0 to the number of allocatable CPUs.
+ // Instrument: gauge
+ // Unit: {cpu}
+ // Stability: development
+ K8SNodeCPUUsageName = "k8s.node.cpu.usage"
+ K8SNodeCPUUsageUnit = "{cpu}"
+ K8SNodeCPUUsageDescription = "Node's CPU usage, measured in cpus. Range from 0 to the number of allocatable CPUs"
+ // K8SNodeMemoryUsage is the metric conforming to the "k8s.node.memory.usage"
+ // semantic conventions. It represents the memory usage of the Node.
+ // Instrument: gauge
+ // Unit: By
+ // Stability: development
+ K8SNodeMemoryUsageName = "k8s.node.memory.usage"
+ K8SNodeMemoryUsageUnit = "By"
+ K8SNodeMemoryUsageDescription = "Memory usage of the Node"
+ // K8SNodeNetworkErrors is the metric conforming to the
+ // "k8s.node.network.errors" semantic conventions. It represents the node
+ // network errors.
+ // Instrument: counter
+ // Unit: {error}
+ // Stability: development
+ K8SNodeNetworkErrorsName = "k8s.node.network.errors"
+ K8SNodeNetworkErrorsUnit = "{error}"
+ K8SNodeNetworkErrorsDescription = "Node network errors"
+ // K8SNodeNetworkIo is the metric conforming to the "k8s.node.network.io"
+ // semantic conventions. It represents the network bytes for the Node.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ K8SNodeNetworkIoName = "k8s.node.network.io"
+ K8SNodeNetworkIoUnit = "By"
+ K8SNodeNetworkIoDescription = "Network bytes for the Node"
+ // K8SNodeUptime is the metric conforming to the "k8s.node.uptime" semantic
+ // conventions. It represents the time the Node has been running.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ K8SNodeUptimeName = "k8s.node.uptime"
+ K8SNodeUptimeUnit = "s"
+ K8SNodeUptimeDescription = "The time the Node has been running"
+ // K8SPodCPUTime is the metric conforming to the "k8s.pod.cpu.time" semantic
+ // conventions. It represents the total CPU time consumed.
+ // Instrument: counter
+ // Unit: s
+ // Stability: development
+ K8SPodCPUTimeName = "k8s.pod.cpu.time"
+ K8SPodCPUTimeUnit = "s"
+ K8SPodCPUTimeDescription = "Total CPU time consumed"
+ // K8SPodCPUUsage is the metric conforming to the "k8s.pod.cpu.usage" semantic
+ // conventions. It represents the pod's CPU usage, measured in cpus. Range from
+ // 0 to the number of allocatable CPUs.
+ // Instrument: gauge
+ // Unit: {cpu}
+ // Stability: development
+ K8SPodCPUUsageName = "k8s.pod.cpu.usage"
+ K8SPodCPUUsageUnit = "{cpu}"
+ K8SPodCPUUsageDescription = "Pod's CPU usage, measured in cpus. Range from 0 to the number of allocatable CPUs"
+ // K8SPodMemoryUsage is the metric conforming to the "k8s.pod.memory.usage"
+ // semantic conventions. It represents the memory usage of the Pod.
+ // Instrument: gauge
+ // Unit: By
+ // Stability: development
+ K8SPodMemoryUsageName = "k8s.pod.memory.usage"
+ K8SPodMemoryUsageUnit = "By"
+ K8SPodMemoryUsageDescription = "Memory usage of the Pod"
+ // K8SPodNetworkErrors is the metric conforming to the "k8s.pod.network.errors"
+ // semantic conventions. It represents the pod network errors.
+ // Instrument: counter
+ // Unit: {error}
+ // Stability: development
+ K8SPodNetworkErrorsName = "k8s.pod.network.errors"
+ K8SPodNetworkErrorsUnit = "{error}"
+ K8SPodNetworkErrorsDescription = "Pod network errors"
+ // K8SPodNetworkIo is the metric conforming to the "k8s.pod.network.io"
+ // semantic conventions. It represents the network bytes for the Pod.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ K8SPodNetworkIoName = "k8s.pod.network.io"
+ K8SPodNetworkIoUnit = "By"
+ K8SPodNetworkIoDescription = "Network bytes for the Pod"
+ // K8SPodUptime is the metric conforming to the "k8s.pod.uptime" semantic
+ // conventions. It represents the time the Pod has been running.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ K8SPodUptimeName = "k8s.pod.uptime"
+ K8SPodUptimeUnit = "s"
+ K8SPodUptimeDescription = "The time the Pod has been running"
+ // K8SReplicaSetAvailablePods is the metric conforming to the
+ // "k8s.replicaset.available_pods" semantic conventions. It represents the
+ // total number of available replica pods (ready for at least minReadySeconds)
+ // targeted by this replicaset.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SReplicaSetAvailablePodsName = "k8s.replicaset.available_pods"
+ K8SReplicaSetAvailablePodsUnit = "{pod}"
+ K8SReplicaSetAvailablePodsDescription = "Total number of available replica pods (ready for at least minReadySeconds) targeted by this replicaset"
+ // K8SReplicaSetDesiredPods is the metric conforming to the
+ // "k8s.replicaset.desired_pods" semantic conventions. It represents the number
+ // of desired replica pods in this replicaset.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SReplicaSetDesiredPodsName = "k8s.replicaset.desired_pods"
+ K8SReplicaSetDesiredPodsUnit = "{pod}"
+ K8SReplicaSetDesiredPodsDescription = "Number of desired replica pods in this replicaset"
+ // K8SReplicationControllerAvailablePods is the metric conforming to the
+ // "k8s.replication_controller.available_pods" semantic conventions. It
+ // represents the total number of available replica pods (ready for at least
+ // minReadySeconds) targeted by this replication controller.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SReplicationControllerAvailablePodsName = "k8s.replication_controller.available_pods"
+ K8SReplicationControllerAvailablePodsUnit = "{pod}"
+ K8SReplicationControllerAvailablePodsDescription = "Total number of available replica pods (ready for at least minReadySeconds) targeted by this replication controller"
+ // K8SReplicationControllerDesiredPods is the metric conforming to the
+ // "k8s.replication_controller.desired_pods" semantic conventions. It
+ // represents the number of desired replica pods in this replication
+ // controller.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SReplicationControllerDesiredPodsName = "k8s.replication_controller.desired_pods"
+ K8SReplicationControllerDesiredPodsUnit = "{pod}"
+ K8SReplicationControllerDesiredPodsDescription = "Number of desired replica pods in this replication controller"
+ // K8SStatefulSetCurrentPods is the metric conforming to the
+ // "k8s.statefulset.current_pods" semantic conventions. It represents the
+ // number of replica pods created by the statefulset controller from the
+ // statefulset version indicated by currentRevision.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SStatefulSetCurrentPodsName = "k8s.statefulset.current_pods"
+ K8SStatefulSetCurrentPodsUnit = "{pod}"
+ K8SStatefulSetCurrentPodsDescription = "The number of replica pods created by the statefulset controller from the statefulset version indicated by currentRevision"
+ // K8SStatefulSetDesiredPods is the metric conforming to the
+ // "k8s.statefulset.desired_pods" semantic conventions. It represents the
+ // number of desired replica pods in this statefulset.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SStatefulSetDesiredPodsName = "k8s.statefulset.desired_pods"
+ K8SStatefulSetDesiredPodsUnit = "{pod}"
+ K8SStatefulSetDesiredPodsDescription = "Number of desired replica pods in this statefulset"
+ // K8SStatefulSetReadyPods is the metric conforming to the
+ // "k8s.statefulset.ready_pods" semantic conventions. It represents the number
+ // of replica pods created for this statefulset with a Ready Condition.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SStatefulSetReadyPodsName = "k8s.statefulset.ready_pods"
+ K8SStatefulSetReadyPodsUnit = "{pod}"
+ K8SStatefulSetReadyPodsDescription = "The number of replica pods created for this statefulset with a Ready Condition"
+ // K8SStatefulSetUpdatedPods is the metric conforming to the
+ // "k8s.statefulset.updated_pods" semantic conventions. It represents the
+ // number of replica pods created by the statefulset controller from the
+ // statefulset version indicated by updateRevision.
+ // Instrument: updowncounter
+ // Unit: {pod}
+ // Stability: development
+ K8SStatefulSetUpdatedPodsName = "k8s.statefulset.updated_pods"
+ K8SStatefulSetUpdatedPodsUnit = "{pod}"
+ K8SStatefulSetUpdatedPodsDescription = "Number of replica pods created by the statefulset controller from the statefulset version indicated by updateRevision"
+ // KestrelActiveConnections is the metric conforming to the
+ // "kestrel.active_connections" semantic conventions. It represents the number
+ // of connections that are currently active on the server.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: stable
+ KestrelActiveConnectionsName = "kestrel.active_connections"
+ KestrelActiveConnectionsUnit = "{connection}"
+ KestrelActiveConnectionsDescription = "Number of connections that are currently active on the server."
+ // KestrelActiveTLSHandshakes is the metric conforming to the
+ // "kestrel.active_tls_handshakes" semantic conventions. It represents the
+ // number of TLS handshakes that are currently in progress on the server.
+ // Instrument: updowncounter
+ // Unit: {handshake}
+ // Stability: stable
+ KestrelActiveTLSHandshakesName = "kestrel.active_tls_handshakes"
+ KestrelActiveTLSHandshakesUnit = "{handshake}"
+ KestrelActiveTLSHandshakesDescription = "Number of TLS handshakes that are currently in progress on the server."
+ // KestrelConnectionDuration is the metric conforming to the
+ // "kestrel.connection.duration" semantic conventions. It represents the
+ // duration of connections on the server.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: stable
+ KestrelConnectionDurationName = "kestrel.connection.duration"
+ KestrelConnectionDurationUnit = "s"
+ KestrelConnectionDurationDescription = "The duration of connections on the server."
+ // KestrelQueuedConnections is the metric conforming to the
+ // "kestrel.queued_connections" semantic conventions. It represents the number
+ // of connections that are currently queued and are waiting to start.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: stable
+ KestrelQueuedConnectionsName = "kestrel.queued_connections"
+ KestrelQueuedConnectionsUnit = "{connection}"
+ KestrelQueuedConnectionsDescription = "Number of connections that are currently queued and are waiting to start."
+ // KestrelQueuedRequests is the metric conforming to the
+ // "kestrel.queued_requests" semantic conventions. It represents the number of
+ // HTTP requests on multiplexed connections (HTTP/2 and HTTP/3) that are
+ // currently queued and are waiting to start.
+ // Instrument: updowncounter
+ // Unit: {request}
+ // Stability: stable
+ KestrelQueuedRequestsName = "kestrel.queued_requests"
+ KestrelQueuedRequestsUnit = "{request}"
+ KestrelQueuedRequestsDescription = "Number of HTTP requests on multiplexed connections (HTTP/2 and HTTP/3) that are currently queued and are waiting to start."
+ // KestrelRejectedConnections is the metric conforming to the
+ // "kestrel.rejected_connections" semantic conventions. It represents the
+ // number of connections rejected by the server.
+ // Instrument: counter
+ // Unit: {connection}
+ // Stability: stable
+ KestrelRejectedConnectionsName = "kestrel.rejected_connections"
+ KestrelRejectedConnectionsUnit = "{connection}"
+ KestrelRejectedConnectionsDescription = "Number of connections rejected by the server."
+ // KestrelTLSHandshakeDuration is the metric conforming to the
+ // "kestrel.tls_handshake.duration" semantic conventions. It represents the
+ // duration of TLS handshakes on the server.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: stable
+ KestrelTLSHandshakeDurationName = "kestrel.tls_handshake.duration"
+ KestrelTLSHandshakeDurationUnit = "s"
+ KestrelTLSHandshakeDurationDescription = "The duration of TLS handshakes on the server."
+ // KestrelUpgradedConnections is the metric conforming to the
+ // "kestrel.upgraded_connections" semantic conventions. It represents the
+ // number of connections that are currently upgraded (WebSockets). .
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: stable
+ KestrelUpgradedConnectionsName = "kestrel.upgraded_connections"
+ KestrelUpgradedConnectionsUnit = "{connection}"
+ KestrelUpgradedConnectionsDescription = "Number of connections that are currently upgraded (WebSockets). ."
+ // MessagingClientConsumedMessages is the metric conforming to the
+ // "messaging.client.consumed.messages" semantic conventions. It represents the
+ // number of messages that were delivered to the application.
+ // Instrument: counter
+ // Unit: {message}
+ // Stability: development
+ MessagingClientConsumedMessagesName = "messaging.client.consumed.messages"
+ MessagingClientConsumedMessagesUnit = "{message}"
+ MessagingClientConsumedMessagesDescription = "Number of messages that were delivered to the application."
+ // MessagingClientOperationDuration is the metric conforming to the
+ // "messaging.client.operation.duration" semantic conventions. It represents
+ // the duration of messaging operation initiated by a producer or consumer
+ // client.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ MessagingClientOperationDurationName = "messaging.client.operation.duration"
+ MessagingClientOperationDurationUnit = "s"
+ MessagingClientOperationDurationDescription = "Duration of messaging operation initiated by a producer or consumer client."
+ // MessagingClientPublishedMessages is the metric conforming to the
+ // "messaging.client.published.messages" semantic conventions. It represents
+ // the deprecated. Use `messaging.client.sent.messages` instead.
+ // Instrument: counter
+ // Unit: {message}
+ // Stability: development
+ // Deprecated: Replaced by `messaging.client.sent.messages`.
+ MessagingClientPublishedMessagesName = "messaging.client.published.messages"
+ MessagingClientPublishedMessagesUnit = "{message}"
+ MessagingClientPublishedMessagesDescription = "Deprecated. Use `messaging.client.sent.messages` instead."
+ // MessagingClientSentMessages is the metric conforming to the
+ // "messaging.client.sent.messages" semantic conventions. It represents the
+ // number of messages producer attempted to send to the broker.
+ // Instrument: counter
+ // Unit: {message}
+ // Stability: development
+ MessagingClientSentMessagesName = "messaging.client.sent.messages"
+ MessagingClientSentMessagesUnit = "{message}"
+ MessagingClientSentMessagesDescription = "Number of messages producer attempted to send to the broker."
+ // MessagingProcessDuration is the metric conforming to the
+ // "messaging.process.duration" semantic conventions. It represents the
+ // duration of processing operation.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ MessagingProcessDurationName = "messaging.process.duration"
+ MessagingProcessDurationUnit = "s"
+ MessagingProcessDurationDescription = "Duration of processing operation."
+ // MessagingProcessMessages is the metric conforming to the
+ // "messaging.process.messages" semantic conventions. It represents the
+ // deprecated. Use `messaging.client.consumed.messages` instead.
+ // Instrument: counter
+ // Unit: {message}
+ // Stability: development
+ // Deprecated: Replaced by `messaging.client.consumed.messages`.
+ MessagingProcessMessagesName = "messaging.process.messages"
+ MessagingProcessMessagesUnit = "{message}"
+ MessagingProcessMessagesDescription = "Deprecated. Use `messaging.client.consumed.messages` instead."
+ // MessagingPublishDuration is the metric conforming to the
+ // "messaging.publish.duration" semantic conventions. It represents the
+ // deprecated. Use `messaging.client.operation.duration` instead.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ // Deprecated: Replaced by `messaging.client.operation.duration`.
+ MessagingPublishDurationName = "messaging.publish.duration"
+ MessagingPublishDurationUnit = "s"
+ MessagingPublishDurationDescription = "Deprecated. Use `messaging.client.operation.duration` instead."
+ // MessagingPublishMessages is the metric conforming to the
+ // "messaging.publish.messages" semantic conventions. It represents the
+ // deprecated. Use `messaging.client.produced.messages` instead.
+ // Instrument: counter
+ // Unit: {message}
+ // Stability: development
+ // Deprecated: Replaced by `messaging.client.produced.messages`.
+ MessagingPublishMessagesName = "messaging.publish.messages"
+ MessagingPublishMessagesUnit = "{message}"
+ MessagingPublishMessagesDescription = "Deprecated. Use `messaging.client.produced.messages` instead."
+ // MessagingReceiveDuration is the metric conforming to the
+ // "messaging.receive.duration" semantic conventions. It represents the
+ // deprecated. Use `messaging.client.operation.duration` instead.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: development
+ // Deprecated: Replaced by `messaging.client.operation.duration`.
+ MessagingReceiveDurationName = "messaging.receive.duration"
+ MessagingReceiveDurationUnit = "s"
+ MessagingReceiveDurationDescription = "Deprecated. Use `messaging.client.operation.duration` instead."
+ // MessagingReceiveMessages is the metric conforming to the
+ // "messaging.receive.messages" semantic conventions. It represents the
+ // deprecated. Use `messaging.client.consumed.messages` instead.
+ // Instrument: counter
+ // Unit: {message}
+ // Stability: development
+ // Deprecated: Replaced by `messaging.client.consumed.messages`.
+ MessagingReceiveMessagesName = "messaging.receive.messages"
+ MessagingReceiveMessagesUnit = "{message}"
+ MessagingReceiveMessagesDescription = "Deprecated. Use `messaging.client.consumed.messages` instead."
+ // ProcessContextSwitches is the metric conforming to the
+ // "process.context_switches" semantic conventions. It represents the number of
+ // times the process has been context switched.
+ // Instrument: counter
+ // Unit: {count}
+ // Stability: development
+ ProcessContextSwitchesName = "process.context_switches"
+ ProcessContextSwitchesUnit = "{count}"
+ ProcessContextSwitchesDescription = "Number of times the process has been context switched."
+ // ProcessCPUTime is the metric conforming to the "process.cpu.time" semantic
+ // conventions. It represents the total CPU seconds broken down by different
+ // states.
+ // Instrument: counter
+ // Unit: s
+ // Stability: development
+ ProcessCPUTimeName = "process.cpu.time"
+ ProcessCPUTimeUnit = "s"
+ ProcessCPUTimeDescription = "Total CPU seconds broken down by different states."
+ // ProcessCPUUtilization is the metric conforming to the
+ // "process.cpu.utilization" semantic conventions. It represents the difference
+ // in process.cpu.time since the last measurement, divided by the elapsed time
+ // and number of CPUs available to the process.
+ // Instrument: gauge
+ // Unit: 1
+ // Stability: development
+ ProcessCPUUtilizationName = "process.cpu.utilization"
+ ProcessCPUUtilizationUnit = "1"
+ ProcessCPUUtilizationDescription = "Difference in process.cpu.time since the last measurement, divided by the elapsed time and number of CPUs available to the process."
+ // ProcessDiskIo is the metric conforming to the "process.disk.io" semantic
+ // conventions. It represents the disk bytes transferred.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ ProcessDiskIoName = "process.disk.io"
+ ProcessDiskIoUnit = "By"
+ ProcessDiskIoDescription = "Disk bytes transferred."
+ // ProcessMemoryUsage is the metric conforming to the "process.memory.usage"
+ // semantic conventions. It represents the amount of physical memory in use.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ ProcessMemoryUsageName = "process.memory.usage"
+ ProcessMemoryUsageUnit = "By"
+ ProcessMemoryUsageDescription = "The amount of physical memory in use."
+ // ProcessMemoryVirtual is the metric conforming to the
+ // "process.memory.virtual" semantic conventions. It represents the amount of
+ // committed virtual memory.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ ProcessMemoryVirtualName = "process.memory.virtual"
+ ProcessMemoryVirtualUnit = "By"
+ ProcessMemoryVirtualDescription = "The amount of committed virtual memory."
+ // ProcessNetworkIo is the metric conforming to the "process.network.io"
+ // semantic conventions. It represents the network bytes transferred.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ ProcessNetworkIoName = "process.network.io"
+ ProcessNetworkIoUnit = "By"
+ ProcessNetworkIoDescription = "Network bytes transferred."
+ // ProcessOpenFileDescriptorCount is the metric conforming to the
+ // "process.open_file_descriptor.count" semantic conventions. It represents the
+ // number of file descriptors in use by the process.
+ // Instrument: updowncounter
+ // Unit: {count}
+ // Stability: development
+ ProcessOpenFileDescriptorCountName = "process.open_file_descriptor.count"
+ ProcessOpenFileDescriptorCountUnit = "{count}"
+ ProcessOpenFileDescriptorCountDescription = "Number of file descriptors in use by the process."
+ // ProcessPagingFaults is the metric conforming to the "process.paging.faults"
+ // semantic conventions. It represents the number of page faults the process
+ // has made.
+ // Instrument: counter
+ // Unit: {fault}
+ // Stability: development
+ ProcessPagingFaultsName = "process.paging.faults"
+ ProcessPagingFaultsUnit = "{fault}"
+ ProcessPagingFaultsDescription = "Number of page faults the process has made."
+ // ProcessThreadCount is the metric conforming to the "process.thread.count"
+ // semantic conventions. It represents the process threads count.
+ // Instrument: updowncounter
+ // Unit: {thread}
+ // Stability: development
+ ProcessThreadCountName = "process.thread.count"
+ ProcessThreadCountUnit = "{thread}"
+ ProcessThreadCountDescription = "Process threads count."
+ // ProcessUptime is the metric conforming to the "process.uptime" semantic
+ // conventions. It represents the time the process has been running.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ ProcessUptimeName = "process.uptime"
+ ProcessUptimeUnit = "s"
+ ProcessUptimeDescription = "The time the process has been running."
+ // RPCClientDuration is the metric conforming to the "rpc.client.duration"
+ // semantic conventions. It represents the measures the duration of outbound
+ // RPC.
+ // Instrument: histogram
+ // Unit: ms
+ // Stability: development
+ RPCClientDurationName = "rpc.client.duration"
+ RPCClientDurationUnit = "ms"
+ RPCClientDurationDescription = "Measures the duration of outbound RPC."
+ // RPCClientRequestSize is the metric conforming to the
+ // "rpc.client.request.size" semantic conventions. It represents the measures
+ // the size of RPC request messages (uncompressed).
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ RPCClientRequestSizeName = "rpc.client.request.size"
+ RPCClientRequestSizeUnit = "By"
+ RPCClientRequestSizeDescription = "Measures the size of RPC request messages (uncompressed)."
+ // RPCClientRequestsPerRPC is the metric conforming to the
+ // "rpc.client.requests_per_rpc" semantic conventions. It represents the
+ // measures the number of messages received per RPC.
+ // Instrument: histogram
+ // Unit: {count}
+ // Stability: development
+ RPCClientRequestsPerRPCName = "rpc.client.requests_per_rpc"
+ RPCClientRequestsPerRPCUnit = "{count}"
+ RPCClientRequestsPerRPCDescription = "Measures the number of messages received per RPC."
+ // RPCClientResponseSize is the metric conforming to the
+ // "rpc.client.response.size" semantic conventions. It represents the measures
+ // the size of RPC response messages (uncompressed).
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ RPCClientResponseSizeName = "rpc.client.response.size"
+ RPCClientResponseSizeUnit = "By"
+ RPCClientResponseSizeDescription = "Measures the size of RPC response messages (uncompressed)."
+ // RPCClientResponsesPerRPC is the metric conforming to the
+ // "rpc.client.responses_per_rpc" semantic conventions. It represents the
+ // measures the number of messages sent per RPC.
+ // Instrument: histogram
+ // Unit: {count}
+ // Stability: development
+ RPCClientResponsesPerRPCName = "rpc.client.responses_per_rpc"
+ RPCClientResponsesPerRPCUnit = "{count}"
+ RPCClientResponsesPerRPCDescription = "Measures the number of messages sent per RPC."
+ // RPCServerDuration is the metric conforming to the "rpc.server.duration"
+ // semantic conventions. It represents the measures the duration of inbound
+ // RPC.
+ // Instrument: histogram
+ // Unit: ms
+ // Stability: development
+ RPCServerDurationName = "rpc.server.duration"
+ RPCServerDurationUnit = "ms"
+ RPCServerDurationDescription = "Measures the duration of inbound RPC."
+ // RPCServerRequestSize is the metric conforming to the
+ // "rpc.server.request.size" semantic conventions. It represents the measures
+ // the size of RPC request messages (uncompressed).
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ RPCServerRequestSizeName = "rpc.server.request.size"
+ RPCServerRequestSizeUnit = "By"
+ RPCServerRequestSizeDescription = "Measures the size of RPC request messages (uncompressed)."
+ // RPCServerRequestsPerRPC is the metric conforming to the
+ // "rpc.server.requests_per_rpc" semantic conventions. It represents the
+ // measures the number of messages received per RPC.
+ // Instrument: histogram
+ // Unit: {count}
+ // Stability: development
+ RPCServerRequestsPerRPCName = "rpc.server.requests_per_rpc"
+ RPCServerRequestsPerRPCUnit = "{count}"
+ RPCServerRequestsPerRPCDescription = "Measures the number of messages received per RPC."
+ // RPCServerResponseSize is the metric conforming to the
+ // "rpc.server.response.size" semantic conventions. It represents the measures
+ // the size of RPC response messages (uncompressed).
+ // Instrument: histogram
+ // Unit: By
+ // Stability: development
+ RPCServerResponseSizeName = "rpc.server.response.size"
+ RPCServerResponseSizeUnit = "By"
+ RPCServerResponseSizeDescription = "Measures the size of RPC response messages (uncompressed)."
+ // RPCServerResponsesPerRPC is the metric conforming to the
+ // "rpc.server.responses_per_rpc" semantic conventions. It represents the
+ // measures the number of messages sent per RPC.
+ // Instrument: histogram
+ // Unit: {count}
+ // Stability: development
+ RPCServerResponsesPerRPCName = "rpc.server.responses_per_rpc"
+ RPCServerResponsesPerRPCUnit = "{count}"
+ RPCServerResponsesPerRPCDescription = "Measures the number of messages sent per RPC."
+ // SignalrServerActiveConnections is the metric conforming to the
+ // "signalr.server.active_connections" semantic conventions. It represents the
+ // number of connections that are currently active on the server.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: stable
+ SignalrServerActiveConnectionsName = "signalr.server.active_connections"
+ SignalrServerActiveConnectionsUnit = "{connection}"
+ SignalrServerActiveConnectionsDescription = "Number of connections that are currently active on the server."
+ // SignalrServerConnectionDuration is the metric conforming to the
+ // "signalr.server.connection.duration" semantic conventions. It represents the
+ // duration of connections on the server.
+ // Instrument: histogram
+ // Unit: s
+ // Stability: stable
+ SignalrServerConnectionDurationName = "signalr.server.connection.duration"
+ SignalrServerConnectionDurationUnit = "s"
+ SignalrServerConnectionDurationDescription = "The duration of connections on the server."
+ // SystemCPUFrequency is the metric conforming to the "system.cpu.frequency"
+ // semantic conventions. It represents the reports the current frequency of the
+ // CPU in Hz.
+ // Instrument: gauge
+ // Unit: {Hz}
+ // Stability: development
+ SystemCPUFrequencyName = "system.cpu.frequency"
+ SystemCPUFrequencyUnit = "{Hz}"
+ SystemCPUFrequencyDescription = "Reports the current frequency of the CPU in Hz"
+ // SystemCPULogicalCount is the metric conforming to the
+ // "system.cpu.logical.count" semantic conventions. It represents the reports
+ // the number of logical (virtual) processor cores created by the operating
+ // system to manage multitasking.
+ // Instrument: updowncounter
+ // Unit: {cpu}
+ // Stability: development
+ SystemCPULogicalCountName = "system.cpu.logical.count"
+ SystemCPULogicalCountUnit = "{cpu}"
+ SystemCPULogicalCountDescription = "Reports the number of logical (virtual) processor cores created by the operating system to manage multitasking"
+ // SystemCPUPhysicalCount is the metric conforming to the
+ // "system.cpu.physical.count" semantic conventions. It represents the reports
+ // the number of actual physical processor cores on the hardware.
+ // Instrument: updowncounter
+ // Unit: {cpu}
+ // Stability: development
+ SystemCPUPhysicalCountName = "system.cpu.physical.count"
+ SystemCPUPhysicalCountUnit = "{cpu}"
+ SystemCPUPhysicalCountDescription = "Reports the number of actual physical processor cores on the hardware"
+ // SystemCPUTime is the metric conforming to the "system.cpu.time" semantic
+ // conventions. It represents the seconds each logical CPU spent on each mode.
+ // Instrument: counter
+ // Unit: s
+ // Stability: development
+ SystemCPUTimeName = "system.cpu.time"
+ SystemCPUTimeUnit = "s"
+ SystemCPUTimeDescription = "Seconds each logical CPU spent on each mode"
+ // SystemCPUUtilization is the metric conforming to the
+ // "system.cpu.utilization" semantic conventions. It represents the difference
+ // in system.cpu.time since the last measurement, divided by the elapsed time
+ // and number of logical CPUs.
+ // Instrument: gauge
+ // Unit: 1
+ // Stability: development
+ SystemCPUUtilizationName = "system.cpu.utilization"
+ SystemCPUUtilizationUnit = "1"
+ SystemCPUUtilizationDescription = "Difference in system.cpu.time since the last measurement, divided by the elapsed time and number of logical CPUs"
+ // SystemDiskIo is the metric conforming to the "system.disk.io" semantic
+ // conventions.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemDiskIoName = "system.disk.io"
+ SystemDiskIoUnit = "By"
+ // SystemDiskIoTime is the metric conforming to the "system.disk.io_time"
+ // semantic conventions. It represents the time disk spent activated.
+ // Instrument: counter
+ // Unit: s
+ // Stability: development
+ SystemDiskIoTimeName = "system.disk.io_time"
+ SystemDiskIoTimeUnit = "s"
+ SystemDiskIoTimeDescription = "Time disk spent activated"
+ // SystemDiskLimit is the metric conforming to the "system.disk.limit" semantic
+ // conventions. It represents the total storage capacity of the disk.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemDiskLimitName = "system.disk.limit"
+ SystemDiskLimitUnit = "By"
+ SystemDiskLimitDescription = "The total storage capacity of the disk"
+ // SystemDiskMerged is the metric conforming to the "system.disk.merged"
+ // semantic conventions.
+ // Instrument: counter
+ // Unit: {operation}
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemDiskMergedName = "system.disk.merged"
+ SystemDiskMergedUnit = "{operation}"
+ // SystemDiskOperationTime is the metric conforming to the
+ // "system.disk.operation_time" semantic conventions. It represents the sum of
+ // the time each operation took to complete.
+ // Instrument: counter
+ // Unit: s
+ // Stability: development
+ SystemDiskOperationTimeName = "system.disk.operation_time"
+ SystemDiskOperationTimeUnit = "s"
+ SystemDiskOperationTimeDescription = "Sum of the time each operation took to complete"
+ // SystemDiskOperations is the metric conforming to the
+ // "system.disk.operations" semantic conventions.
+ // Instrument: counter
+ // Unit: {operation}
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemDiskOperationsName = "system.disk.operations"
+ SystemDiskOperationsUnit = "{operation}"
+ // SystemFilesystemLimit is the metric conforming to the
+ // "system.filesystem.limit" semantic conventions. It represents the total
+ // storage capacity of the filesystem.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemFilesystemLimitName = "system.filesystem.limit"
+ SystemFilesystemLimitUnit = "By"
+ SystemFilesystemLimitDescription = "The total storage capacity of the filesystem"
+ // SystemFilesystemUsage is the metric conforming to the
+ // "system.filesystem.usage" semantic conventions. It represents the reports a
+ // filesystem's space usage across different states.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemFilesystemUsageName = "system.filesystem.usage"
+ SystemFilesystemUsageUnit = "By"
+ SystemFilesystemUsageDescription = "Reports a filesystem's space usage across different states."
+ // SystemFilesystemUtilization is the metric conforming to the
+ // "system.filesystem.utilization" semantic conventions.
+ // Instrument: gauge
+ // Unit: 1
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemFilesystemUtilizationName = "system.filesystem.utilization"
+ SystemFilesystemUtilizationUnit = "1"
+ // SystemLinuxMemoryAvailable is the metric conforming to the
+ // "system.linux.memory.available" semantic conventions. It represents an
+ // estimate of how much memory is available for starting new applications,
+ // without causing swapping.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemLinuxMemoryAvailableName = "system.linux.memory.available"
+ SystemLinuxMemoryAvailableUnit = "By"
+ SystemLinuxMemoryAvailableDescription = "An estimate of how much memory is available for starting new applications, without causing swapping"
+ // SystemLinuxMemorySlabUsage is the metric conforming to the
+ // "system.linux.memory.slab.usage" semantic conventions. It represents the
+ // reports the memory used by the Linux kernel for managing caches of
+ // frequently used objects.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemLinuxMemorySlabUsageName = "system.linux.memory.slab.usage"
+ SystemLinuxMemorySlabUsageUnit = "By"
+ SystemLinuxMemorySlabUsageDescription = "Reports the memory used by the Linux kernel for managing caches of frequently used objects."
+ // SystemMemoryLimit is the metric conforming to the "system.memory.limit"
+ // semantic conventions. It represents the total memory available in the
+ // system.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemMemoryLimitName = "system.memory.limit"
+ SystemMemoryLimitUnit = "By"
+ SystemMemoryLimitDescription = "Total memory available in the system."
+ // SystemMemoryShared is the metric conforming to the "system.memory.shared"
+ // semantic conventions. It represents the shared memory used (mostly by
+ // tmpfs).
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemMemorySharedName = "system.memory.shared"
+ SystemMemorySharedUnit = "By"
+ SystemMemorySharedDescription = "Shared memory used (mostly by tmpfs)."
+ // SystemMemoryUsage is the metric conforming to the "system.memory.usage"
+ // semantic conventions. It represents the reports memory in use by state.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemMemoryUsageName = "system.memory.usage"
+ SystemMemoryUsageUnit = "By"
+ SystemMemoryUsageDescription = "Reports memory in use by state."
+ // SystemMemoryUtilization is the metric conforming to the
+ // "system.memory.utilization" semantic conventions.
+ // Instrument: gauge
+ // Unit: 1
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemMemoryUtilizationName = "system.memory.utilization"
+ SystemMemoryUtilizationUnit = "1"
+ // SystemNetworkConnections is the metric conforming to the
+ // "system.network.connections" semantic conventions.
+ // Instrument: updowncounter
+ // Unit: {connection}
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemNetworkConnectionsName = "system.network.connections"
+ SystemNetworkConnectionsUnit = "{connection}"
+ // SystemNetworkDropped is the metric conforming to the
+ // "system.network.dropped" semantic conventions. It represents the count of
+ // packets that are dropped or discarded even though there was no error.
+ // Instrument: counter
+ // Unit: {packet}
+ // Stability: development
+ SystemNetworkDroppedName = "system.network.dropped"
+ SystemNetworkDroppedUnit = "{packet}"
+ SystemNetworkDroppedDescription = "Count of packets that are dropped or discarded even though there was no error"
+ // SystemNetworkErrors is the metric conforming to the "system.network.errors"
+ // semantic conventions. It represents the count of network errors detected.
+ // Instrument: counter
+ // Unit: {error}
+ // Stability: development
+ SystemNetworkErrorsName = "system.network.errors"
+ SystemNetworkErrorsUnit = "{error}"
+ SystemNetworkErrorsDescription = "Count of network errors detected"
+ // SystemNetworkIo is the metric conforming to the "system.network.io" semantic
+ // conventions.
+ // Instrument: counter
+ // Unit: By
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemNetworkIoName = "system.network.io"
+ SystemNetworkIoUnit = "By"
+ // SystemNetworkPackets is the metric conforming to the
+ // "system.network.packets" semantic conventions.
+ // Instrument: counter
+ // Unit: {packet}
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemNetworkPacketsName = "system.network.packets"
+ SystemNetworkPacketsUnit = "{packet}"
+ // SystemPagingFaults is the metric conforming to the "system.paging.faults"
+ // semantic conventions.
+ // Instrument: counter
+ // Unit: {fault}
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemPagingFaultsName = "system.paging.faults"
+ SystemPagingFaultsUnit = "{fault}"
+ // SystemPagingOperations is the metric conforming to the
+ // "system.paging.operations" semantic conventions.
+ // Instrument: counter
+ // Unit: {operation}
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemPagingOperationsName = "system.paging.operations"
+ SystemPagingOperationsUnit = "{operation}"
+ // SystemPagingUsage is the metric conforming to the "system.paging.usage"
+ // semantic conventions. It represents the unix swap or windows pagefile usage.
+ // Instrument: updowncounter
+ // Unit: By
+ // Stability: development
+ SystemPagingUsageName = "system.paging.usage"
+ SystemPagingUsageUnit = "By"
+ SystemPagingUsageDescription = "Unix swap or windows pagefile usage"
+ // SystemPagingUtilization is the metric conforming to the
+ // "system.paging.utilization" semantic conventions.
+ // Instrument: gauge
+ // Unit: 1
+ // Stability: development
+ // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository.
+ SystemPagingUtilizationName = "system.paging.utilization"
+ SystemPagingUtilizationUnit = "1"
+ // SystemProcessCount is the metric conforming to the "system.process.count"
+ // semantic conventions. It represents the total number of processes in each
+ // state.
+ // Instrument: updowncounter
+ // Unit: {process}
+ // Stability: development
+ SystemProcessCountName = "system.process.count"
+ SystemProcessCountUnit = "{process}"
+ SystemProcessCountDescription = "Total number of processes in each state"
+ // SystemProcessCreated is the metric conforming to the
+ // "system.process.created" semantic conventions. It represents the total
+ // number of processes created over uptime of the host.
+ // Instrument: counter
+ // Unit: {process}
+ // Stability: development
+ SystemProcessCreatedName = "system.process.created"
+ SystemProcessCreatedUnit = "{process}"
+ SystemProcessCreatedDescription = "Total number of processes created over uptime of the host"
+ // SystemUptime is the metric conforming to the "system.uptime" semantic
+ // conventions. It represents the time the system has been running.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ SystemUptimeName = "system.uptime"
+ SystemUptimeUnit = "s"
+ SystemUptimeDescription = "The time the system has been running"
+ // VCSChangeCount is the metric conforming to the "vcs.change.count" semantic
+ // conventions. It represents the number of changes (pull requests/merge
+ // requests/changelists) in a repository, categorized by their state (e.g. open
+ // or merged).
+ // Instrument: updowncounter
+ // Unit: {change}
+ // Stability: development
+ VCSChangeCountName = "vcs.change.count"
+ VCSChangeCountUnit = "{change}"
+ VCSChangeCountDescription = "The number of changes (pull requests/merge requests/changelists) in a repository, categorized by their state (e.g. open or merged)"
+ // VCSChangeDuration is the metric conforming to the "vcs.change.duration"
+ // semantic conventions. It represents the time duration a change (pull
+ // request/merge request/changelist) has been in a given state.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ VCSChangeDurationName = "vcs.change.duration"
+ VCSChangeDurationUnit = "s"
+ VCSChangeDurationDescription = "The time duration a change (pull request/merge request/changelist) has been in a given state."
+ // VCSChangeTimeToApproval is the metric conforming to the
+ // "vcs.change.time_to_approval" semantic conventions. It represents the amount
+ // of time since its creation it took a change (pull request/merge
+ // request/changelist) to get the first approval.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ VCSChangeTimeToApprovalName = "vcs.change.time_to_approval"
+ VCSChangeTimeToApprovalUnit = "s"
+ VCSChangeTimeToApprovalDescription = "The amount of time since its creation it took a change (pull request/merge request/changelist) to get the first approval."
+ // VCSChangeTimeToMerge is the metric conforming to the
+ // "vcs.change.time_to_merge" semantic conventions. It represents the amount of
+ // time since its creation it took a change (pull request/merge
+ // request/changelist) to get merged into the target(base) ref.
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ VCSChangeTimeToMergeName = "vcs.change.time_to_merge"
+ VCSChangeTimeToMergeUnit = "s"
+ VCSChangeTimeToMergeDescription = "The amount of time since its creation it took a change (pull request/merge request/changelist) to get merged into the target(base) ref."
+ // VCSContributorCount is the metric conforming to the "vcs.contributor.count"
+ // semantic conventions. It represents the number of unique contributors to a
+ // repository.
+ // Instrument: gauge
+ // Unit: {contributor}
+ // Stability: development
+ VCSContributorCountName = "vcs.contributor.count"
+ VCSContributorCountUnit = "{contributor}"
+ VCSContributorCountDescription = "The number of unique contributors to a repository"
+ // VCSRefCount is the metric conforming to the "vcs.ref.count" semantic
+ // conventions. It represents the number of refs of type branch or tag in a
+ // repository.
+ // Instrument: updowncounter
+ // Unit: {ref}
+ // Stability: development
+ VCSRefCountName = "vcs.ref.count"
+ VCSRefCountUnit = "{ref}"
+ VCSRefCountDescription = "The number of refs of type branch or tag in a repository."
+ // VCSRefLinesDelta is the metric conforming to the "vcs.ref.lines_delta"
+ // semantic conventions. It represents the number of lines added/removed in a
+ // ref (branch) relative to the ref from the `vcs.ref.base.name` attribute.
+ // Instrument: gauge
+ // Unit: {line}
+ // Stability: development
+ VCSRefLinesDeltaName = "vcs.ref.lines_delta"
+ VCSRefLinesDeltaUnit = "{line}"
+ VCSRefLinesDeltaDescription = "The number of lines added/removed in a ref (branch) relative to the ref from the `vcs.ref.base.name` attribute."
+ // VCSRefRevisionsDelta is the metric conforming to the
+ // "vcs.ref.revisions_delta" semantic conventions. It represents the number of
+ // revisions (commits) a ref (branch) is ahead/behind the branch from the
+ // `vcs.ref.base.name` attribute.
+ // Instrument: gauge
+ // Unit: {revision}
+ // Stability: development
+ VCSRefRevisionsDeltaName = "vcs.ref.revisions_delta"
+ VCSRefRevisionsDeltaUnit = "{revision}"
+ VCSRefRevisionsDeltaDescription = "The number of revisions (commits) a ref (branch) is ahead/behind the branch from the `vcs.ref.base.name` attribute"
+ // VCSRefTime is the metric conforming to the "vcs.ref.time" semantic
+ // conventions. It represents the time a ref (branch) created from the default
+ // branch (trunk) has existed. The `ref.type` attribute will always be `branch`
+ // .
+ // Instrument: gauge
+ // Unit: s
+ // Stability: development
+ VCSRefTimeName = "vcs.ref.time"
+ VCSRefTimeUnit = "s"
+ VCSRefTimeDescription = "Time a ref (branch) created from the default branch (trunk) has existed. The `ref.type` attribute will always be `branch`"
+ // VCSRepositoryCount is the metric conforming to the "vcs.repository.count"
+ // semantic conventions. It represents the number of repositories in an
+ // organization.
+ // Instrument: updowncounter
+ // Unit: {repository}
+ // Stability: development
+ VCSRepositoryCountName = "vcs.repository.count"
+ VCSRepositoryCountUnit = "{repository}"
+ VCSRepositoryCountDescription = "The number of repositories in an organization."
+)
\ No newline at end of file
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/schema.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/schema.go
similarity index 71%
rename from vendor/go.opentelemetry.io/otel/semconv/v1.17.0/schema.go
rename to vendor/go.opentelemetry.io/otel/semconv/v1.30.0/schema.go
index 634a1dce0..b2e7a515a 100644
--- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/schema.go
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/schema.go
@@ -1,9 +1,9 @@
// Copyright The OpenTelemetry Authors
// SPDX-License-Identifier: Apache-2.0
-package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0"
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0"
// SchemaURL is the schema URL that matches the version of the semantic conventions
// that this package defines. Semconv packages starting from v1.4.0 must declare
// non-empty schema URL in the form https://opentelemetry.io/schemas/
-const SchemaURL = "https://opentelemetry.io/schemas/1.17.0"
+const SchemaURL = "https://opentelemetry.io/schemas/1.30.0"
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md
new file mode 100644
index 000000000..02b56115e
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md
@@ -0,0 +1,4 @@
+
+# Migration from v1.33.0 to v1.34.0
+
+The `go.opentelemetry.io/otel/semconv/v1.34.0` package should be a drop-in replacement for `go.opentelemetry.io/otel/semconv/v1.33.0`.
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md
new file mode 100644
index 000000000..fab06c975
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md
@@ -0,0 +1,3 @@
+# Semconv v1.34.0
+
+[](https://pkg.go.dev/go.opentelemetry.io/otel/semconv/v1.34.0)
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go
new file mode 100644
index 000000000..5b5666257
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go
@@ -0,0 +1,13851 @@
+// Copyright The OpenTelemetry Authors
+// SPDX-License-Identifier: Apache-2.0
+
+// Code generated from semantic convention specification. DO NOT EDIT.
+
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0"
+
+import "go.opentelemetry.io/otel/attribute"
+
+// Namespace: android
+const (
+ // AndroidAppStateKey is the attribute Key conforming to the "android.app.state"
+ // semantic conventions. It represents the this attribute represents the state
+ // of the application.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "created"
+ // Note: The Android lifecycle states are defined in
+ // [Activity lifecycle callbacks], and from which the `OS identifiers` are
+ // derived.
+ //
+ // [Activity lifecycle callbacks]: https://developer.android.com/guide/components/activities/activity-lifecycle#lc
+ AndroidAppStateKey = attribute.Key("android.app.state")
+
+ // AndroidOSAPILevelKey is the attribute Key conforming to the
+ // "android.os.api_level" semantic conventions. It represents the uniquely
+ // identifies the framework API revision offered by a version (`os.version`) of
+ // the android operating system. More information can be found [here].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "33", "32"
+ //
+ // [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels
+ AndroidOSAPILevelKey = attribute.Key("android.os.api_level")
+)
+
+// AndroidOSAPILevel returns an attribute KeyValue conforming to the
+// "android.os.api_level" semantic conventions. It represents the uniquely
+// identifies the framework API revision offered by a version (`os.version`) of
+// the android operating system. More information can be found [here].
+//
+// [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels
+func AndroidOSAPILevel(val string) attribute.KeyValue {
+ return AndroidOSAPILevelKey.String(val)
+}
+
+// Enum values for android.app.state
+var (
+ // Any time before Activity.onResume() or, if the app has no Activity,
+ // Context.startService() has been called in the app for the first time.
+ //
+ // Stability: development
+ AndroidAppStateCreated = AndroidAppStateKey.String("created")
+ // Any time after Activity.onPause() or, if the app has no Activity,
+ // Context.stopService() has been called when the app was in the foreground
+ // state.
+ //
+ // Stability: development
+ AndroidAppStateBackground = AndroidAppStateKey.String("background")
+ // Any time after Activity.onResume() or, if the app has no Activity,
+ // Context.startService() has been called when the app was in either the created
+ // or background states.
+ //
+ // Stability: development
+ AndroidAppStateForeground = AndroidAppStateKey.String("foreground")
+)
+
+// Namespace: app
+const (
+ // AppInstallationIDKey is the attribute Key conforming to the
+ // "app.installation.id" semantic conventions. It represents a unique identifier
+ // representing the installation of an application on a specific device.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2ab2916d-a51f-4ac8-80ee-45ac31a28092"
+ // Note: Its value SHOULD persist across launches of the same application
+ // installation, including through application upgrades.
+ // It SHOULD change if the application is uninstalled or if all applications of
+ // the vendor are uninstalled.
+ // Additionally, users might be able to reset this value (e.g. by clearing
+ // application data).
+ // If an app is installed multiple times on the same device (e.g. in different
+ // accounts on Android), each `app.installation.id` SHOULD have a different
+ // value.
+ // If multiple OpenTelemetry SDKs are used within the same application, they
+ // SHOULD use the same value for `app.installation.id`.
+ // Hardware IDs (e.g. serial number, IMEI, MAC address) MUST NOT be used as the
+ // `app.installation.id`.
+ //
+ // For iOS, this value SHOULD be equal to the [vendor identifier].
+ //
+ // For Android, examples of `app.installation.id` implementations include:
+ //
+ // - [Firebase Installation ID].
+ // - A globally unique UUID which is persisted across sessions in your
+ // application.
+ // - [App set ID].
+ // - [`Settings.getString(Settings.Secure.ANDROID_ID)`].
+ //
+ // More information about Android identifier best practices can be found [here]
+ // .
+ //
+ // [vendor identifier]: https://developer.apple.com/documentation/uikit/uidevice/identifierforvendor
+ // [Firebase Installation ID]: https://firebase.google.com/docs/projects/manage-installations
+ // [App set ID]: https://developer.android.com/identity/app-set-id
+ // [`Settings.getString(Settings.Secure.ANDROID_ID)`]: https://developer.android.com/reference/android/provider/Settings.Secure#ANDROID_ID
+ // [here]: https://developer.android.com/training/articles/user-data-ids
+ AppInstallationIDKey = attribute.Key("app.installation.id")
+
+ // AppScreenCoordinateXKey is the attribute Key conforming to the
+ // "app.screen.coordinate.x" semantic conventions. It represents the x
+ // (horizontal) coordinate of a screen coordinate, in screen pixels.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0, 131
+ AppScreenCoordinateXKey = attribute.Key("app.screen.coordinate.x")
+
+ // AppScreenCoordinateYKey is the attribute Key conforming to the
+ // "app.screen.coordinate.y" semantic conventions. It represents the y
+ // (vertical) component of a screen coordinate, in screen pixels.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 12, 99
+ AppScreenCoordinateYKey = attribute.Key("app.screen.coordinate.y")
+
+ // AppWidgetIDKey is the attribute Key conforming to the "app.widget.id"
+ // semantic conventions. It represents an identifier that uniquely
+ // differentiates this widget from other widgets in the same application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "f9bc787d-ff05-48ad-90e1-fca1d46130b3", "submit_order_1829"
+ // Note: A widget is an application component, typically an on-screen visual GUI
+ // element.
+ AppWidgetIDKey = attribute.Key("app.widget.id")
+
+ // AppWidgetNameKey is the attribute Key conforming to the "app.widget.name"
+ // semantic conventions. It represents the name of an application widget.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "submit", "attack", "Clear Cart"
+ // Note: A widget is an application component, typically an on-screen visual GUI
+ // element.
+ AppWidgetNameKey = attribute.Key("app.widget.name")
+)
+
+// AppInstallationID returns an attribute KeyValue conforming to the
+// "app.installation.id" semantic conventions. It represents a unique identifier
+// representing the installation of an application on a specific device.
+func AppInstallationID(val string) attribute.KeyValue {
+ return AppInstallationIDKey.String(val)
+}
+
+// AppScreenCoordinateX returns an attribute KeyValue conforming to the
+// "app.screen.coordinate.x" semantic conventions. It represents the x
+// (horizontal) coordinate of a screen coordinate, in screen pixels.
+func AppScreenCoordinateX(val int) attribute.KeyValue {
+ return AppScreenCoordinateXKey.Int(val)
+}
+
+// AppScreenCoordinateY returns an attribute KeyValue conforming to the
+// "app.screen.coordinate.y" semantic conventions. It represents the y (vertical)
+// component of a screen coordinate, in screen pixels.
+func AppScreenCoordinateY(val int) attribute.KeyValue {
+ return AppScreenCoordinateYKey.Int(val)
+}
+
+// AppWidgetID returns an attribute KeyValue conforming to the "app.widget.id"
+// semantic conventions. It represents an identifier that uniquely differentiates
+// this widget from other widgets in the same application.
+func AppWidgetID(val string) attribute.KeyValue {
+ return AppWidgetIDKey.String(val)
+}
+
+// AppWidgetName returns an attribute KeyValue conforming to the
+// "app.widget.name" semantic conventions. It represents the name of an
+// application widget.
+func AppWidgetName(val string) attribute.KeyValue {
+ return AppWidgetNameKey.String(val)
+}
+
+// Namespace: artifact
+const (
+ // ArtifactAttestationFilenameKey is the attribute Key conforming to the
+ // "artifact.attestation.filename" semantic conventions. It represents the
+ // provenance filename of the built attestation which directly relates to the
+ // build artifact filename. This filename SHOULD accompany the artifact at
+ // publish time. See the [SLSA Relationship] specification for more information.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "golang-binary-amd64-v0.1.0.attestation",
+ // "docker-image-amd64-v0.1.0.intoto.json1", "release-1.tar.gz.attestation",
+ // "file-name-package.tar.gz.intoto.json1"
+ //
+ // [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations
+ ArtifactAttestationFilenameKey = attribute.Key("artifact.attestation.filename")
+
+ // ArtifactAttestationHashKey is the attribute Key conforming to the
+ // "artifact.attestation.hash" semantic conventions. It represents the full
+ // [hash value (see glossary)], of the built attestation. Some envelopes in the
+ // [software attestation space] also refer to this as the **digest**.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1b31dfcd5b7f9267bf2ff47651df1cfb9147b9e4df1f335accf65b4cda498408"
+ //
+ // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ // [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec
+ ArtifactAttestationHashKey = attribute.Key("artifact.attestation.hash")
+
+ // ArtifactAttestationIDKey is the attribute Key conforming to the
+ // "artifact.attestation.id" semantic conventions. It represents the id of the
+ // build [software attestation].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "123"
+ //
+ // [software attestation]: https://slsa.dev/attestation-model
+ ArtifactAttestationIDKey = attribute.Key("artifact.attestation.id")
+
+ // ArtifactFilenameKey is the attribute Key conforming to the
+ // "artifact.filename" semantic conventions. It represents the human readable
+ // file name of the artifact, typically generated during build and release
+ // processes. Often includes the package name and version in the file name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "golang-binary-amd64-v0.1.0", "docker-image-amd64-v0.1.0",
+ // "release-1.tar.gz", "file-name-package.tar.gz"
+ // Note: This file name can also act as the [Package Name]
+ // in cases where the package ecosystem maps accordingly.
+ // Additionally, the artifact [can be published]
+ // for others, but that is not a guarantee.
+ //
+ // [Package Name]: https://slsa.dev/spec/v1.0/terminology#package-model
+ // [can be published]: https://slsa.dev/spec/v1.0/terminology#software-supply-chain
+ ArtifactFilenameKey = attribute.Key("artifact.filename")
+
+ // ArtifactHashKey is the attribute Key conforming to the "artifact.hash"
+ // semantic conventions. It represents the full [hash value (see glossary)],
+ // often found in checksum.txt on a release of the artifact and used to verify
+ // package integrity.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9ff4c52759e2c4ac70b7d517bc7fcdc1cda631ca0045271ddd1b192544f8a3e9"
+ // Note: The specific algorithm used to create the cryptographic hash value is
+ // not defined. In situations where an artifact has multiple
+ // cryptographic hashes, it is up to the implementer to choose which
+ // hash value to set here; this should be the most secure hash algorithm
+ // that is suitable for the situation and consistent with the
+ // corresponding attestation. The implementer can then provide the other
+ // hash values through an additional set of attribute extensions as they
+ // deem necessary.
+ //
+ // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ ArtifactHashKey = attribute.Key("artifact.hash")
+
+ // ArtifactPurlKey is the attribute Key conforming to the "artifact.purl"
+ // semantic conventions. It represents the [Package URL] of the
+ // [package artifact] provides a standard way to identify and locate the
+ // packaged artifact.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pkg:github/package-url/purl-spec@1209109710924",
+ // "pkg:npm/foo@12.12.3"
+ //
+ // [Package URL]: https://github.com/package-url/purl-spec
+ // [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model
+ ArtifactPurlKey = attribute.Key("artifact.purl")
+
+ // ArtifactVersionKey is the attribute Key conforming to the "artifact.version"
+ // semantic conventions. It represents the version of the artifact.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "v0.1.0", "1.2.1", "122691-build"
+ ArtifactVersionKey = attribute.Key("artifact.version")
+)
+
+// ArtifactAttestationFilename returns an attribute KeyValue conforming to the
+// "artifact.attestation.filename" semantic conventions. It represents the
+// provenance filename of the built attestation which directly relates to the
+// build artifact filename. This filename SHOULD accompany the artifact at
+// publish time. See the [SLSA Relationship] specification for more information.
+//
+// [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations
+func ArtifactAttestationFilename(val string) attribute.KeyValue {
+ return ArtifactAttestationFilenameKey.String(val)
+}
+
+// ArtifactAttestationHash returns an attribute KeyValue conforming to the
+// "artifact.attestation.hash" semantic conventions. It represents the full
+// [hash value (see glossary)], of the built attestation. Some envelopes in the
+// [software attestation space] also refer to this as the **digest**.
+//
+// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+// [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec
+func ArtifactAttestationHash(val string) attribute.KeyValue {
+ return ArtifactAttestationHashKey.String(val)
+}
+
+// ArtifactAttestationID returns an attribute KeyValue conforming to the
+// "artifact.attestation.id" semantic conventions. It represents the id of the
+// build [software attestation].
+//
+// [software attestation]: https://slsa.dev/attestation-model
+func ArtifactAttestationID(val string) attribute.KeyValue {
+ return ArtifactAttestationIDKey.String(val)
+}
+
+// ArtifactFilename returns an attribute KeyValue conforming to the
+// "artifact.filename" semantic conventions. It represents the human readable
+// file name of the artifact, typically generated during build and release
+// processes. Often includes the package name and version in the file name.
+func ArtifactFilename(val string) attribute.KeyValue {
+ return ArtifactFilenameKey.String(val)
+}
+
+// ArtifactHash returns an attribute KeyValue conforming to the "artifact.hash"
+// semantic conventions. It represents the full [hash value (see glossary)],
+// often found in checksum.txt on a release of the artifact and used to verify
+// package integrity.
+//
+// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+func ArtifactHash(val string) attribute.KeyValue {
+ return ArtifactHashKey.String(val)
+}
+
+// ArtifactPurl returns an attribute KeyValue conforming to the "artifact.purl"
+// semantic conventions. It represents the [Package URL] of the
+// [package artifact] provides a standard way to identify and locate the packaged
+// artifact.
+//
+// [Package URL]: https://github.com/package-url/purl-spec
+// [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model
+func ArtifactPurl(val string) attribute.KeyValue {
+ return ArtifactPurlKey.String(val)
+}
+
+// ArtifactVersion returns an attribute KeyValue conforming to the
+// "artifact.version" semantic conventions. It represents the version of the
+// artifact.
+func ArtifactVersion(val string) attribute.KeyValue {
+ return ArtifactVersionKey.String(val)
+}
+
+// Namespace: aws
+const (
+ // AWSBedrockGuardrailIDKey is the attribute Key conforming to the
+ // "aws.bedrock.guardrail.id" semantic conventions. It represents the unique
+ // identifier of the AWS Bedrock Guardrail. A [guardrail] helps safeguard and
+ // prevent unwanted behavior from model responses or user messages.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "sgi5gkybzqak"
+ //
+ // [guardrail]: https://docs.aws.amazon.com/bedrock/latest/userguide/guardrails.html
+ AWSBedrockGuardrailIDKey = attribute.Key("aws.bedrock.guardrail.id")
+
+ // AWSBedrockKnowledgeBaseIDKey is the attribute Key conforming to the
+ // "aws.bedrock.knowledge_base.id" semantic conventions. It represents the
+ // unique identifier of the AWS Bedrock Knowledge base. A [knowledge base] is a
+ // bank of information that can be queried by models to generate more relevant
+ // responses and augment prompts.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "XFWUPB9PAW"
+ //
+ // [knowledge base]: https://docs.aws.amazon.com/bedrock/latest/userguide/knowledge-base.html
+ AWSBedrockKnowledgeBaseIDKey = attribute.Key("aws.bedrock.knowledge_base.id")
+
+ // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to the
+ // "aws.dynamodb.attribute_definitions" semantic conventions. It represents the
+ // JSON-serialized value of each item in the `AttributeDefinitions` request
+ // field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "AttributeName": "string", "AttributeType": "string" }"
+ AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions")
+
+ // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the
+ // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the
+ // value of the `AttributesToGet` request parameter.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "lives", "id"
+ AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get")
+
+ // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the
+ // "aws.dynamodb.consistent_read" semantic conventions. It represents the value
+ // of the `ConsistentRead` request parameter.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read")
+
+ // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the
+ // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
+ // JSON-serialized value of each item in the `ConsumedCapacity` response field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "CapacityUnits": number, "GlobalSecondaryIndexes": { "string" :
+ // { "CapacityUnits": number, "ReadCapacityUnits": number, "WriteCapacityUnits":
+ // number } }, "LocalSecondaryIndexes": { "string" : { "CapacityUnits": number,
+ // "ReadCapacityUnits": number, "WriteCapacityUnits": number } },
+ // "ReadCapacityUnits": number, "Table": { "CapacityUnits": number,
+ // "ReadCapacityUnits": number, "WriteCapacityUnits": number }, "TableName":
+ // "string", "WriteCapacityUnits": number }"
+ AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity")
+
+ // AWSDynamoDBCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.count" semantic conventions. It represents the value of the
+ // `Count` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10
+ AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count")
+
+ // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the
+ // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the
+ // value of the `ExclusiveStartTableName` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Users", "CatsTable"
+ AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table")
+
+ // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key conforming to
+ // the "aws.dynamodb.global_secondary_index_updates" semantic conventions. It
+ // represents the JSON-serialized value of each item in the
+ // `GlobalSecondaryIndexUpdates` request field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "Create": { "IndexName": "string", "KeySchema": [ {
+ // "AttributeName": "string", "KeyType": "string" } ], "Projection": {
+ // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" },
+ // "ProvisionedThroughput": { "ReadCapacityUnits": number, "WriteCapacityUnits":
+ // number } }"
+ AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates")
+
+ // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to the
+ // "aws.dynamodb.global_secondary_indexes" semantic conventions. It represents
+ // the JSON-serialized value of each item of the `GlobalSecondaryIndexes`
+ // request field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "IndexName": "string", "KeySchema": [ { "AttributeName":
+ // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [
+ // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": {
+ // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }"
+ AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes")
+
+ // AWSDynamoDBIndexNameKey is the attribute Key conforming to the
+ // "aws.dynamodb.index_name" semantic conventions. It represents the value of
+ // the `IndexName` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "name_to_group"
+ AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name")
+
+ // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to the
+ // "aws.dynamodb.item_collection_metrics" semantic conventions. It represents
+ // the JSON-serialized value of the `ItemCollectionMetrics` response field.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "string" : [ { "ItemCollectionKey": { "string" : { "B": blob,
+ // "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": { "string" :
+ // "AttributeValue" }, "N": "string", "NS": [ "string" ], "NULL": boolean, "S":
+ // "string", "SS": [ "string" ] } }, "SizeEstimateRangeGB": [ number ] } ] }"
+ AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics")
+
+ // AWSDynamoDBLimitKey is the attribute Key conforming to the
+ // "aws.dynamodb.limit" semantic conventions. It represents the value of the
+ // `Limit` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10
+ AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit")
+
+ // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to the
+ // "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents
+ // the JSON-serialized value of each item of the `LocalSecondaryIndexes` request
+ // field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "{ "IndexArn": "string", "IndexName": "string", "IndexSizeBytes":
+ // number, "ItemCount": number, "KeySchema": [ { "AttributeName": "string",
+ // "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ "string" ],
+ // "ProjectionType": "string" } }"
+ AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes")
+
+ // AWSDynamoDBProjectionKey is the attribute Key conforming to the
+ // "aws.dynamodb.projection" semantic conventions. It represents the value of
+ // the `ProjectionExpression` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Title", "Title, Price, Color", "Title, Description, RelatedItems,
+ // ProductReviews"
+ AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection")
+
+ // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to the
+ // "aws.dynamodb.provisioned_read_capacity" semantic conventions. It represents
+ // the value of the `ProvisionedThroughput.ReadCapacityUnits` request parameter.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0, 2.0
+ AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity")
+
+ // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming to the
+ // "aws.dynamodb.provisioned_write_capacity" semantic conventions. It represents
+ // the value of the `ProvisionedThroughput.WriteCapacityUnits` request
+ // parameter.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0, 2.0
+ AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity")
+
+ // AWSDynamoDBScanForwardKey is the attribute Key conforming to the
+ // "aws.dynamodb.scan_forward" semantic conventions. It represents the value of
+ // the `ScanIndexForward` request parameter.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward")
+
+ // AWSDynamoDBScannedCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.scanned_count" semantic conventions. It represents the value of
+ // the `ScannedCount` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 50
+ AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count")
+
+ // AWSDynamoDBSegmentKey is the attribute Key conforming to the
+ // "aws.dynamodb.segment" semantic conventions. It represents the value of the
+ // `Segment` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10
+ AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment")
+
+ // AWSDynamoDBSelectKey is the attribute Key conforming to the
+ // "aws.dynamodb.select" semantic conventions. It represents the value of the
+ // `Select` request parameter.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ALL_ATTRIBUTES", "COUNT"
+ AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select")
+
+ // AWSDynamoDBTableCountKey is the attribute Key conforming to the
+ // "aws.dynamodb.table_count" semantic conventions. It represents the number of
+ // items in the `TableNames` response parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 20
+ AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count")
+
+ // AWSDynamoDBTableNamesKey is the attribute Key conforming to the
+ // "aws.dynamodb.table_names" semantic conventions. It represents the keys in
+ // the `RequestItems` object field.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Users", "Cats"
+ AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names")
+
+ // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the
+ // "aws.dynamodb.total_segments" semantic conventions. It represents the value
+ // of the `TotalSegments` request parameter.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments")
+
+ // AWSECSClusterARNKey is the attribute Key conforming to the
+ // "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an
+ // [ECS cluster].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster"
+ //
+ // [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html
+ AWSECSClusterARNKey = attribute.Key("aws.ecs.cluster.arn")
+
+ // AWSECSContainerARNKey is the attribute Key conforming to the
+ // "aws.ecs.container.arn" semantic conventions. It represents the Amazon
+ // Resource Name (ARN) of an [ECS container instance].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:ecs:us-west-1:123456789123:container/32624152-9086-4f0e-acae-1a75b14fe4d9"
+ //
+ // [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html
+ AWSECSContainerARNKey = attribute.Key("aws.ecs.container.arn")
+
+ // AWSECSLaunchtypeKey is the attribute Key conforming to the
+ // "aws.ecs.launchtype" semantic conventions. It represents the [launch type]
+ // for an ECS task.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [launch type]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/launch_types.html
+ AWSECSLaunchtypeKey = attribute.Key("aws.ecs.launchtype")
+
+ // AWSECSTaskARNKey is the attribute Key conforming to the "aws.ecs.task.arn"
+ // semantic conventions. It represents the ARN of a running [ECS task].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:ecs:us-west-1:123456789123:task/10838bed-421f-43ef-870a-f43feacbbb5b",
+ // "arn:aws:ecs:us-west-1:123456789123:task/my-cluster/task-id/23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd"
+ //
+ // [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids
+ AWSECSTaskARNKey = attribute.Key("aws.ecs.task.arn")
+
+ // AWSECSTaskFamilyKey is the attribute Key conforming to the
+ // "aws.ecs.task.family" semantic conventions. It represents the family name of
+ // the [ECS task definition] used to create the ECS task.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-family"
+ //
+ // [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html
+ AWSECSTaskFamilyKey = attribute.Key("aws.ecs.task.family")
+
+ // AWSECSTaskIDKey is the attribute Key conforming to the "aws.ecs.task.id"
+ // semantic conventions. It represents the ID of a running ECS task. The ID MUST
+ // be extracted from `task.arn`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "10838bed-421f-43ef-870a-f43feacbbb5b",
+ // "23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd"
+ AWSECSTaskIDKey = attribute.Key("aws.ecs.task.id")
+
+ // AWSECSTaskRevisionKey is the attribute Key conforming to the
+ // "aws.ecs.task.revision" semantic conventions. It represents the revision for
+ // the task definition used to create the ECS task.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "8", "26"
+ AWSECSTaskRevisionKey = attribute.Key("aws.ecs.task.revision")
+
+ // AWSEKSClusterARNKey is the attribute Key conforming to the
+ // "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS
+ // cluster.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster"
+ AWSEKSClusterARNKey = attribute.Key("aws.eks.cluster.arn")
+
+ // AWSExtendedRequestIDKey is the attribute Key conforming to the
+ // "aws.extended_request_id" semantic conventions. It represents the AWS
+ // extended request ID as returned in the response header `x-amz-id-2`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "wzHcyEWfmOGDIE5QOhTAqFDoDWP3y8IUvpNINCwL9N4TEHbUw0/gZJ+VZTmCNCWR7fezEN3eCiQ="
+ AWSExtendedRequestIDKey = attribute.Key("aws.extended_request_id")
+
+ // AWSKinesisStreamNameKey is the attribute Key conforming to the
+ // "aws.kinesis.stream_name" semantic conventions. It represents the name of the
+ // AWS Kinesis [stream] the request refers to. Corresponds to the
+ // `--stream-name` parameter of the Kinesis [describe-stream] operation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "some-stream-name"
+ //
+ // [stream]: https://docs.aws.amazon.com/streams/latest/dev/introduction.html
+ // [describe-stream]: https://docs.aws.amazon.com/cli/latest/reference/kinesis/describe-stream.html
+ AWSKinesisStreamNameKey = attribute.Key("aws.kinesis.stream_name")
+
+ // AWSLambdaInvokedARNKey is the attribute Key conforming to the
+ // "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked
+ // ARN as provided on the `Context` passed to the function (
+ // `Lambda-Runtime-Invoked-Function-Arn` header on the
+ // `/runtime/invocation/next` applicable).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:lambda:us-east-1:123456:function:myfunction:myalias"
+ // Note: This may be different from `cloud.resource_id` if an alias is involved.
+ AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn")
+
+ // AWSLambdaResourceMappingIDKey is the attribute Key conforming to the
+ // "aws.lambda.resource_mapping.id" semantic conventions. It represents the UUID
+ // of the [AWS Lambda EvenSource Mapping]. An event source is mapped to a lambda
+ // function. It's contents are read by Lambda and used to trigger a function.
+ // This isn't available in the lambda execution context or the lambda runtime
+ // environtment. This is going to be populated by the AWS SDK for each language
+ // when that UUID is present. Some of these operations are
+ // Create/Delete/Get/List/Update EventSourceMapping.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "587ad24b-03b9-4413-8202-bbd56b36e5b7"
+ //
+ // [AWS Lambda EvenSource Mapping]: https://docs.aws.amazon.com/AWSCloudFormation/latest/UserGuide/aws-resource-lambda-eventsourcemapping.html
+ AWSLambdaResourceMappingIDKey = attribute.Key("aws.lambda.resource_mapping.id")
+
+ // AWSLogGroupARNsKey is the attribute Key conforming to the
+ // "aws.log.group.arns" semantic conventions. It represents the Amazon Resource
+ // Name(s) (ARN) of the AWS log group(s).
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:*"
+ // Note: See the [log group ARN format documentation].
+ //
+ // [log group ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format
+ AWSLogGroupARNsKey = attribute.Key("aws.log.group.arns")
+
+ // AWSLogGroupNamesKey is the attribute Key conforming to the
+ // "aws.log.group.names" semantic conventions. It represents the name(s) of the
+ // AWS log group(s) an application is writing to.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/aws/lambda/my-function", "opentelemetry-service"
+ // Note: Multiple log groups must be supported for cases like multi-container
+ // applications, where a single application has sidecar containers, and each
+ // write to their own log group.
+ AWSLogGroupNamesKey = attribute.Key("aws.log.group.names")
+
+ // AWSLogStreamARNsKey is the attribute Key conforming to the
+ // "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the
+ // AWS log stream(s).
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:log-stream:logs/main/10838bed-421f-43ef-870a-f43feacbbb5b"
+ // Note: See the [log stream ARN format documentation]. One log group can
+ // contain several log streams, so these ARNs necessarily identify both a log
+ // group and a log stream.
+ //
+ // [log stream ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format
+ AWSLogStreamARNsKey = attribute.Key("aws.log.stream.arns")
+
+ // AWSLogStreamNamesKey is the attribute Key conforming to the
+ // "aws.log.stream.names" semantic conventions. It represents the name(s) of the
+ // AWS log stream(s) an application is writing to.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "logs/main/10838bed-421f-43ef-870a-f43feacbbb5b"
+ AWSLogStreamNamesKey = attribute.Key("aws.log.stream.names")
+
+ // AWSRequestIDKey is the attribute Key conforming to the "aws.request_id"
+ // semantic conventions. It represents the AWS request ID as returned in the
+ // response headers `x-amzn-requestid`, `x-amzn-request-id` or
+ // `x-amz-request-id`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "79b9da39-b7ae-508a-a6bc-864b2829c622", "C9ER4AJX75574TDJ"
+ AWSRequestIDKey = attribute.Key("aws.request_id")
+
+ // AWSS3BucketKey is the attribute Key conforming to the "aws.s3.bucket"
+ // semantic conventions. It represents the S3 bucket name the request refers to.
+ // Corresponds to the `--bucket` parameter of the [S3 API] operations.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "some-bucket-name"
+ // Note: The `bucket` attribute is applicable to all S3 operations that
+ // reference a bucket, i.e. that require the bucket name as a mandatory
+ // parameter.
+ // This applies to almost all S3 operations except `list-buckets`.
+ //
+ // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+ AWSS3BucketKey = attribute.Key("aws.s3.bucket")
+
+ // AWSS3CopySourceKey is the attribute Key conforming to the
+ // "aws.s3.copy_source" semantic conventions. It represents the source object
+ // (in the form `bucket`/`key`) for the copy operation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "someFile.yml"
+ // Note: The `copy_source` attribute applies to S3 copy operations and
+ // corresponds to the `--copy-source` parameter
+ // of the [copy-object operation within the S3 API].
+ // This applies in particular to the following operations:
+ //
+ // - [copy-object]
+ // - [upload-part-copy]
+ //
+ //
+ // [copy-object operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html
+ // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ AWSS3CopySourceKey = attribute.Key("aws.s3.copy_source")
+
+ // AWSS3DeleteKey is the attribute Key conforming to the "aws.s3.delete"
+ // semantic conventions. It represents the delete request container that
+ // specifies the objects to be deleted.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "Objects=[{Key=string,VersionId=string},{Key=string,VersionId=string}],Quiet=boolean"
+ // Note: The `delete` attribute is only applicable to the [delete-object]
+ // operation.
+ // The `delete` attribute corresponds to the `--delete` parameter of the
+ // [delete-objects operation within the S3 API].
+ //
+ // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html
+ // [delete-objects operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-objects.html
+ AWSS3DeleteKey = attribute.Key("aws.s3.delete")
+
+ // AWSS3KeyKey is the attribute Key conforming to the "aws.s3.key" semantic
+ // conventions. It represents the S3 object key the request refers to.
+ // Corresponds to the `--key` parameter of the [S3 API] operations.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "someFile.yml"
+ // Note: The `key` attribute is applicable to all object-related S3 operations,
+ // i.e. that require the object key as a mandatory parameter.
+ // This applies in particular to the following operations:
+ //
+ // - [copy-object]
+ // - [delete-object]
+ // - [get-object]
+ // - [head-object]
+ // - [put-object]
+ // - [restore-object]
+ // - [select-object-content]
+ // - [abort-multipart-upload]
+ // - [complete-multipart-upload]
+ // - [create-multipart-upload]
+ // - [list-parts]
+ // - [upload-part]
+ // - [upload-part-copy]
+ //
+ //
+ // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+ // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html
+ // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html
+ // [get-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/get-object.html
+ // [head-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/head-object.html
+ // [put-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/put-object.html
+ // [restore-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/restore-object.html
+ // [select-object-content]: https://docs.aws.amazon.com/cli/latest/reference/s3api/select-object-content.html
+ // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html
+ // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html
+ // [create-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/create-multipart-upload.html
+ // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html
+ // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ AWSS3KeyKey = attribute.Key("aws.s3.key")
+
+ // AWSS3PartNumberKey is the attribute Key conforming to the
+ // "aws.s3.part_number" semantic conventions. It represents the part number of
+ // the part being uploaded in a multipart-upload operation. This is a positive
+ // integer between 1 and 10,000.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 3456
+ // Note: The `part_number` attribute is only applicable to the [upload-part]
+ // and [upload-part-copy] operations.
+ // The `part_number` attribute corresponds to the `--part-number` parameter of
+ // the
+ // [upload-part operation within the S3 API].
+ //
+ // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ // [upload-part operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ AWSS3PartNumberKey = attribute.Key("aws.s3.part_number")
+
+ // AWSS3UploadIDKey is the attribute Key conforming to the "aws.s3.upload_id"
+ // semantic conventions. It represents the upload ID that identifies the
+ // multipart upload.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "dfRtDYWFbkRONycy.Yxwh66Yjlx.cph0gtNBtJ"
+ // Note: The `upload_id` attribute applies to S3 multipart-upload operations and
+ // corresponds to the `--upload-id` parameter
+ // of the [S3 API] multipart operations.
+ // This applies in particular to the following operations:
+ //
+ // - [abort-multipart-upload]
+ // - [complete-multipart-upload]
+ // - [list-parts]
+ // - [upload-part]
+ // - [upload-part-copy]
+ //
+ //
+ // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+ // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html
+ // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html
+ // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html
+ // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html
+ // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html
+ AWSS3UploadIDKey = attribute.Key("aws.s3.upload_id")
+
+ // AWSSecretsmanagerSecretARNKey is the attribute Key conforming to the
+ // "aws.secretsmanager.secret.arn" semantic conventions. It represents the ARN
+ // of the Secret stored in the Secrets Mangger.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:secretsmanager:us-east-1:123456789012:secret:SecretName-6RandomCharacters"
+ AWSSecretsmanagerSecretARNKey = attribute.Key("aws.secretsmanager.secret.arn")
+
+ // AWSSNSTopicARNKey is the attribute Key conforming to the "aws.sns.topic.arn"
+ // semantic conventions. It represents the ARN of the AWS SNS Topic. An Amazon
+ // SNS [topic] is a logical access point that acts as a communication channel.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:sns:us-east-1:123456789012:mystack-mytopic-NZJ5JSMVGFIE"
+ //
+ // [topic]: https://docs.aws.amazon.com/sns/latest/dg/sns-create-topic.html
+ AWSSNSTopicARNKey = attribute.Key("aws.sns.topic.arn")
+
+ // AWSSQSQueueURLKey is the attribute Key conforming to the "aws.sqs.queue.url"
+ // semantic conventions. It represents the URL of the AWS SQS Queue. It's a
+ // unique identifier for a queue in Amazon Simple Queue Service (SQS) and is
+ // used to access the queue and perform actions on it.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://sqs.us-east-1.amazonaws.com/123456789012/MyQueue"
+ AWSSQSQueueURLKey = attribute.Key("aws.sqs.queue.url")
+
+ // AWSStepFunctionsActivityARNKey is the attribute Key conforming to the
+ // "aws.step_functions.activity.arn" semantic conventions. It represents the ARN
+ // of the AWS Step Functions Activity.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:states:us-east-1:123456789012:activity:get-greeting"
+ AWSStepFunctionsActivityARNKey = attribute.Key("aws.step_functions.activity.arn")
+
+ // AWSStepFunctionsStateMachineARNKey is the attribute Key conforming to the
+ // "aws.step_functions.state_machine.arn" semantic conventions. It represents
+ // the ARN of the AWS Step Functions State Machine.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "arn:aws:states:us-east-1:123456789012:stateMachine:myStateMachine:1"
+ AWSStepFunctionsStateMachineARNKey = attribute.Key("aws.step_functions.state_machine.arn")
+)
+
+// AWSBedrockGuardrailID returns an attribute KeyValue conforming to the
+// "aws.bedrock.guardrail.id" semantic conventions. It represents the unique
+// identifier of the AWS Bedrock Guardrail. A [guardrail] helps safeguard and
+// prevent unwanted behavior from model responses or user messages.
+//
+// [guardrail]: https://docs.aws.amazon.com/bedrock/latest/userguide/guardrails.html
+func AWSBedrockGuardrailID(val string) attribute.KeyValue {
+ return AWSBedrockGuardrailIDKey.String(val)
+}
+
+// AWSBedrockKnowledgeBaseID returns an attribute KeyValue conforming to the
+// "aws.bedrock.knowledge_base.id" semantic conventions. It represents the unique
+// identifier of the AWS Bedrock Knowledge base. A [knowledge base] is a bank of
+// information that can be queried by models to generate more relevant responses
+// and augment prompts.
+//
+// [knowledge base]: https://docs.aws.amazon.com/bedrock/latest/userguide/knowledge-base.html
+func AWSBedrockKnowledgeBaseID(val string) attribute.KeyValue {
+ return AWSBedrockKnowledgeBaseIDKey.String(val)
+}
+
+// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming to
+// the "aws.dynamodb.attribute_definitions" semantic conventions. It represents
+// the JSON-serialized value of each item in the `AttributeDefinitions` request
+// field.
+func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue {
+ return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val)
+}
+
+// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to the
+// "aws.dynamodb.attributes_to_get" semantic conventions. It represents the value
+// of the `AttributesToGet` request parameter.
+func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue {
+ return AWSDynamoDBAttributesToGetKey.StringSlice(val)
+}
+
+// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the
+// "aws.dynamodb.consistent_read" semantic conventions. It represents the value
+// of the `ConsistentRead` request parameter.
+func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue {
+ return AWSDynamoDBConsistentReadKey.Bool(val)
+}
+
+// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to the
+// "aws.dynamodb.consumed_capacity" semantic conventions. It represents the
+// JSON-serialized value of each item in the `ConsumedCapacity` response field.
+func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue {
+ return AWSDynamoDBConsumedCapacityKey.StringSlice(val)
+}
+
+// AWSDynamoDBCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.count" semantic conventions. It represents the value of the
+// `Count` response parameter.
+func AWSDynamoDBCount(val int) attribute.KeyValue {
+ return AWSDynamoDBCountKey.Int(val)
+}
+
+// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming to the
+// "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the
+// value of the `ExclusiveStartTableName` request parameter.
+func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue {
+ return AWSDynamoDBExclusiveStartTableKey.String(val)
+}
+
+// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue
+// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic
+// conventions. It represents the JSON-serialized value of each item in the
+// `GlobalSecondaryIndexUpdates` request field.
+func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue {
+ return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val)
+}
+
+// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue conforming to
+// the "aws.dynamodb.global_secondary_indexes" semantic conventions. It
+// represents the JSON-serialized value of each item of the
+// `GlobalSecondaryIndexes` request field.
+func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue {
+ return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val)
+}
+
+// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the
+// "aws.dynamodb.index_name" semantic conventions. It represents the value of the
+// `IndexName` request parameter.
+func AWSDynamoDBIndexName(val string) attribute.KeyValue {
+ return AWSDynamoDBIndexNameKey.String(val)
+}
+
+// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming to
+// the "aws.dynamodb.item_collection_metrics" semantic conventions. It represents
+// the JSON-serialized value of the `ItemCollectionMetrics` response field.
+func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue {
+ return AWSDynamoDBItemCollectionMetricsKey.String(val)
+}
+
+// AWSDynamoDBLimit returns an attribute KeyValue conforming to the
+// "aws.dynamodb.limit" semantic conventions. It represents the value of the
+// `Limit` request parameter.
+func AWSDynamoDBLimit(val int) attribute.KeyValue {
+ return AWSDynamoDBLimitKey.Int(val)
+}
+
+// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming to
+// the "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents
+// the JSON-serialized value of each item of the `LocalSecondaryIndexes` request
+// field.
+func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue {
+ return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val)
+}
+
+// AWSDynamoDBProjection returns an attribute KeyValue conforming to the
+// "aws.dynamodb.projection" semantic conventions. It represents the value of the
+// `ProjectionExpression` request parameter.
+func AWSDynamoDBProjection(val string) attribute.KeyValue {
+ return AWSDynamoDBProjectionKey.String(val)
+}
+
+// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue conforming to
+// the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It
+// represents the value of the `ProvisionedThroughput.ReadCapacityUnits` request
+// parameter.
+func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue {
+ return AWSDynamoDBProvisionedReadCapacityKey.Float64(val)
+}
+
+// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue conforming
+// to the "aws.dynamodb.provisioned_write_capacity" semantic conventions. It
+// represents the value of the `ProvisionedThroughput.WriteCapacityUnits` request
+// parameter.
+func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue {
+ return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val)
+}
+
+// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the
+// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of
+// the `ScanIndexForward` request parameter.
+func AWSDynamoDBScanForward(val bool) attribute.KeyValue {
+ return AWSDynamoDBScanForwardKey.Bool(val)
+}
+
+// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.scanned_count" semantic conventions. It represents the value of
+// the `ScannedCount` response parameter.
+func AWSDynamoDBScannedCount(val int) attribute.KeyValue {
+ return AWSDynamoDBScannedCountKey.Int(val)
+}
+
+// AWSDynamoDBSegment returns an attribute KeyValue conforming to the
+// "aws.dynamodb.segment" semantic conventions. It represents the value of the
+// `Segment` request parameter.
+func AWSDynamoDBSegment(val int) attribute.KeyValue {
+ return AWSDynamoDBSegmentKey.Int(val)
+}
+
+// AWSDynamoDBSelect returns an attribute KeyValue conforming to the
+// "aws.dynamodb.select" semantic conventions. It represents the value of the
+// `Select` request parameter.
+func AWSDynamoDBSelect(val string) attribute.KeyValue {
+ return AWSDynamoDBSelectKey.String(val)
+}
+
+// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the
+// "aws.dynamodb.table_count" semantic conventions. It represents the number of
+// items in the `TableNames` response parameter.
+func AWSDynamoDBTableCount(val int) attribute.KeyValue {
+ return AWSDynamoDBTableCountKey.Int(val)
+}
+
+// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the
+// "aws.dynamodb.table_names" semantic conventions. It represents the keys in the
+// `RequestItems` object field.
+func AWSDynamoDBTableNames(val ...string) attribute.KeyValue {
+ return AWSDynamoDBTableNamesKey.StringSlice(val)
+}
+
+// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the
+// "aws.dynamodb.total_segments" semantic conventions. It represents the value of
+// the `TotalSegments` request parameter.
+func AWSDynamoDBTotalSegments(val int) attribute.KeyValue {
+ return AWSDynamoDBTotalSegmentsKey.Int(val)
+}
+
+// AWSECSClusterARN returns an attribute KeyValue conforming to the
+// "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an
+// [ECS cluster].
+//
+// [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html
+func AWSECSClusterARN(val string) attribute.KeyValue {
+ return AWSECSClusterARNKey.String(val)
+}
+
+// AWSECSContainerARN returns an attribute KeyValue conforming to the
+// "aws.ecs.container.arn" semantic conventions. It represents the Amazon
+// Resource Name (ARN) of an [ECS container instance].
+//
+// [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html
+func AWSECSContainerARN(val string) attribute.KeyValue {
+ return AWSECSContainerARNKey.String(val)
+}
+
+// AWSECSTaskARN returns an attribute KeyValue conforming to the
+// "aws.ecs.task.arn" semantic conventions. It represents the ARN of a running
+// [ECS task].
+//
+// [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids
+func AWSECSTaskARN(val string) attribute.KeyValue {
+ return AWSECSTaskARNKey.String(val)
+}
+
+// AWSECSTaskFamily returns an attribute KeyValue conforming to the
+// "aws.ecs.task.family" semantic conventions. It represents the family name of
+// the [ECS task definition] used to create the ECS task.
+//
+// [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html
+func AWSECSTaskFamily(val string) attribute.KeyValue {
+ return AWSECSTaskFamilyKey.String(val)
+}
+
+// AWSECSTaskID returns an attribute KeyValue conforming to the "aws.ecs.task.id"
+// semantic conventions. It represents the ID of a running ECS task. The ID MUST
+// be extracted from `task.arn`.
+func AWSECSTaskID(val string) attribute.KeyValue {
+ return AWSECSTaskIDKey.String(val)
+}
+
+// AWSECSTaskRevision returns an attribute KeyValue conforming to the
+// "aws.ecs.task.revision" semantic conventions. It represents the revision for
+// the task definition used to create the ECS task.
+func AWSECSTaskRevision(val string) attribute.KeyValue {
+ return AWSECSTaskRevisionKey.String(val)
+}
+
+// AWSEKSClusterARN returns an attribute KeyValue conforming to the
+// "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS
+// cluster.
+func AWSEKSClusterARN(val string) attribute.KeyValue {
+ return AWSEKSClusterARNKey.String(val)
+}
+
+// AWSExtendedRequestID returns an attribute KeyValue conforming to the
+// "aws.extended_request_id" semantic conventions. It represents the AWS extended
+// request ID as returned in the response header `x-amz-id-2`.
+func AWSExtendedRequestID(val string) attribute.KeyValue {
+ return AWSExtendedRequestIDKey.String(val)
+}
+
+// AWSKinesisStreamName returns an attribute KeyValue conforming to the
+// "aws.kinesis.stream_name" semantic conventions. It represents the name of the
+// AWS Kinesis [stream] the request refers to. Corresponds to the `--stream-name`
+// parameter of the Kinesis [describe-stream] operation.
+//
+// [stream]: https://docs.aws.amazon.com/streams/latest/dev/introduction.html
+// [describe-stream]: https://docs.aws.amazon.com/cli/latest/reference/kinesis/describe-stream.html
+func AWSKinesisStreamName(val string) attribute.KeyValue {
+ return AWSKinesisStreamNameKey.String(val)
+}
+
+// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the
+// "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked
+// ARN as provided on the `Context` passed to the function (
+// `Lambda-Runtime-Invoked-Function-Arn` header on the `/runtime/invocation/next`
+// applicable).
+func AWSLambdaInvokedARN(val string) attribute.KeyValue {
+ return AWSLambdaInvokedARNKey.String(val)
+}
+
+// AWSLambdaResourceMappingID returns an attribute KeyValue conforming to the
+// "aws.lambda.resource_mapping.id" semantic conventions. It represents the UUID
+// of the [AWS Lambda EvenSource Mapping]. An event source is mapped to a lambda
+// function. It's contents are read by Lambda and used to trigger a function.
+// This isn't available in the lambda execution context or the lambda runtime
+// environtment. This is going to be populated by the AWS SDK for each language
+// when that UUID is present. Some of these operations are
+// Create/Delete/Get/List/Update EventSourceMapping.
+//
+// [AWS Lambda EvenSource Mapping]: https://docs.aws.amazon.com/AWSCloudFormation/latest/UserGuide/aws-resource-lambda-eventsourcemapping.html
+func AWSLambdaResourceMappingID(val string) attribute.KeyValue {
+ return AWSLambdaResourceMappingIDKey.String(val)
+}
+
+// AWSLogGroupARNs returns an attribute KeyValue conforming to the
+// "aws.log.group.arns" semantic conventions. It represents the Amazon Resource
+// Name(s) (ARN) of the AWS log group(s).
+func AWSLogGroupARNs(val ...string) attribute.KeyValue {
+ return AWSLogGroupARNsKey.StringSlice(val)
+}
+
+// AWSLogGroupNames returns an attribute KeyValue conforming to the
+// "aws.log.group.names" semantic conventions. It represents the name(s) of the
+// AWS log group(s) an application is writing to.
+func AWSLogGroupNames(val ...string) attribute.KeyValue {
+ return AWSLogGroupNamesKey.StringSlice(val)
+}
+
+// AWSLogStreamARNs returns an attribute KeyValue conforming to the
+// "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the
+// AWS log stream(s).
+func AWSLogStreamARNs(val ...string) attribute.KeyValue {
+ return AWSLogStreamARNsKey.StringSlice(val)
+}
+
+// AWSLogStreamNames returns an attribute KeyValue conforming to the
+// "aws.log.stream.names" semantic conventions. It represents the name(s) of the
+// AWS log stream(s) an application is writing to.
+func AWSLogStreamNames(val ...string) attribute.KeyValue {
+ return AWSLogStreamNamesKey.StringSlice(val)
+}
+
+// AWSRequestID returns an attribute KeyValue conforming to the "aws.request_id"
+// semantic conventions. It represents the AWS request ID as returned in the
+// response headers `x-amzn-requestid`, `x-amzn-request-id` or `x-amz-request-id`
+// .
+func AWSRequestID(val string) attribute.KeyValue {
+ return AWSRequestIDKey.String(val)
+}
+
+// AWSS3Bucket returns an attribute KeyValue conforming to the "aws.s3.bucket"
+// semantic conventions. It represents the S3 bucket name the request refers to.
+// Corresponds to the `--bucket` parameter of the [S3 API] operations.
+//
+// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+func AWSS3Bucket(val string) attribute.KeyValue {
+ return AWSS3BucketKey.String(val)
+}
+
+// AWSS3CopySource returns an attribute KeyValue conforming to the
+// "aws.s3.copy_source" semantic conventions. It represents the source object (in
+// the form `bucket`/`key`) for the copy operation.
+func AWSS3CopySource(val string) attribute.KeyValue {
+ return AWSS3CopySourceKey.String(val)
+}
+
+// AWSS3Delete returns an attribute KeyValue conforming to the "aws.s3.delete"
+// semantic conventions. It represents the delete request container that
+// specifies the objects to be deleted.
+func AWSS3Delete(val string) attribute.KeyValue {
+ return AWSS3DeleteKey.String(val)
+}
+
+// AWSS3Key returns an attribute KeyValue conforming to the "aws.s3.key" semantic
+// conventions. It represents the S3 object key the request refers to.
+// Corresponds to the `--key` parameter of the [S3 API] operations.
+//
+// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html
+func AWSS3Key(val string) attribute.KeyValue {
+ return AWSS3KeyKey.String(val)
+}
+
+// AWSS3PartNumber returns an attribute KeyValue conforming to the
+// "aws.s3.part_number" semantic conventions. It represents the part number of
+// the part being uploaded in a multipart-upload operation. This is a positive
+// integer between 1 and 10,000.
+func AWSS3PartNumber(val int) attribute.KeyValue {
+ return AWSS3PartNumberKey.Int(val)
+}
+
+// AWSS3UploadID returns an attribute KeyValue conforming to the
+// "aws.s3.upload_id" semantic conventions. It represents the upload ID that
+// identifies the multipart upload.
+func AWSS3UploadID(val string) attribute.KeyValue {
+ return AWSS3UploadIDKey.String(val)
+}
+
+// AWSSecretsmanagerSecretARN returns an attribute KeyValue conforming to the
+// "aws.secretsmanager.secret.arn" semantic conventions. It represents the ARN of
+// the Secret stored in the Secrets Mangger.
+func AWSSecretsmanagerSecretARN(val string) attribute.KeyValue {
+ return AWSSecretsmanagerSecretARNKey.String(val)
+}
+
+// AWSSNSTopicARN returns an attribute KeyValue conforming to the
+// "aws.sns.topic.arn" semantic conventions. It represents the ARN of the AWS SNS
+// Topic. An Amazon SNS [topic] is a logical access point that acts as a
+// communication channel.
+//
+// [topic]: https://docs.aws.amazon.com/sns/latest/dg/sns-create-topic.html
+func AWSSNSTopicARN(val string) attribute.KeyValue {
+ return AWSSNSTopicARNKey.String(val)
+}
+
+// AWSSQSQueueURL returns an attribute KeyValue conforming to the
+// "aws.sqs.queue.url" semantic conventions. It represents the URL of the AWS SQS
+// Queue. It's a unique identifier for a queue in Amazon Simple Queue Service
+// (SQS) and is used to access the queue and perform actions on it.
+func AWSSQSQueueURL(val string) attribute.KeyValue {
+ return AWSSQSQueueURLKey.String(val)
+}
+
+// AWSStepFunctionsActivityARN returns an attribute KeyValue conforming to the
+// "aws.step_functions.activity.arn" semantic conventions. It represents the ARN
+// of the AWS Step Functions Activity.
+func AWSStepFunctionsActivityARN(val string) attribute.KeyValue {
+ return AWSStepFunctionsActivityARNKey.String(val)
+}
+
+// AWSStepFunctionsStateMachineARN returns an attribute KeyValue conforming to
+// the "aws.step_functions.state_machine.arn" semantic conventions. It represents
+// the ARN of the AWS Step Functions State Machine.
+func AWSStepFunctionsStateMachineARN(val string) attribute.KeyValue {
+ return AWSStepFunctionsStateMachineARNKey.String(val)
+}
+
+// Enum values for aws.ecs.launchtype
+var (
+ // ec2
+ // Stability: development
+ AWSECSLaunchtypeEC2 = AWSECSLaunchtypeKey.String("ec2")
+ // fargate
+ // Stability: development
+ AWSECSLaunchtypeFargate = AWSECSLaunchtypeKey.String("fargate")
+)
+
+// Namespace: az
+const (
+ // AzNamespaceKey is the attribute Key conforming to the "az.namespace" semantic
+ // conventions. It represents the [Azure Resource Provider Namespace] as
+ // recognized by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Microsoft.Storage", "Microsoft.KeyVault", "Microsoft.ServiceBus"
+ //
+ // [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers
+ AzNamespaceKey = attribute.Key("az.namespace")
+
+ // AzServiceRequestIDKey is the attribute Key conforming to the
+ // "az.service_request_id" semantic conventions. It represents the unique
+ // identifier of the service request. It's generated by the Azure service and
+ // returned with the response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "00000000-0000-0000-0000-000000000000"
+ AzServiceRequestIDKey = attribute.Key("az.service_request_id")
+)
+
+// AzNamespace returns an attribute KeyValue conforming to the "az.namespace"
+// semantic conventions. It represents the [Azure Resource Provider Namespace] as
+// recognized by the client.
+//
+// [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers
+func AzNamespace(val string) attribute.KeyValue {
+ return AzNamespaceKey.String(val)
+}
+
+// AzServiceRequestID returns an attribute KeyValue conforming to the
+// "az.service_request_id" semantic conventions. It represents the unique
+// identifier of the service request. It's generated by the Azure service and
+// returned with the response.
+func AzServiceRequestID(val string) attribute.KeyValue {
+ return AzServiceRequestIDKey.String(val)
+}
+
+// Namespace: azure
+const (
+ // AzureClientIDKey is the attribute Key conforming to the "azure.client.id"
+ // semantic conventions. It represents the unique identifier of the client
+ // instance.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "3ba4827d-4422-483f-b59f-85b74211c11d", "storage-client-1"
+ AzureClientIDKey = attribute.Key("azure.client.id")
+
+ // AzureCosmosDBConnectionModeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.connection.mode" semantic conventions. It represents the
+ // cosmos client connection mode.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AzureCosmosDBConnectionModeKey = attribute.Key("azure.cosmosdb.connection.mode")
+
+ // AzureCosmosDBConsistencyLevelKey is the attribute Key conforming to the
+ // "azure.cosmosdb.consistency.level" semantic conventions. It represents the
+ // account or request [consistency level].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Eventual", "ConsistentPrefix", "BoundedStaleness", "Strong",
+ // "Session"
+ //
+ // [consistency level]: https://learn.microsoft.com/azure/cosmos-db/consistency-levels
+ AzureCosmosDBConsistencyLevelKey = attribute.Key("azure.cosmosdb.consistency.level")
+
+ // AzureCosmosDBOperationContactedRegionsKey is the attribute Key conforming to
+ // the "azure.cosmosdb.operation.contacted_regions" semantic conventions. It
+ // represents the list of regions contacted during operation in the order that
+ // they were contacted. If there is more than one region listed, it indicates
+ // that the operation was performed on multiple regions i.e. cross-regional
+ // call.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "North Central US", "Australia East", "Australia Southeast"
+ // Note: Region name matches the format of `displayName` in [Azure Location API]
+ //
+ // [Azure Location API]: https://learn.microsoft.com/rest/api/subscription/subscriptions/list-locations?view=rest-subscription-2021-10-01&tabs=HTTP#location
+ AzureCosmosDBOperationContactedRegionsKey = attribute.Key("azure.cosmosdb.operation.contacted_regions")
+
+ // AzureCosmosDBOperationRequestChargeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.operation.request_charge" semantic conventions. It represents
+ // the number of request units consumed by the operation.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 46.18, 1.0
+ AzureCosmosDBOperationRequestChargeKey = attribute.Key("azure.cosmosdb.operation.request_charge")
+
+ // AzureCosmosDBRequestBodySizeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.request.body.size" semantic conventions. It represents the
+ // request payload size in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ AzureCosmosDBRequestBodySizeKey = attribute.Key("azure.cosmosdb.request.body.size")
+
+ // AzureCosmosDBResponseSubStatusCodeKey is the attribute Key conforming to the
+ // "azure.cosmosdb.response.sub_status_code" semantic conventions. It represents
+ // the cosmos DB sub status code.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1000, 1002
+ AzureCosmosDBResponseSubStatusCodeKey = attribute.Key("azure.cosmosdb.response.sub_status_code")
+)
+
+// AzureClientID returns an attribute KeyValue conforming to the
+// "azure.client.id" semantic conventions. It represents the unique identifier of
+// the client instance.
+func AzureClientID(val string) attribute.KeyValue {
+ return AzureClientIDKey.String(val)
+}
+
+// AzureCosmosDBOperationContactedRegions returns an attribute KeyValue
+// conforming to the "azure.cosmosdb.operation.contacted_regions" semantic
+// conventions. It represents the list of regions contacted during operation in
+// the order that they were contacted. If there is more than one region listed,
+// it indicates that the operation was performed on multiple regions i.e.
+// cross-regional call.
+func AzureCosmosDBOperationContactedRegions(val ...string) attribute.KeyValue {
+ return AzureCosmosDBOperationContactedRegionsKey.StringSlice(val)
+}
+
+// AzureCosmosDBOperationRequestCharge returns an attribute KeyValue conforming
+// to the "azure.cosmosdb.operation.request_charge" semantic conventions. It
+// represents the number of request units consumed by the operation.
+func AzureCosmosDBOperationRequestCharge(val float64) attribute.KeyValue {
+ return AzureCosmosDBOperationRequestChargeKey.Float64(val)
+}
+
+// AzureCosmosDBRequestBodySize returns an attribute KeyValue conforming to the
+// "azure.cosmosdb.request.body.size" semantic conventions. It represents the
+// request payload size in bytes.
+func AzureCosmosDBRequestBodySize(val int) attribute.KeyValue {
+ return AzureCosmosDBRequestBodySizeKey.Int(val)
+}
+
+// AzureCosmosDBResponseSubStatusCode returns an attribute KeyValue conforming to
+// the "azure.cosmosdb.response.sub_status_code" semantic conventions. It
+// represents the cosmos DB sub status code.
+func AzureCosmosDBResponseSubStatusCode(val int) attribute.KeyValue {
+ return AzureCosmosDBResponseSubStatusCodeKey.Int(val)
+}
+
+// Enum values for azure.cosmosdb.connection.mode
+var (
+ // Gateway (HTTP) connection.
+ // Stability: development
+ AzureCosmosDBConnectionModeGateway = AzureCosmosDBConnectionModeKey.String("gateway")
+ // Direct connection.
+ // Stability: development
+ AzureCosmosDBConnectionModeDirect = AzureCosmosDBConnectionModeKey.String("direct")
+)
+
+// Enum values for azure.cosmosdb.consistency.level
+var (
+ // strong
+ // Stability: development
+ AzureCosmosDBConsistencyLevelStrong = AzureCosmosDBConsistencyLevelKey.String("Strong")
+ // bounded_staleness
+ // Stability: development
+ AzureCosmosDBConsistencyLevelBoundedStaleness = AzureCosmosDBConsistencyLevelKey.String("BoundedStaleness")
+ // session
+ // Stability: development
+ AzureCosmosDBConsistencyLevelSession = AzureCosmosDBConsistencyLevelKey.String("Session")
+ // eventual
+ // Stability: development
+ AzureCosmosDBConsistencyLevelEventual = AzureCosmosDBConsistencyLevelKey.String("Eventual")
+ // consistent_prefix
+ // Stability: development
+ AzureCosmosDBConsistencyLevelConsistentPrefix = AzureCosmosDBConsistencyLevelKey.String("ConsistentPrefix")
+)
+
+// Namespace: browser
+const (
+ // BrowserBrandsKey is the attribute Key conforming to the "browser.brands"
+ // semantic conventions. It represents the array of brand name and version
+ // separated by a space.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: " Not A;Brand 99", "Chromium 99", "Chrome 99"
+ // Note: This value is intended to be taken from the [UA client hints API] (
+ // `navigator.userAgentData.brands`).
+ //
+ // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface
+ BrowserBrandsKey = attribute.Key("browser.brands")
+
+ // BrowserLanguageKey is the attribute Key conforming to the "browser.language"
+ // semantic conventions. It represents the preferred language of the user using
+ // the browser.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "en", "en-US", "fr", "fr-FR"
+ // Note: This value is intended to be taken from the Navigator API
+ // `navigator.language`.
+ BrowserLanguageKey = attribute.Key("browser.language")
+
+ // BrowserMobileKey is the attribute Key conforming to the "browser.mobile"
+ // semantic conventions. It represents a boolean that is true if the browser is
+ // running on a mobile device.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: This value is intended to be taken from the [UA client hints API] (
+ // `navigator.userAgentData.mobile`). If unavailable, this attribute SHOULD be
+ // left unset.
+ //
+ // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface
+ BrowserMobileKey = attribute.Key("browser.mobile")
+
+ // BrowserPlatformKey is the attribute Key conforming to the "browser.platform"
+ // semantic conventions. It represents the platform on which the browser is
+ // running.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Windows", "macOS", "Android"
+ // Note: This value is intended to be taken from the [UA client hints API] (
+ // `navigator.userAgentData.platform`). If unavailable, the legacy
+ // `navigator.platform` API SHOULD NOT be used instead and this attribute SHOULD
+ // be left unset in order for the values to be consistent.
+ // The list of possible values is defined in the
+ // [W3C User-Agent Client Hints specification]. Note that some (but not all) of
+ // these values can overlap with values in the
+ // [`os.type` and `os.name` attributes]. However, for consistency, the values in
+ // the `browser.platform` attribute should capture the exact value that the user
+ // agent provides.
+ //
+ // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface
+ // [W3C User-Agent Client Hints specification]: https://wicg.github.io/ua-client-hints/#sec-ch-ua-platform
+ // [`os.type` and `os.name` attributes]: ./os.md
+ BrowserPlatformKey = attribute.Key("browser.platform")
+)
+
+// BrowserBrands returns an attribute KeyValue conforming to the "browser.brands"
+// semantic conventions. It represents the array of brand name and version
+// separated by a space.
+func BrowserBrands(val ...string) attribute.KeyValue {
+ return BrowserBrandsKey.StringSlice(val)
+}
+
+// BrowserLanguage returns an attribute KeyValue conforming to the
+// "browser.language" semantic conventions. It represents the preferred language
+// of the user using the browser.
+func BrowserLanguage(val string) attribute.KeyValue {
+ return BrowserLanguageKey.String(val)
+}
+
+// BrowserMobile returns an attribute KeyValue conforming to the "browser.mobile"
+// semantic conventions. It represents a boolean that is true if the browser is
+// running on a mobile device.
+func BrowserMobile(val bool) attribute.KeyValue {
+ return BrowserMobileKey.Bool(val)
+}
+
+// BrowserPlatform returns an attribute KeyValue conforming to the
+// "browser.platform" semantic conventions. It represents the platform on which
+// the browser is running.
+func BrowserPlatform(val string) attribute.KeyValue {
+ return BrowserPlatformKey.String(val)
+}
+
+// Namespace: cassandra
+const (
+ // CassandraConsistencyLevelKey is the attribute Key conforming to the
+ // "cassandra.consistency.level" semantic conventions. It represents the
+ // consistency level of the query. Based on consistency values from [CQL].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [CQL]: https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html
+ CassandraConsistencyLevelKey = attribute.Key("cassandra.consistency.level")
+
+ // CassandraCoordinatorDCKey is the attribute Key conforming to the
+ // "cassandra.coordinator.dc" semantic conventions. It represents the data
+ // center of the coordinating node for a query.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: us-west-2
+ CassandraCoordinatorDCKey = attribute.Key("cassandra.coordinator.dc")
+
+ // CassandraCoordinatorIDKey is the attribute Key conforming to the
+ // "cassandra.coordinator.id" semantic conventions. It represents the ID of the
+ // coordinating node for a query.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: be13faa2-8574-4d71-926d-27f16cf8a7af
+ CassandraCoordinatorIDKey = attribute.Key("cassandra.coordinator.id")
+
+ // CassandraPageSizeKey is the attribute Key conforming to the
+ // "cassandra.page.size" semantic conventions. It represents the fetch size used
+ // for paging, i.e. how many rows will be returned at once.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 5000
+ CassandraPageSizeKey = attribute.Key("cassandra.page.size")
+
+ // CassandraQueryIdempotentKey is the attribute Key conforming to the
+ // "cassandra.query.idempotent" semantic conventions. It represents the whether
+ // or not the query is idempotent.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ CassandraQueryIdempotentKey = attribute.Key("cassandra.query.idempotent")
+
+ // CassandraSpeculativeExecutionCountKey is the attribute Key conforming to the
+ // "cassandra.speculative_execution.count" semantic conventions. It represents
+ // the number of times a query was speculatively executed. Not set or `0` if the
+ // query was not executed speculatively.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0, 2
+ CassandraSpeculativeExecutionCountKey = attribute.Key("cassandra.speculative_execution.count")
+)
+
+// CassandraCoordinatorDC returns an attribute KeyValue conforming to the
+// "cassandra.coordinator.dc" semantic conventions. It represents the data center
+// of the coordinating node for a query.
+func CassandraCoordinatorDC(val string) attribute.KeyValue {
+ return CassandraCoordinatorDCKey.String(val)
+}
+
+// CassandraCoordinatorID returns an attribute KeyValue conforming to the
+// "cassandra.coordinator.id" semantic conventions. It represents the ID of the
+// coordinating node for a query.
+func CassandraCoordinatorID(val string) attribute.KeyValue {
+ return CassandraCoordinatorIDKey.String(val)
+}
+
+// CassandraPageSize returns an attribute KeyValue conforming to the
+// "cassandra.page.size" semantic conventions. It represents the fetch size used
+// for paging, i.e. how many rows will be returned at once.
+func CassandraPageSize(val int) attribute.KeyValue {
+ return CassandraPageSizeKey.Int(val)
+}
+
+// CassandraQueryIdempotent returns an attribute KeyValue conforming to the
+// "cassandra.query.idempotent" semantic conventions. It represents the whether
+// or not the query is idempotent.
+func CassandraQueryIdempotent(val bool) attribute.KeyValue {
+ return CassandraQueryIdempotentKey.Bool(val)
+}
+
+// CassandraSpeculativeExecutionCount returns an attribute KeyValue conforming to
+// the "cassandra.speculative_execution.count" semantic conventions. It
+// represents the number of times a query was speculatively executed. Not set or
+// `0` if the query was not executed speculatively.
+func CassandraSpeculativeExecutionCount(val int) attribute.KeyValue {
+ return CassandraSpeculativeExecutionCountKey.Int(val)
+}
+
+// Enum values for cassandra.consistency.level
+var (
+ // all
+ // Stability: development
+ CassandraConsistencyLevelAll = CassandraConsistencyLevelKey.String("all")
+ // each_quorum
+ // Stability: development
+ CassandraConsistencyLevelEachQuorum = CassandraConsistencyLevelKey.String("each_quorum")
+ // quorum
+ // Stability: development
+ CassandraConsistencyLevelQuorum = CassandraConsistencyLevelKey.String("quorum")
+ // local_quorum
+ // Stability: development
+ CassandraConsistencyLevelLocalQuorum = CassandraConsistencyLevelKey.String("local_quorum")
+ // one
+ // Stability: development
+ CassandraConsistencyLevelOne = CassandraConsistencyLevelKey.String("one")
+ // two
+ // Stability: development
+ CassandraConsistencyLevelTwo = CassandraConsistencyLevelKey.String("two")
+ // three
+ // Stability: development
+ CassandraConsistencyLevelThree = CassandraConsistencyLevelKey.String("three")
+ // local_one
+ // Stability: development
+ CassandraConsistencyLevelLocalOne = CassandraConsistencyLevelKey.String("local_one")
+ // any
+ // Stability: development
+ CassandraConsistencyLevelAny = CassandraConsistencyLevelKey.String("any")
+ // serial
+ // Stability: development
+ CassandraConsistencyLevelSerial = CassandraConsistencyLevelKey.String("serial")
+ // local_serial
+ // Stability: development
+ CassandraConsistencyLevelLocalSerial = CassandraConsistencyLevelKey.String("local_serial")
+)
+
+// Namespace: cicd
+const (
+ // CICDPipelineActionNameKey is the attribute Key conforming to the
+ // "cicd.pipeline.action.name" semantic conventions. It represents the kind of
+ // action a pipeline run is performing.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "BUILD", "RUN", "SYNC"
+ CICDPipelineActionNameKey = attribute.Key("cicd.pipeline.action.name")
+
+ // CICDPipelineNameKey is the attribute Key conforming to the
+ // "cicd.pipeline.name" semantic conventions. It represents the human readable
+ // name of the pipeline within a CI/CD system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Build and Test", "Lint", "Deploy Go Project",
+ // "deploy_to_environment"
+ CICDPipelineNameKey = attribute.Key("cicd.pipeline.name")
+
+ // CICDPipelineResultKey is the attribute Key conforming to the
+ // "cicd.pipeline.result" semantic conventions. It represents the result of a
+ // pipeline run.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "success", "failure", "timeout", "skipped"
+ CICDPipelineResultKey = attribute.Key("cicd.pipeline.result")
+
+ // CICDPipelineRunIDKey is the attribute Key conforming to the
+ // "cicd.pipeline.run.id" semantic conventions. It represents the unique
+ // identifier of a pipeline run within a CI/CD system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "120912"
+ CICDPipelineRunIDKey = attribute.Key("cicd.pipeline.run.id")
+
+ // CICDPipelineRunStateKey is the attribute Key conforming to the
+ // "cicd.pipeline.run.state" semantic conventions. It represents the pipeline
+ // run goes through these states during its lifecycle.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pending", "executing", "finalizing"
+ CICDPipelineRunStateKey = attribute.Key("cicd.pipeline.run.state")
+
+ // CICDPipelineRunURLFullKey is the attribute Key conforming to the
+ // "cicd.pipeline.run.url.full" semantic conventions. It represents the [URL] of
+ // the pipeline run, providing the complete address in order to locate and
+ // identify the pipeline run.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763?pr=1075"
+ //
+ // [URL]: https://wikipedia.org/wiki/URL
+ CICDPipelineRunURLFullKey = attribute.Key("cicd.pipeline.run.url.full")
+
+ // CICDPipelineTaskNameKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.name" semantic conventions. It represents the human
+ // readable name of a task within a pipeline. Task here most closely aligns with
+ // a [computing process] in a pipeline. Other terms for tasks include commands,
+ // steps, and procedures.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Run GoLang Linter", "Go Build", "go-test", "deploy_binary"
+ //
+ // [computing process]: https://wikipedia.org/wiki/Pipeline_(computing)
+ CICDPipelineTaskNameKey = attribute.Key("cicd.pipeline.task.name")
+
+ // CICDPipelineTaskRunIDKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.run.id" semantic conventions. It represents the unique
+ // identifier of a task run within a pipeline.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "12097"
+ CICDPipelineTaskRunIDKey = attribute.Key("cicd.pipeline.task.run.id")
+
+ // CICDPipelineTaskRunResultKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.run.result" semantic conventions. It represents the
+ // result of a task run.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "success", "failure", "timeout", "skipped"
+ CICDPipelineTaskRunResultKey = attribute.Key("cicd.pipeline.task.run.result")
+
+ // CICDPipelineTaskRunURLFullKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.run.url.full" semantic conventions. It represents the
+ // [URL] of the pipeline task run, providing the complete address in order to
+ // locate and identify the pipeline task run.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763/job/26920038674?pr=1075"
+ //
+ // [URL]: https://wikipedia.org/wiki/URL
+ CICDPipelineTaskRunURLFullKey = attribute.Key("cicd.pipeline.task.run.url.full")
+
+ // CICDPipelineTaskTypeKey is the attribute Key conforming to the
+ // "cicd.pipeline.task.type" semantic conventions. It represents the type of the
+ // task within a pipeline.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "build", "test", "deploy"
+ CICDPipelineTaskTypeKey = attribute.Key("cicd.pipeline.task.type")
+
+ // CICDSystemComponentKey is the attribute Key conforming to the
+ // "cicd.system.component" semantic conventions. It represents the name of a
+ // component of the CICD system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "controller", "scheduler", "agent"
+ CICDSystemComponentKey = attribute.Key("cicd.system.component")
+
+ // CICDWorkerIDKey is the attribute Key conforming to the "cicd.worker.id"
+ // semantic conventions. It represents the unique identifier of a worker within
+ // a CICD system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "abc123", "10.0.1.2", "controller"
+ CICDWorkerIDKey = attribute.Key("cicd.worker.id")
+
+ // CICDWorkerNameKey is the attribute Key conforming to the "cicd.worker.name"
+ // semantic conventions. It represents the name of a worker within a CICD
+ // system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "agent-abc", "controller", "Ubuntu LTS"
+ CICDWorkerNameKey = attribute.Key("cicd.worker.name")
+
+ // CICDWorkerStateKey is the attribute Key conforming to the "cicd.worker.state"
+ // semantic conventions. It represents the state of a CICD worker / agent.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "idle", "busy", "down"
+ CICDWorkerStateKey = attribute.Key("cicd.worker.state")
+
+ // CICDWorkerURLFullKey is the attribute Key conforming to the
+ // "cicd.worker.url.full" semantic conventions. It represents the [URL] of the
+ // worker, providing the complete address in order to locate and identify the
+ // worker.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://cicd.example.org/worker/abc123"
+ //
+ // [URL]: https://wikipedia.org/wiki/URL
+ CICDWorkerURLFullKey = attribute.Key("cicd.worker.url.full")
+)
+
+// CICDPipelineName returns an attribute KeyValue conforming to the
+// "cicd.pipeline.name" semantic conventions. It represents the human readable
+// name of the pipeline within a CI/CD system.
+func CICDPipelineName(val string) attribute.KeyValue {
+ return CICDPipelineNameKey.String(val)
+}
+
+// CICDPipelineRunID returns an attribute KeyValue conforming to the
+// "cicd.pipeline.run.id" semantic conventions. It represents the unique
+// identifier of a pipeline run within a CI/CD system.
+func CICDPipelineRunID(val string) attribute.KeyValue {
+ return CICDPipelineRunIDKey.String(val)
+}
+
+// CICDPipelineRunURLFull returns an attribute KeyValue conforming to the
+// "cicd.pipeline.run.url.full" semantic conventions. It represents the [URL] of
+// the pipeline run, providing the complete address in order to locate and
+// identify the pipeline run.
+//
+// [URL]: https://wikipedia.org/wiki/URL
+func CICDPipelineRunURLFull(val string) attribute.KeyValue {
+ return CICDPipelineRunURLFullKey.String(val)
+}
+
+// CICDPipelineTaskName returns an attribute KeyValue conforming to the
+// "cicd.pipeline.task.name" semantic conventions. It represents the human
+// readable name of a task within a pipeline. Task here most closely aligns with
+// a [computing process] in a pipeline. Other terms for tasks include commands,
+// steps, and procedures.
+//
+// [computing process]: https://wikipedia.org/wiki/Pipeline_(computing)
+func CICDPipelineTaskName(val string) attribute.KeyValue {
+ return CICDPipelineTaskNameKey.String(val)
+}
+
+// CICDPipelineTaskRunID returns an attribute KeyValue conforming to the
+// "cicd.pipeline.task.run.id" semantic conventions. It represents the unique
+// identifier of a task run within a pipeline.
+func CICDPipelineTaskRunID(val string) attribute.KeyValue {
+ return CICDPipelineTaskRunIDKey.String(val)
+}
+
+// CICDPipelineTaskRunURLFull returns an attribute KeyValue conforming to the
+// "cicd.pipeline.task.run.url.full" semantic conventions. It represents the
+// [URL] of the pipeline task run, providing the complete address in order to
+// locate and identify the pipeline task run.
+//
+// [URL]: https://wikipedia.org/wiki/URL
+func CICDPipelineTaskRunURLFull(val string) attribute.KeyValue {
+ return CICDPipelineTaskRunURLFullKey.String(val)
+}
+
+// CICDSystemComponent returns an attribute KeyValue conforming to the
+// "cicd.system.component" semantic conventions. It represents the name of a
+// component of the CICD system.
+func CICDSystemComponent(val string) attribute.KeyValue {
+ return CICDSystemComponentKey.String(val)
+}
+
+// CICDWorkerID returns an attribute KeyValue conforming to the "cicd.worker.id"
+// semantic conventions. It represents the unique identifier of a worker within a
+// CICD system.
+func CICDWorkerID(val string) attribute.KeyValue {
+ return CICDWorkerIDKey.String(val)
+}
+
+// CICDWorkerName returns an attribute KeyValue conforming to the
+// "cicd.worker.name" semantic conventions. It represents the name of a worker
+// within a CICD system.
+func CICDWorkerName(val string) attribute.KeyValue {
+ return CICDWorkerNameKey.String(val)
+}
+
+// CICDWorkerURLFull returns an attribute KeyValue conforming to the
+// "cicd.worker.url.full" semantic conventions. It represents the [URL] of the
+// worker, providing the complete address in order to locate and identify the
+// worker.
+//
+// [URL]: https://wikipedia.org/wiki/URL
+func CICDWorkerURLFull(val string) attribute.KeyValue {
+ return CICDWorkerURLFullKey.String(val)
+}
+
+// Enum values for cicd.pipeline.action.name
+var (
+ // The pipeline run is executing a build.
+ // Stability: development
+ CICDPipelineActionNameBuild = CICDPipelineActionNameKey.String("BUILD")
+ // The pipeline run is executing.
+ // Stability: development
+ CICDPipelineActionNameRun = CICDPipelineActionNameKey.String("RUN")
+ // The pipeline run is executing a sync.
+ // Stability: development
+ CICDPipelineActionNameSync = CICDPipelineActionNameKey.String("SYNC")
+)
+
+// Enum values for cicd.pipeline.result
+var (
+ // The pipeline run finished successfully.
+ // Stability: development
+ CICDPipelineResultSuccess = CICDPipelineResultKey.String("success")
+ // The pipeline run did not finish successfully, eg. due to a compile error or a
+ // failing test. Such failures are usually detected by non-zero exit codes of
+ // the tools executed in the pipeline run.
+ // Stability: development
+ CICDPipelineResultFailure = CICDPipelineResultKey.String("failure")
+ // The pipeline run failed due to an error in the CICD system, eg. due to the
+ // worker being killed.
+ // Stability: development
+ CICDPipelineResultError = CICDPipelineResultKey.String("error")
+ // A timeout caused the pipeline run to be interrupted.
+ // Stability: development
+ CICDPipelineResultTimeout = CICDPipelineResultKey.String("timeout")
+ // The pipeline run was cancelled, eg. by a user manually cancelling the
+ // pipeline run.
+ // Stability: development
+ CICDPipelineResultCancellation = CICDPipelineResultKey.String("cancellation")
+ // The pipeline run was skipped, eg. due to a precondition not being met.
+ // Stability: development
+ CICDPipelineResultSkip = CICDPipelineResultKey.String("skip")
+)
+
+// Enum values for cicd.pipeline.run.state
+var (
+ // The run pending state spans from the event triggering the pipeline run until
+ // the execution of the run starts (eg. time spent in a queue, provisioning
+ // agents, creating run resources).
+ //
+ // Stability: development
+ CICDPipelineRunStatePending = CICDPipelineRunStateKey.String("pending")
+ // The executing state spans the execution of any run tasks (eg. build, test).
+ // Stability: development
+ CICDPipelineRunStateExecuting = CICDPipelineRunStateKey.String("executing")
+ // The finalizing state spans from when the run has finished executing (eg.
+ // cleanup of run resources).
+ // Stability: development
+ CICDPipelineRunStateFinalizing = CICDPipelineRunStateKey.String("finalizing")
+)
+
+// Enum values for cicd.pipeline.task.run.result
+var (
+ // The task run finished successfully.
+ // Stability: development
+ CICDPipelineTaskRunResultSuccess = CICDPipelineTaskRunResultKey.String("success")
+ // The task run did not finish successfully, eg. due to a compile error or a
+ // failing test. Such failures are usually detected by non-zero exit codes of
+ // the tools executed in the task run.
+ // Stability: development
+ CICDPipelineTaskRunResultFailure = CICDPipelineTaskRunResultKey.String("failure")
+ // The task run failed due to an error in the CICD system, eg. due to the worker
+ // being killed.
+ // Stability: development
+ CICDPipelineTaskRunResultError = CICDPipelineTaskRunResultKey.String("error")
+ // A timeout caused the task run to be interrupted.
+ // Stability: development
+ CICDPipelineTaskRunResultTimeout = CICDPipelineTaskRunResultKey.String("timeout")
+ // The task run was cancelled, eg. by a user manually cancelling the task run.
+ // Stability: development
+ CICDPipelineTaskRunResultCancellation = CICDPipelineTaskRunResultKey.String("cancellation")
+ // The task run was skipped, eg. due to a precondition not being met.
+ // Stability: development
+ CICDPipelineTaskRunResultSkip = CICDPipelineTaskRunResultKey.String("skip")
+)
+
+// Enum values for cicd.pipeline.task.type
+var (
+ // build
+ // Stability: development
+ CICDPipelineTaskTypeBuild = CICDPipelineTaskTypeKey.String("build")
+ // test
+ // Stability: development
+ CICDPipelineTaskTypeTest = CICDPipelineTaskTypeKey.String("test")
+ // deploy
+ // Stability: development
+ CICDPipelineTaskTypeDeploy = CICDPipelineTaskTypeKey.String("deploy")
+)
+
+// Enum values for cicd.worker.state
+var (
+ // The worker is not performing work for the CICD system. It is available to the
+ // CICD system to perform work on (online / idle).
+ // Stability: development
+ CICDWorkerStateAvailable = CICDWorkerStateKey.String("available")
+ // The worker is performing work for the CICD system.
+ // Stability: development
+ CICDWorkerStateBusy = CICDWorkerStateKey.String("busy")
+ // The worker is not available to the CICD system (disconnected / down).
+ // Stability: development
+ CICDWorkerStateOffline = CICDWorkerStateKey.String("offline")
+)
+
+// Namespace: client
+const (
+ // ClientAddressKey is the attribute Key conforming to the "client.address"
+ // semantic conventions. It represents the client address - domain name if
+ // available without reverse DNS lookup; otherwise, IP address or Unix domain
+ // socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "client.example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the server side, and when communicating through an
+ // intermediary, `client.address` SHOULD represent the client address behind any
+ // intermediaries, for example proxies, if it's available.
+ ClientAddressKey = attribute.Key("client.address")
+
+ // ClientPortKey is the attribute Key conforming to the "client.port" semantic
+ // conventions. It represents the client port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 65123
+ // Note: When observed from the server side, and when communicating through an
+ // intermediary, `client.port` SHOULD represent the client port behind any
+ // intermediaries, for example proxies, if it's available.
+ ClientPortKey = attribute.Key("client.port")
+)
+
+// ClientAddress returns an attribute KeyValue conforming to the "client.address"
+// semantic conventions. It represents the client address - domain name if
+// available without reverse DNS lookup; otherwise, IP address or Unix domain
+// socket name.
+func ClientAddress(val string) attribute.KeyValue {
+ return ClientAddressKey.String(val)
+}
+
+// ClientPort returns an attribute KeyValue conforming to the "client.port"
+// semantic conventions. It represents the client port number.
+func ClientPort(val int) attribute.KeyValue {
+ return ClientPortKey.Int(val)
+}
+
+// Namespace: cloud
+const (
+ // CloudAccountIDKey is the attribute Key conforming to the "cloud.account.id"
+ // semantic conventions. It represents the cloud account ID the resource is
+ // assigned to.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "111111111111", "opentelemetry"
+ CloudAccountIDKey = attribute.Key("cloud.account.id")
+
+ // CloudAvailabilityZoneKey is the attribute Key conforming to the
+ // "cloud.availability_zone" semantic conventions. It represents the cloud
+ // regions often have multiple, isolated locations known as zones to increase
+ // availability. Availability zone represents the zone where the resource is
+ // running.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "us-east-1c"
+ // Note: Availability zones are called "zones" on Alibaba Cloud and Google
+ // Cloud.
+ CloudAvailabilityZoneKey = attribute.Key("cloud.availability_zone")
+
+ // CloudPlatformKey is the attribute Key conforming to the "cloud.platform"
+ // semantic conventions. It represents the cloud platform in use.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: The prefix of the service SHOULD match the one specified in
+ // `cloud.provider`.
+ CloudPlatformKey = attribute.Key("cloud.platform")
+
+ // CloudProviderKey is the attribute Key conforming to the "cloud.provider"
+ // semantic conventions. It represents the name of the cloud provider.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ CloudProviderKey = attribute.Key("cloud.provider")
+
+ // CloudRegionKey is the attribute Key conforming to the "cloud.region" semantic
+ // conventions. It represents the geographical region within a cloud provider.
+ // When associated with a resource, this attribute specifies the region where
+ // the resource operates. When calling services or APIs deployed on a cloud,
+ // this attribute identifies the region where the called destination is
+ // deployed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "us-central1", "us-east-1"
+ // Note: Refer to your provider's docs to see the available regions, for example
+ // [Alibaba Cloud regions], [AWS regions], [Azure regions],
+ // [Google Cloud regions], or [Tencent Cloud regions].
+ //
+ // [Alibaba Cloud regions]: https://www.alibabacloud.com/help/doc-detail/40654.htm
+ // [AWS regions]: https://aws.amazon.com/about-aws/global-infrastructure/regions_az/
+ // [Azure regions]: https://azure.microsoft.com/global-infrastructure/geographies/
+ // [Google Cloud regions]: https://cloud.google.com/about/locations
+ // [Tencent Cloud regions]: https://www.tencentcloud.com/document/product/213/6091
+ CloudRegionKey = attribute.Key("cloud.region")
+
+ // CloudResourceIDKey is the attribute Key conforming to the "cloud.resource_id"
+ // semantic conventions. It represents the cloud provider-specific native
+ // identifier of the monitored cloud resource (e.g. an [ARN] on AWS, a
+ // [fully qualified resource ID] on Azure, a [full resource name] on GCP).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "arn:aws:lambda:REGION:ACCOUNT_ID:function:my-function",
+ // "//run.googleapis.com/projects/PROJECT_ID/locations/LOCATION_ID/services/SERVICE_ID",
+ // "/subscriptions//resourceGroups/
+ // /providers/Microsoft.Web/sites//functions/"
+ // Note: On some cloud providers, it may not be possible to determine the full
+ // ID at startup,
+ // so it may be necessary to set `cloud.resource_id` as a span attribute
+ // instead.
+ //
+ // The exact value to use for `cloud.resource_id` depends on the cloud provider.
+ // The following well-known definitions MUST be used if you set this attribute
+ // and they apply:
+ //
+ // - **AWS Lambda:** The function [ARN].
+ // Take care not to use the "invoked ARN" directly but replace any
+ // [alias suffix]
+ // with the resolved function version, as the same runtime instance may be
+ // invocable with
+ // multiple different aliases.
+ // - **GCP:** The [URI of the resource]
+ // - **Azure:** The [Fully Qualified Resource ID] of the invoked function,
+ // *not* the function app, having the form
+ //
+ // `/subscriptions//resourceGroups//providers/Microsoft.Web/sites//functions/`
+ // .
+ // This means that a span attribute MUST be used, as an Azure function app
+ // can host multiple functions that would usually share
+ // a TracerProvider.
+ //
+ //
+ // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html
+ // [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id
+ // [full resource name]: https://google.aip.dev/122#full-resource-names
+ // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html
+ // [alias suffix]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-aliases.html
+ // [URI of the resource]: https://cloud.google.com/iam/docs/full-resource-names
+ // [Fully Qualified Resource ID]: https://docs.microsoft.com/rest/api/resources/resources/get-by-id
+ CloudResourceIDKey = attribute.Key("cloud.resource_id")
+)
+
+// CloudAccountID returns an attribute KeyValue conforming to the
+// "cloud.account.id" semantic conventions. It represents the cloud account ID
+// the resource is assigned to.
+func CloudAccountID(val string) attribute.KeyValue {
+ return CloudAccountIDKey.String(val)
+}
+
+// CloudAvailabilityZone returns an attribute KeyValue conforming to the
+// "cloud.availability_zone" semantic conventions. It represents the cloud
+// regions often have multiple, isolated locations known as zones to increase
+// availability. Availability zone represents the zone where the resource is
+// running.
+func CloudAvailabilityZone(val string) attribute.KeyValue {
+ return CloudAvailabilityZoneKey.String(val)
+}
+
+// CloudRegion returns an attribute KeyValue conforming to the "cloud.region"
+// semantic conventions. It represents the geographical region within a cloud
+// provider. When associated with a resource, this attribute specifies the region
+// where the resource operates. When calling services or APIs deployed on a
+// cloud, this attribute identifies the region where the called destination is
+// deployed.
+func CloudRegion(val string) attribute.KeyValue {
+ return CloudRegionKey.String(val)
+}
+
+// CloudResourceID returns an attribute KeyValue conforming to the
+// "cloud.resource_id" semantic conventions. It represents the cloud
+// provider-specific native identifier of the monitored cloud resource (e.g. an
+// [ARN] on AWS, a [fully qualified resource ID] on Azure, a [full resource name]
+// on GCP).
+//
+// [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html
+// [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id
+// [full resource name]: https://google.aip.dev/122#full-resource-names
+func CloudResourceID(val string) attribute.KeyValue {
+ return CloudResourceIDKey.String(val)
+}
+
+// Enum values for cloud.platform
+var (
+ // Alibaba Cloud Elastic Compute Service
+ // Stability: development
+ CloudPlatformAlibabaCloudECS = CloudPlatformKey.String("alibaba_cloud_ecs")
+ // Alibaba Cloud Function Compute
+ // Stability: development
+ CloudPlatformAlibabaCloudFC = CloudPlatformKey.String("alibaba_cloud_fc")
+ // Red Hat OpenShift on Alibaba Cloud
+ // Stability: development
+ CloudPlatformAlibabaCloudOpenShift = CloudPlatformKey.String("alibaba_cloud_openshift")
+ // AWS Elastic Compute Cloud
+ // Stability: development
+ CloudPlatformAWSEC2 = CloudPlatformKey.String("aws_ec2")
+ // AWS Elastic Container Service
+ // Stability: development
+ CloudPlatformAWSECS = CloudPlatformKey.String("aws_ecs")
+ // AWS Elastic Kubernetes Service
+ // Stability: development
+ CloudPlatformAWSEKS = CloudPlatformKey.String("aws_eks")
+ // AWS Lambda
+ // Stability: development
+ CloudPlatformAWSLambda = CloudPlatformKey.String("aws_lambda")
+ // AWS Elastic Beanstalk
+ // Stability: development
+ CloudPlatformAWSElasticBeanstalk = CloudPlatformKey.String("aws_elastic_beanstalk")
+ // AWS App Runner
+ // Stability: development
+ CloudPlatformAWSAppRunner = CloudPlatformKey.String("aws_app_runner")
+ // Red Hat OpenShift on AWS (ROSA)
+ // Stability: development
+ CloudPlatformAWSOpenShift = CloudPlatformKey.String("aws_openshift")
+ // Azure Virtual Machines
+ // Stability: development
+ CloudPlatformAzureVM = CloudPlatformKey.String("azure_vm")
+ // Azure Container Apps
+ // Stability: development
+ CloudPlatformAzureContainerApps = CloudPlatformKey.String("azure_container_apps")
+ // Azure Container Instances
+ // Stability: development
+ CloudPlatformAzureContainerInstances = CloudPlatformKey.String("azure_container_instances")
+ // Azure Kubernetes Service
+ // Stability: development
+ CloudPlatformAzureAKS = CloudPlatformKey.String("azure_aks")
+ // Azure Functions
+ // Stability: development
+ CloudPlatformAzureFunctions = CloudPlatformKey.String("azure_functions")
+ // Azure App Service
+ // Stability: development
+ CloudPlatformAzureAppService = CloudPlatformKey.String("azure_app_service")
+ // Azure Red Hat OpenShift
+ // Stability: development
+ CloudPlatformAzureOpenShift = CloudPlatformKey.String("azure_openshift")
+ // Google Bare Metal Solution (BMS)
+ // Stability: development
+ CloudPlatformGCPBareMetalSolution = CloudPlatformKey.String("gcp_bare_metal_solution")
+ // Google Cloud Compute Engine (GCE)
+ // Stability: development
+ CloudPlatformGCPComputeEngine = CloudPlatformKey.String("gcp_compute_engine")
+ // Google Cloud Run
+ // Stability: development
+ CloudPlatformGCPCloudRun = CloudPlatformKey.String("gcp_cloud_run")
+ // Google Cloud Kubernetes Engine (GKE)
+ // Stability: development
+ CloudPlatformGCPKubernetesEngine = CloudPlatformKey.String("gcp_kubernetes_engine")
+ // Google Cloud Functions (GCF)
+ // Stability: development
+ CloudPlatformGCPCloudFunctions = CloudPlatformKey.String("gcp_cloud_functions")
+ // Google Cloud App Engine (GAE)
+ // Stability: development
+ CloudPlatformGCPAppEngine = CloudPlatformKey.String("gcp_app_engine")
+ // Red Hat OpenShift on Google Cloud
+ // Stability: development
+ CloudPlatformGCPOpenShift = CloudPlatformKey.String("gcp_openshift")
+ // Red Hat OpenShift on IBM Cloud
+ // Stability: development
+ CloudPlatformIBMCloudOpenShift = CloudPlatformKey.String("ibm_cloud_openshift")
+ // Compute on Oracle Cloud Infrastructure (OCI)
+ // Stability: development
+ CloudPlatformOracleCloudCompute = CloudPlatformKey.String("oracle_cloud_compute")
+ // Kubernetes Engine (OKE) on Oracle Cloud Infrastructure (OCI)
+ // Stability: development
+ CloudPlatformOracleCloudOKE = CloudPlatformKey.String("oracle_cloud_oke")
+ // Tencent Cloud Cloud Virtual Machine (CVM)
+ // Stability: development
+ CloudPlatformTencentCloudCVM = CloudPlatformKey.String("tencent_cloud_cvm")
+ // Tencent Cloud Elastic Kubernetes Service (EKS)
+ // Stability: development
+ CloudPlatformTencentCloudEKS = CloudPlatformKey.String("tencent_cloud_eks")
+ // Tencent Cloud Serverless Cloud Function (SCF)
+ // Stability: development
+ CloudPlatformTencentCloudSCF = CloudPlatformKey.String("tencent_cloud_scf")
+)
+
+// Enum values for cloud.provider
+var (
+ // Alibaba Cloud
+ // Stability: development
+ CloudProviderAlibabaCloud = CloudProviderKey.String("alibaba_cloud")
+ // Amazon Web Services
+ // Stability: development
+ CloudProviderAWS = CloudProviderKey.String("aws")
+ // Microsoft Azure
+ // Stability: development
+ CloudProviderAzure = CloudProviderKey.String("azure")
+ // Google Cloud Platform
+ // Stability: development
+ CloudProviderGCP = CloudProviderKey.String("gcp")
+ // Heroku Platform as a Service
+ // Stability: development
+ CloudProviderHeroku = CloudProviderKey.String("heroku")
+ // IBM Cloud
+ // Stability: development
+ CloudProviderIBMCloud = CloudProviderKey.String("ibm_cloud")
+ // Oracle Cloud Infrastructure (OCI)
+ // Stability: development
+ CloudProviderOracleCloud = CloudProviderKey.String("oracle_cloud")
+ // Tencent Cloud
+ // Stability: development
+ CloudProviderTencentCloud = CloudProviderKey.String("tencent_cloud")
+)
+
+// Namespace: cloudevents
+const (
+ // CloudEventsEventIDKey is the attribute Key conforming to the
+ // "cloudevents.event_id" semantic conventions. It represents the [event_id]
+ // uniquely identifies the event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "123e4567-e89b-12d3-a456-426614174000", "0001"
+ //
+ // [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id
+ CloudEventsEventIDKey = attribute.Key("cloudevents.event_id")
+
+ // CloudEventsEventSourceKey is the attribute Key conforming to the
+ // "cloudevents.event_source" semantic conventions. It represents the [source]
+ // identifies the context in which an event happened.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://github.com/cloudevents", "/cloudevents/spec/pull/123",
+ // "my-service"
+ //
+ // [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1
+ CloudEventsEventSourceKey = attribute.Key("cloudevents.event_source")
+
+ // CloudEventsEventSpecVersionKey is the attribute Key conforming to the
+ // "cloudevents.event_spec_version" semantic conventions. It represents the
+ // [version of the CloudEvents specification] which the event uses.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0
+ //
+ // [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion
+ CloudEventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version")
+
+ // CloudEventsEventSubjectKey is the attribute Key conforming to the
+ // "cloudevents.event_subject" semantic conventions. It represents the [subject]
+ // of the event in the context of the event producer (identified by source).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: mynewfile.jpg
+ //
+ // [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject
+ CloudEventsEventSubjectKey = attribute.Key("cloudevents.event_subject")
+
+ // CloudEventsEventTypeKey is the attribute Key conforming to the
+ // "cloudevents.event_type" semantic conventions. It represents the [event_type]
+ // contains a value describing the type of event related to the originating
+ // occurrence.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "com.github.pull_request.opened", "com.example.object.deleted.v2"
+ //
+ // [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type
+ CloudEventsEventTypeKey = attribute.Key("cloudevents.event_type")
+)
+
+// CloudEventsEventID returns an attribute KeyValue conforming to the
+// "cloudevents.event_id" semantic conventions. It represents the [event_id]
+// uniquely identifies the event.
+//
+// [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id
+func CloudEventsEventID(val string) attribute.KeyValue {
+ return CloudEventsEventIDKey.String(val)
+}
+
+// CloudEventsEventSource returns an attribute KeyValue conforming to the
+// "cloudevents.event_source" semantic conventions. It represents the [source]
+// identifies the context in which an event happened.
+//
+// [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1
+func CloudEventsEventSource(val string) attribute.KeyValue {
+ return CloudEventsEventSourceKey.String(val)
+}
+
+// CloudEventsEventSpecVersion returns an attribute KeyValue conforming to the
+// "cloudevents.event_spec_version" semantic conventions. It represents the
+// [version of the CloudEvents specification] which the event uses.
+//
+// [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion
+func CloudEventsEventSpecVersion(val string) attribute.KeyValue {
+ return CloudEventsEventSpecVersionKey.String(val)
+}
+
+// CloudEventsEventSubject returns an attribute KeyValue conforming to the
+// "cloudevents.event_subject" semantic conventions. It represents the [subject]
+// of the event in the context of the event producer (identified by source).
+//
+// [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject
+func CloudEventsEventSubject(val string) attribute.KeyValue {
+ return CloudEventsEventSubjectKey.String(val)
+}
+
+// CloudEventsEventType returns an attribute KeyValue conforming to the
+// "cloudevents.event_type" semantic conventions. It represents the [event_type]
+// contains a value describing the type of event related to the originating
+// occurrence.
+//
+// [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type
+func CloudEventsEventType(val string) attribute.KeyValue {
+ return CloudEventsEventTypeKey.String(val)
+}
+
+// Namespace: cloudfoundry
+const (
+ // CloudFoundryAppIDKey is the attribute Key conforming to the
+ // "cloudfoundry.app.id" semantic conventions. It represents the guid of the
+ // application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.application_id`. This is the same value as
+ // reported by `cf app --guid`.
+ CloudFoundryAppIDKey = attribute.Key("cloudfoundry.app.id")
+
+ // CloudFoundryAppInstanceIDKey is the attribute Key conforming to the
+ // "cloudfoundry.app.instance.id" semantic conventions. It represents the index
+ // of the application instance. 0 when just one instance is active.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0", "1"
+ // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope]
+ // .
+ // It is used for logs and metrics emitted by CloudFoundry. It is
+ // supposed to contain the application instance index for applications
+ // deployed on the runtime.
+ //
+ // Application instrumentation should use the value from environment
+ // variable `CF_INSTANCE_INDEX`.
+ //
+ // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope
+ CloudFoundryAppInstanceIDKey = attribute.Key("cloudfoundry.app.instance.id")
+
+ // CloudFoundryAppNameKey is the attribute Key conforming to the
+ // "cloudfoundry.app.name" semantic conventions. It represents the name of the
+ // application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-app-name"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.application_name`. This is the same value
+ // as reported by `cf apps`.
+ CloudFoundryAppNameKey = attribute.Key("cloudfoundry.app.name")
+
+ // CloudFoundryOrgIDKey is the attribute Key conforming to the
+ // "cloudfoundry.org.id" semantic conventions. It represents the guid of the
+ // CloudFoundry org the application is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.org_id`. This is the same value as
+ // reported by `cf org --guid`.
+ CloudFoundryOrgIDKey = attribute.Key("cloudfoundry.org.id")
+
+ // CloudFoundryOrgNameKey is the attribute Key conforming to the
+ // "cloudfoundry.org.name" semantic conventions. It represents the name of the
+ // CloudFoundry organization the app is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-org-name"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.org_name`. This is the same value as
+ // reported by `cf orgs`.
+ CloudFoundryOrgNameKey = attribute.Key("cloudfoundry.org.name")
+
+ // CloudFoundryProcessIDKey is the attribute Key conforming to the
+ // "cloudfoundry.process.id" semantic conventions. It represents the UID
+ // identifying the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.process_id`. It is supposed to be equal to
+ // `VCAP_APPLICATION.app_id` for applications deployed to the runtime.
+ // For system components, this could be the actual PID.
+ CloudFoundryProcessIDKey = attribute.Key("cloudfoundry.process.id")
+
+ // CloudFoundryProcessTypeKey is the attribute Key conforming to the
+ // "cloudfoundry.process.type" semantic conventions. It represents the type of
+ // process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "web"
+ // Note: CloudFoundry applications can consist of multiple jobs. Usually the
+ // main process will be of type `web`. There can be additional background
+ // tasks or side-cars with different process types.
+ CloudFoundryProcessTypeKey = attribute.Key("cloudfoundry.process.type")
+
+ // CloudFoundrySpaceIDKey is the attribute Key conforming to the
+ // "cloudfoundry.space.id" semantic conventions. It represents the guid of the
+ // CloudFoundry space the application is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.space_id`. This is the same value as
+ // reported by `cf space --guid`.
+ CloudFoundrySpaceIDKey = attribute.Key("cloudfoundry.space.id")
+
+ // CloudFoundrySpaceNameKey is the attribute Key conforming to the
+ // "cloudfoundry.space.name" semantic conventions. It represents the name of the
+ // CloudFoundry space the application is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-space-name"
+ // Note: Application instrumentation should use the value from environment
+ // variable `VCAP_APPLICATION.space_name`. This is the same value as
+ // reported by `cf spaces`.
+ CloudFoundrySpaceNameKey = attribute.Key("cloudfoundry.space.name")
+
+ // CloudFoundrySystemIDKey is the attribute Key conforming to the
+ // "cloudfoundry.system.id" semantic conventions. It represents a guid or
+ // another name describing the event source.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cf/gorouter"
+ // Note: CloudFoundry defines the `source_id` in the [Loggregator v2 envelope].
+ // It is used for logs and metrics emitted by CloudFoundry. It is
+ // supposed to contain the component name, e.g. "gorouter", for
+ // CloudFoundry components.
+ //
+ // When system components are instrumented, values from the
+ // [Bosh spec]
+ // should be used. The `system.id` should be set to
+ // `spec.deployment/spec.name`.
+ //
+ // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope
+ // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec
+ CloudFoundrySystemIDKey = attribute.Key("cloudfoundry.system.id")
+
+ // CloudFoundrySystemInstanceIDKey is the attribute Key conforming to the
+ // "cloudfoundry.system.instance.id" semantic conventions. It represents a guid
+ // describing the concrete instance of the event source.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope]
+ // .
+ // It is used for logs and metrics emitted by CloudFoundry. It is
+ // supposed to contain the vm id for CloudFoundry components.
+ //
+ // When system components are instrumented, values from the
+ // [Bosh spec]
+ // should be used. The `system.instance.id` should be set to `spec.id`.
+ //
+ // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope
+ // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec
+ CloudFoundrySystemInstanceIDKey = attribute.Key("cloudfoundry.system.instance.id")
+)
+
+// CloudFoundryAppID returns an attribute KeyValue conforming to the
+// "cloudfoundry.app.id" semantic conventions. It represents the guid of the
+// application.
+func CloudFoundryAppID(val string) attribute.KeyValue {
+ return CloudFoundryAppIDKey.String(val)
+}
+
+// CloudFoundryAppInstanceID returns an attribute KeyValue conforming to the
+// "cloudfoundry.app.instance.id" semantic conventions. It represents the index
+// of the application instance. 0 when just one instance is active.
+func CloudFoundryAppInstanceID(val string) attribute.KeyValue {
+ return CloudFoundryAppInstanceIDKey.String(val)
+}
+
+// CloudFoundryAppName returns an attribute KeyValue conforming to the
+// "cloudfoundry.app.name" semantic conventions. It represents the name of the
+// application.
+func CloudFoundryAppName(val string) attribute.KeyValue {
+ return CloudFoundryAppNameKey.String(val)
+}
+
+// CloudFoundryOrgID returns an attribute KeyValue conforming to the
+// "cloudfoundry.org.id" semantic conventions. It represents the guid of the
+// CloudFoundry org the application is running in.
+func CloudFoundryOrgID(val string) attribute.KeyValue {
+ return CloudFoundryOrgIDKey.String(val)
+}
+
+// CloudFoundryOrgName returns an attribute KeyValue conforming to the
+// "cloudfoundry.org.name" semantic conventions. It represents the name of the
+// CloudFoundry organization the app is running in.
+func CloudFoundryOrgName(val string) attribute.KeyValue {
+ return CloudFoundryOrgNameKey.String(val)
+}
+
+// CloudFoundryProcessID returns an attribute KeyValue conforming to the
+// "cloudfoundry.process.id" semantic conventions. It represents the UID
+// identifying the process.
+func CloudFoundryProcessID(val string) attribute.KeyValue {
+ return CloudFoundryProcessIDKey.String(val)
+}
+
+// CloudFoundryProcessType returns an attribute KeyValue conforming to the
+// "cloudfoundry.process.type" semantic conventions. It represents the type of
+// process.
+func CloudFoundryProcessType(val string) attribute.KeyValue {
+ return CloudFoundryProcessTypeKey.String(val)
+}
+
+// CloudFoundrySpaceID returns an attribute KeyValue conforming to the
+// "cloudfoundry.space.id" semantic conventions. It represents the guid of the
+// CloudFoundry space the application is running in.
+func CloudFoundrySpaceID(val string) attribute.KeyValue {
+ return CloudFoundrySpaceIDKey.String(val)
+}
+
+// CloudFoundrySpaceName returns an attribute KeyValue conforming to the
+// "cloudfoundry.space.name" semantic conventions. It represents the name of the
+// CloudFoundry space the application is running in.
+func CloudFoundrySpaceName(val string) attribute.KeyValue {
+ return CloudFoundrySpaceNameKey.String(val)
+}
+
+// CloudFoundrySystemID returns an attribute KeyValue conforming to the
+// "cloudfoundry.system.id" semantic conventions. It represents a guid or another
+// name describing the event source.
+func CloudFoundrySystemID(val string) attribute.KeyValue {
+ return CloudFoundrySystemIDKey.String(val)
+}
+
+// CloudFoundrySystemInstanceID returns an attribute KeyValue conforming to the
+// "cloudfoundry.system.instance.id" semantic conventions. It represents a guid
+// describing the concrete instance of the event source.
+func CloudFoundrySystemInstanceID(val string) attribute.KeyValue {
+ return CloudFoundrySystemInstanceIDKey.String(val)
+}
+
+// Namespace: code
+const (
+ // CodeColumnNumberKey is the attribute Key conforming to the
+ // "code.column.number" semantic conventions. It represents the column number in
+ // `code.file.path` best representing the operation. It SHOULD point within the
+ // code unit named in `code.function.name`. This attribute MUST NOT be used on
+ // the Profile signal since the data is already captured in 'message Line'. This
+ // constraint is imposed to prevent redundancy and maintain data integrity.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ CodeColumnNumberKey = attribute.Key("code.column.number")
+
+ // CodeFilePathKey is the attribute Key conforming to the "code.file.path"
+ // semantic conventions. It represents the source code file name that identifies
+ // the code unit as uniquely as possible (preferably an absolute file path).
+ // This attribute MUST NOT be used on the Profile signal since the data is
+ // already captured in 'message Function'. This constraint is imposed to prevent
+ // redundancy and maintain data integrity.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: /usr/local/MyApplication/content_root/app/index.php
+ CodeFilePathKey = attribute.Key("code.file.path")
+
+ // CodeFunctionNameKey is the attribute Key conforming to the
+ // "code.function.name" semantic conventions. It represents the method or
+ // function fully-qualified name without arguments. The value should fit the
+ // natural representation of the language runtime, which is also likely the same
+ // used within `code.stacktrace` attribute value. This attribute MUST NOT be
+ // used on the Profile signal since the data is already captured in 'message
+ // Function'. This constraint is imposed to prevent redundancy and maintain data
+ // integrity.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "com.example.MyHttpService.serveRequest",
+ // "GuzzleHttp\Client::transfer", "fopen"
+ // Note: Values and format depends on each language runtime, thus it is
+ // impossible to provide an exhaustive list of examples.
+ // The values are usually the same (or prefixes of) the ones found in native
+ // stack trace representation stored in
+ // `code.stacktrace` without information on arguments.
+ //
+ // Examples:
+ //
+ // - Java method: `com.example.MyHttpService.serveRequest`
+ // - Java anonymous class method: `com.mycompany.Main$1.myMethod`
+ // - Java lambda method:
+ // `com.mycompany.Main$$Lambda/0x0000748ae4149c00.myMethod`
+ // - PHP function: `GuzzleHttp\Client::transfer`
+ // - Go function: `github.com/my/repo/pkg.foo.func5`
+ // - Elixir: `OpenTelemetry.Ctx.new`
+ // - Erlang: `opentelemetry_ctx:new`
+ // - Rust: `playground::my_module::my_cool_func`
+ // - C function: `fopen`
+ CodeFunctionNameKey = attribute.Key("code.function.name")
+
+ // CodeLineNumberKey is the attribute Key conforming to the "code.line.number"
+ // semantic conventions. It represents the line number in `code.file.path` best
+ // representing the operation. It SHOULD point within the code unit named in
+ // `code.function.name`. This attribute MUST NOT be used on the Profile signal
+ // since the data is already captured in 'message Line'. This constraint is
+ // imposed to prevent redundancy and maintain data integrity.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ CodeLineNumberKey = attribute.Key("code.line.number")
+
+ // CodeStacktraceKey is the attribute Key conforming to the "code.stacktrace"
+ // semantic conventions. It represents a stacktrace as a string in the natural
+ // representation for the language runtime. The representation is identical to
+ // [`exception.stacktrace`]. This attribute MUST NOT be used on the Profile
+ // signal since the data is already captured in 'message Location'. This
+ // constraint is imposed to prevent redundancy and maintain data integrity.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at
+ // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at
+ // com.example.GenerateTrace.main(GenerateTrace.java:5)
+ //
+ // [`exception.stacktrace`]: /docs/exceptions/exceptions-spans.md#stacktrace-representation
+ CodeStacktraceKey = attribute.Key("code.stacktrace")
+)
+
+// CodeColumnNumber returns an attribute KeyValue conforming to the
+// "code.column.number" semantic conventions. It represents the column number in
+// `code.file.path` best representing the operation. It SHOULD point within the
+// code unit named in `code.function.name`. This attribute MUST NOT be used on
+// the Profile signal since the data is already captured in 'message Line'. This
+// constraint is imposed to prevent redundancy and maintain data integrity.
+func CodeColumnNumber(val int) attribute.KeyValue {
+ return CodeColumnNumberKey.Int(val)
+}
+
+// CodeFilePath returns an attribute KeyValue conforming to the "code.file.path"
+// semantic conventions. It represents the source code file name that identifies
+// the code unit as uniquely as possible (preferably an absolute file path). This
+// attribute MUST NOT be used on the Profile signal since the data is already
+// captured in 'message Function'. This constraint is imposed to prevent
+// redundancy and maintain data integrity.
+func CodeFilePath(val string) attribute.KeyValue {
+ return CodeFilePathKey.String(val)
+}
+
+// CodeFunctionName returns an attribute KeyValue conforming to the
+// "code.function.name" semantic conventions. It represents the method or
+// function fully-qualified name without arguments. The value should fit the
+// natural representation of the language runtime, which is also likely the same
+// used within `code.stacktrace` attribute value. This attribute MUST NOT be used
+// on the Profile signal since the data is already captured in 'message
+// Function'. This constraint is imposed to prevent redundancy and maintain data
+// integrity.
+func CodeFunctionName(val string) attribute.KeyValue {
+ return CodeFunctionNameKey.String(val)
+}
+
+// CodeLineNumber returns an attribute KeyValue conforming to the
+// "code.line.number" semantic conventions. It represents the line number in
+// `code.file.path` best representing the operation. It SHOULD point within the
+// code unit named in `code.function.name`. This attribute MUST NOT be used on
+// the Profile signal since the data is already captured in 'message Line'. This
+// constraint is imposed to prevent redundancy and maintain data integrity.
+func CodeLineNumber(val int) attribute.KeyValue {
+ return CodeLineNumberKey.Int(val)
+}
+
+// CodeStacktrace returns an attribute KeyValue conforming to the
+// "code.stacktrace" semantic conventions. It represents a stacktrace as a string
+// in the natural representation for the language runtime. The representation is
+// identical to [`exception.stacktrace`]. This attribute MUST NOT be used on the
+// Profile signal since the data is already captured in 'message Location'. This
+// constraint is imposed to prevent redundancy and maintain data integrity.
+//
+// [`exception.stacktrace`]: /docs/exceptions/exceptions-spans.md#stacktrace-representation
+func CodeStacktrace(val string) attribute.KeyValue {
+ return CodeStacktraceKey.String(val)
+}
+
+// Namespace: container
+const (
+ // ContainerCommandKey is the attribute Key conforming to the
+ // "container.command" semantic conventions. It represents the command used to
+ // run the container (i.e. the command name).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcontribcol"
+ // Note: If using embedded credentials or sensitive data, it is recommended to
+ // remove them to prevent potential leakage.
+ ContainerCommandKey = attribute.Key("container.command")
+
+ // ContainerCommandArgsKey is the attribute Key conforming to the
+ // "container.command_args" semantic conventions. It represents the all the
+ // command arguments (including the command/executable itself) run by the
+ // container.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcontribcol", "--config", "config.yaml"
+ ContainerCommandArgsKey = attribute.Key("container.command_args")
+
+ // ContainerCommandLineKey is the attribute Key conforming to the
+ // "container.command_line" semantic conventions. It represents the full command
+ // run by the container as a single string representing the full command.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcontribcol --config config.yaml"
+ ContainerCommandLineKey = attribute.Key("container.command_line")
+
+ // ContainerCSIPluginNameKey is the attribute Key conforming to the
+ // "container.csi.plugin.name" semantic conventions. It represents the name of
+ // the CSI ([Container Storage Interface]) plugin used by the volume.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pd.csi.storage.gke.io"
+ // Note: This can sometimes be referred to as a "driver" in CSI implementations.
+ // This should represent the `name` field of the GetPluginInfo RPC.
+ //
+ // [Container Storage Interface]: https://github.com/container-storage-interface/spec
+ ContainerCSIPluginNameKey = attribute.Key("container.csi.plugin.name")
+
+ // ContainerCSIVolumeIDKey is the attribute Key conforming to the
+ // "container.csi.volume.id" semantic conventions. It represents the unique
+ // volume ID returned by the CSI ([Container Storage Interface]) plugin.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "projects/my-gcp-project/zones/my-gcp-zone/disks/my-gcp-disk"
+ // Note: This can sometimes be referred to as a "volume handle" in CSI
+ // implementations. This should represent the `Volume.volume_id` field in CSI
+ // spec.
+ //
+ // [Container Storage Interface]: https://github.com/container-storage-interface/spec
+ ContainerCSIVolumeIDKey = attribute.Key("container.csi.volume.id")
+
+ // ContainerIDKey is the attribute Key conforming to the "container.id" semantic
+ // conventions. It represents the container ID. Usually a UUID, as for example
+ // used to [identify Docker containers]. The UUID might be abbreviated.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "a3bf90e006b2"
+ //
+ // [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification
+ ContainerIDKey = attribute.Key("container.id")
+
+ // ContainerImageIDKey is the attribute Key conforming to the
+ // "container.image.id" semantic conventions. It represents the runtime specific
+ // image identifier. Usually a hash algorithm followed by a UUID.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "sha256:19c92d0a00d1b66d897bceaa7319bee0dd38a10a851c60bcec9474aa3f01e50f"
+ // Note: Docker defines a sha256 of the image id; `container.image.id`
+ // corresponds to the `Image` field from the Docker container inspect [API]
+ // endpoint.
+ // K8s defines a link to the container registry repository with digest
+ // `"imageID": "registry.azurecr.io /namespace/service/dockerfile@sha256:bdeabd40c3a8a492eaf9e8e44d0ebbb84bac7ee25ac0cf8a7159d25f62555625"`
+ // .
+ // The ID is assigned by the container runtime and can vary in different
+ // environments. Consider using `oci.manifest.digest` if it is important to
+ // identify the same image in different environments/runtimes.
+ //
+ // [API]: https://docs.docker.com/engine/api/v1.43/#tag/Container/operation/ContainerInspect
+ ContainerImageIDKey = attribute.Key("container.image.id")
+
+ // ContainerImageNameKey is the attribute Key conforming to the
+ // "container.image.name" semantic conventions. It represents the name of the
+ // image the container was built on.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "gcr.io/opentelemetry/operator"
+ ContainerImageNameKey = attribute.Key("container.image.name")
+
+ // ContainerImageRepoDigestsKey is the attribute Key conforming to the
+ // "container.image.repo_digests" semantic conventions. It represents the repo
+ // digests of the container image as provided by the container runtime.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "example@sha256:afcc7f1ac1b49db317a7196c902e61c6c3c4607d63599ee1a82d702d249a0ccb",
+ // "internal.registry.example.com:5000/example@sha256:b69959407d21e8a062e0416bf13405bb2b71ed7a84dde4158ebafacfa06f5578"
+ // Note: [Docker] and [CRI] report those under the `RepoDigests` field.
+ //
+ // [Docker]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect
+ // [CRI]: https://github.com/kubernetes/cri-api/blob/c75ef5b473bbe2d0a4fc92f82235efd665ea8e9f/pkg/apis/runtime/v1/api.proto#L1237-L1238
+ ContainerImageRepoDigestsKey = attribute.Key("container.image.repo_digests")
+
+ // ContainerImageTagsKey is the attribute Key conforming to the
+ // "container.image.tags" semantic conventions. It represents the container
+ // image tags. An example can be found in [Docker Image Inspect]. Should be only
+ // the `` section of the full name for example from
+ // `registry.example.com/my-org/my-image:`.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "v1.27.1", "3.5.7-0"
+ //
+ // [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect
+ ContainerImageTagsKey = attribute.Key("container.image.tags")
+
+ // ContainerNameKey is the attribute Key conforming to the "container.name"
+ // semantic conventions. It represents the container name used by container
+ // runtime.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-autoconf"
+ ContainerNameKey = attribute.Key("container.name")
+
+ // ContainerRuntimeKey is the attribute Key conforming to the
+ // "container.runtime" semantic conventions. It represents the container runtime
+ // managing this container.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "docker", "containerd", "rkt"
+ ContainerRuntimeKey = attribute.Key("container.runtime")
+)
+
+// ContainerCommand returns an attribute KeyValue conforming to the
+// "container.command" semantic conventions. It represents the command used to
+// run the container (i.e. the command name).
+func ContainerCommand(val string) attribute.KeyValue {
+ return ContainerCommandKey.String(val)
+}
+
+// ContainerCommandArgs returns an attribute KeyValue conforming to the
+// "container.command_args" semantic conventions. It represents the all the
+// command arguments (including the command/executable itself) run by the
+// container.
+func ContainerCommandArgs(val ...string) attribute.KeyValue {
+ return ContainerCommandArgsKey.StringSlice(val)
+}
+
+// ContainerCommandLine returns an attribute KeyValue conforming to the
+// "container.command_line" semantic conventions. It represents the full command
+// run by the container as a single string representing the full command.
+func ContainerCommandLine(val string) attribute.KeyValue {
+ return ContainerCommandLineKey.String(val)
+}
+
+// ContainerCSIPluginName returns an attribute KeyValue conforming to the
+// "container.csi.plugin.name" semantic conventions. It represents the name of
+// the CSI ([Container Storage Interface]) plugin used by the volume.
+//
+// [Container Storage Interface]: https://github.com/container-storage-interface/spec
+func ContainerCSIPluginName(val string) attribute.KeyValue {
+ return ContainerCSIPluginNameKey.String(val)
+}
+
+// ContainerCSIVolumeID returns an attribute KeyValue conforming to the
+// "container.csi.volume.id" semantic conventions. It represents the unique
+// volume ID returned by the CSI ([Container Storage Interface]) plugin.
+//
+// [Container Storage Interface]: https://github.com/container-storage-interface/spec
+func ContainerCSIVolumeID(val string) attribute.KeyValue {
+ return ContainerCSIVolumeIDKey.String(val)
+}
+
+// ContainerID returns an attribute KeyValue conforming to the "container.id"
+// semantic conventions. It represents the container ID. Usually a UUID, as for
+// example used to [identify Docker containers]. The UUID might be abbreviated.
+//
+// [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification
+func ContainerID(val string) attribute.KeyValue {
+ return ContainerIDKey.String(val)
+}
+
+// ContainerImageID returns an attribute KeyValue conforming to the
+// "container.image.id" semantic conventions. It represents the runtime specific
+// image identifier. Usually a hash algorithm followed by a UUID.
+func ContainerImageID(val string) attribute.KeyValue {
+ return ContainerImageIDKey.String(val)
+}
+
+// ContainerImageName returns an attribute KeyValue conforming to the
+// "container.image.name" semantic conventions. It represents the name of the
+// image the container was built on.
+func ContainerImageName(val string) attribute.KeyValue {
+ return ContainerImageNameKey.String(val)
+}
+
+// ContainerImageRepoDigests returns an attribute KeyValue conforming to the
+// "container.image.repo_digests" semantic conventions. It represents the repo
+// digests of the container image as provided by the container runtime.
+func ContainerImageRepoDigests(val ...string) attribute.KeyValue {
+ return ContainerImageRepoDigestsKey.StringSlice(val)
+}
+
+// ContainerImageTags returns an attribute KeyValue conforming to the
+// "container.image.tags" semantic conventions. It represents the container image
+// tags. An example can be found in [Docker Image Inspect]. Should be only the
+// `` section of the full name for example from
+// `registry.example.com/my-org/my-image:`.
+//
+// [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect
+func ContainerImageTags(val ...string) attribute.KeyValue {
+ return ContainerImageTagsKey.StringSlice(val)
+}
+
+// ContainerName returns an attribute KeyValue conforming to the "container.name"
+// semantic conventions. It represents the container name used by container
+// runtime.
+func ContainerName(val string) attribute.KeyValue {
+ return ContainerNameKey.String(val)
+}
+
+// ContainerRuntime returns an attribute KeyValue conforming to the
+// "container.runtime" semantic conventions. It represents the container runtime
+// managing this container.
+func ContainerRuntime(val string) attribute.KeyValue {
+ return ContainerRuntimeKey.String(val)
+}
+
+// Namespace: cpu
+const (
+ // CPULogicalNumberKey is the attribute Key conforming to the
+ // "cpu.logical_number" semantic conventions. It represents the logical CPU
+ // number [0..n-1].
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1
+ CPULogicalNumberKey = attribute.Key("cpu.logical_number")
+
+ // CPUModeKey is the attribute Key conforming to the "cpu.mode" semantic
+ // conventions. It represents the mode of the CPU.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "user", "system"
+ CPUModeKey = attribute.Key("cpu.mode")
+)
+
+// CPULogicalNumber returns an attribute KeyValue conforming to the
+// "cpu.logical_number" semantic conventions. It represents the logical CPU
+// number [0..n-1].
+func CPULogicalNumber(val int) attribute.KeyValue {
+ return CPULogicalNumberKey.Int(val)
+}
+
+// Enum values for cpu.mode
+var (
+ // user
+ // Stability: development
+ CPUModeUser = CPUModeKey.String("user")
+ // system
+ // Stability: development
+ CPUModeSystem = CPUModeKey.String("system")
+ // nice
+ // Stability: development
+ CPUModeNice = CPUModeKey.String("nice")
+ // idle
+ // Stability: development
+ CPUModeIdle = CPUModeKey.String("idle")
+ // iowait
+ // Stability: development
+ CPUModeIOWait = CPUModeKey.String("iowait")
+ // interrupt
+ // Stability: development
+ CPUModeInterrupt = CPUModeKey.String("interrupt")
+ // steal
+ // Stability: development
+ CPUModeSteal = CPUModeKey.String("steal")
+ // kernel
+ // Stability: development
+ CPUModeKernel = CPUModeKey.String("kernel")
+)
+
+// Namespace: db
+const (
+ // DBClientConnectionPoolNameKey is the attribute Key conforming to the
+ // "db.client.connection.pool.name" semantic conventions. It represents the name
+ // of the connection pool; unique within the instrumented application. In case
+ // the connection pool implementation doesn't provide a name, instrumentation
+ // SHOULD use a combination of parameters that would make the name unique, for
+ // example, combining attributes `server.address`, `server.port`, and
+ // `db.namespace`, formatted as `server.address:server.port/db.namespace`.
+ // Instrumentations that generate connection pool name following different
+ // patterns SHOULD document it.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "myDataSource"
+ DBClientConnectionPoolNameKey = attribute.Key("db.client.connection.pool.name")
+
+ // DBClientConnectionStateKey is the attribute Key conforming to the
+ // "db.client.connection.state" semantic conventions. It represents the state of
+ // a connection in the pool.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "idle"
+ DBClientConnectionStateKey = attribute.Key("db.client.connection.state")
+
+ // DBCollectionNameKey is the attribute Key conforming to the
+ // "db.collection.name" semantic conventions. It represents the name of a
+ // collection (table, container) within the database.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "public.users", "customers"
+ // Note: It is RECOMMENDED to capture the value as provided by the application
+ // without attempting to do any case normalization.
+ //
+ // The collection name SHOULD NOT be extracted from `db.query.text`,
+ // when the database system supports query text with multiple collections
+ // in non-batch operations.
+ //
+ // For batch operations, if the individual operations are known to have the same
+ // collection name then that collection name SHOULD be used.
+ DBCollectionNameKey = attribute.Key("db.collection.name")
+
+ // DBNamespaceKey is the attribute Key conforming to the "db.namespace" semantic
+ // conventions. It represents the name of the database, fully qualified within
+ // the server address and port.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "customers", "test.users"
+ // Note: If a database system has multiple namespace components, they SHOULD be
+ // concatenated from the most general to the most specific namespace component,
+ // using `|` as a separator between the components. Any missing components (and
+ // their associated separators) SHOULD be omitted.
+ // Semantic conventions for individual database systems SHOULD document what
+ // `db.namespace` means in the context of that system.
+ // It is RECOMMENDED to capture the value as provided by the application without
+ // attempting to do any case normalization.
+ DBNamespaceKey = attribute.Key("db.namespace")
+
+ // DBOperationBatchSizeKey is the attribute Key conforming to the
+ // "db.operation.batch.size" semantic conventions. It represents the number of
+ // queries included in a batch operation.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 2, 3, 4
+ // Note: Operations are only considered batches when they contain two or more
+ // operations, and so `db.operation.batch.size` SHOULD never be `1`.
+ DBOperationBatchSizeKey = attribute.Key("db.operation.batch.size")
+
+ // DBOperationNameKey is the attribute Key conforming to the "db.operation.name"
+ // semantic conventions. It represents the name of the operation or command
+ // being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "findAndModify", "HMSET", "SELECT"
+ // Note: It is RECOMMENDED to capture the value as provided by the application
+ // without attempting to do any case normalization.
+ //
+ // The operation name SHOULD NOT be extracted from `db.query.text`,
+ // when the database system supports query text with multiple operations
+ // in non-batch operations.
+ //
+ // If spaces can occur in the operation name, multiple consecutive spaces
+ // SHOULD be normalized to a single space.
+ //
+ // For batch operations, if the individual operations are known to have the same
+ // operation name
+ // then that operation name SHOULD be used prepended by `BATCH `,
+ // otherwise `db.operation.name` SHOULD be `BATCH` or some other database
+ // system specific term if more applicable.
+ DBOperationNameKey = attribute.Key("db.operation.name")
+
+ // DBQuerySummaryKey is the attribute Key conforming to the "db.query.summary"
+ // semantic conventions. It represents the low cardinality summary of a database
+ // query.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "SELECT wuser_table", "INSERT shipping_details SELECT orders", "get
+ // user by id"
+ // Note: The query summary describes a class of database queries and is useful
+ // as a grouping key, especially when analyzing telemetry for database
+ // calls involving complex queries.
+ //
+ // Summary may be available to the instrumentation through
+ // instrumentation hooks or other means. If it is not available,
+ // instrumentations
+ // that support query parsing SHOULD generate a summary following
+ // [Generating query summary]
+ // section.
+ //
+ // [Generating query summary]: /docs/database/database-spans.md#generating-a-summary-of-the-query
+ DBQuerySummaryKey = attribute.Key("db.query.summary")
+
+ // DBQueryTextKey is the attribute Key conforming to the "db.query.text"
+ // semantic conventions. It represents the database query being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "SELECT * FROM wuser_table where username = ?", "SET mykey ?"
+ // Note: For sanitization see [Sanitization of `db.query.text`].
+ // For batch operations, if the individual operations are known to have the same
+ // query text then that query text SHOULD be used, otherwise all of the
+ // individual query texts SHOULD be concatenated with separator `; ` or some
+ // other database system specific separator if more applicable.
+ // Parameterized query text SHOULD NOT be sanitized. Even though parameterized
+ // query text can potentially have sensitive data, by using a parameterized
+ // query the user is giving a strong signal that any sensitive data will be
+ // passed as parameter values, and the benefit to observability of capturing the
+ // static part of the query text by default outweighs the risk.
+ //
+ // [Sanitization of `db.query.text`]: /docs/database/database-spans.md#sanitization-of-dbquerytext
+ DBQueryTextKey = attribute.Key("db.query.text")
+
+ // DBResponseReturnedRowsKey is the attribute Key conforming to the
+ // "db.response.returned_rows" semantic conventions. It represents the number of
+ // rows returned by the operation.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 10, 30, 1000
+ DBResponseReturnedRowsKey = attribute.Key("db.response.returned_rows")
+
+ // DBResponseStatusCodeKey is the attribute Key conforming to the
+ // "db.response.status_code" semantic conventions. It represents the database
+ // response status code.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "102", "ORA-17002", "08P01", "404"
+ // Note: The status code returned by the database. Usually it represents an
+ // error code, but may also represent partial success, warning, or differentiate
+ // between various types of successful outcomes.
+ // Semantic conventions for individual database systems SHOULD document what
+ // `db.response.status_code` means in the context of that system.
+ DBResponseStatusCodeKey = attribute.Key("db.response.status_code")
+
+ // DBStoredProcedureNameKey is the attribute Key conforming to the
+ // "db.stored_procedure.name" semantic conventions. It represents the name of a
+ // stored procedure within the database.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "GetCustomer"
+ // Note: It is RECOMMENDED to capture the value as provided by the application
+ // without attempting to do any case normalization.
+ //
+ // For batch operations, if the individual operations are known to have the same
+ // stored procedure name then that stored procedure name SHOULD be used.
+ DBStoredProcedureNameKey = attribute.Key("db.stored_procedure.name")
+
+ // DBSystemNameKey is the attribute Key conforming to the "db.system.name"
+ // semantic conventions. It represents the database management system (DBMS)
+ // product as identified by the client instrumentation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples:
+ // Note: The actual DBMS may differ from the one identified by the client. For
+ // example, when using PostgreSQL client libraries to connect to a CockroachDB,
+ // the `db.system.name` is set to `postgresql` based on the instrumentation's
+ // best knowledge.
+ DBSystemNameKey = attribute.Key("db.system.name")
+)
+
+// DBClientConnectionPoolName returns an attribute KeyValue conforming to the
+// "db.client.connection.pool.name" semantic conventions. It represents the name
+// of the connection pool; unique within the instrumented application. In case
+// the connection pool implementation doesn't provide a name, instrumentation
+// SHOULD use a combination of parameters that would make the name unique, for
+// example, combining attributes `server.address`, `server.port`, and
+// `db.namespace`, formatted as `server.address:server.port/db.namespace`.
+// Instrumentations that generate connection pool name following different
+// patterns SHOULD document it.
+func DBClientConnectionPoolName(val string) attribute.KeyValue {
+ return DBClientConnectionPoolNameKey.String(val)
+}
+
+// DBCollectionName returns an attribute KeyValue conforming to the
+// "db.collection.name" semantic conventions. It represents the name of a
+// collection (table, container) within the database.
+func DBCollectionName(val string) attribute.KeyValue {
+ return DBCollectionNameKey.String(val)
+}
+
+// DBNamespace returns an attribute KeyValue conforming to the "db.namespace"
+// semantic conventions. It represents the name of the database, fully qualified
+// within the server address and port.
+func DBNamespace(val string) attribute.KeyValue {
+ return DBNamespaceKey.String(val)
+}
+
+// DBOperationBatchSize returns an attribute KeyValue conforming to the
+// "db.operation.batch.size" semantic conventions. It represents the number of
+// queries included in a batch operation.
+func DBOperationBatchSize(val int) attribute.KeyValue {
+ return DBOperationBatchSizeKey.Int(val)
+}
+
+// DBOperationName returns an attribute KeyValue conforming to the
+// "db.operation.name" semantic conventions. It represents the name of the
+// operation or command being executed.
+func DBOperationName(val string) attribute.KeyValue {
+ return DBOperationNameKey.String(val)
+}
+
+// DBQuerySummary returns an attribute KeyValue conforming to the
+// "db.query.summary" semantic conventions. It represents the low cardinality
+// summary of a database query.
+func DBQuerySummary(val string) attribute.KeyValue {
+ return DBQuerySummaryKey.String(val)
+}
+
+// DBQueryText returns an attribute KeyValue conforming to the "db.query.text"
+// semantic conventions. It represents the database query being executed.
+func DBQueryText(val string) attribute.KeyValue {
+ return DBQueryTextKey.String(val)
+}
+
+// DBResponseReturnedRows returns an attribute KeyValue conforming to the
+// "db.response.returned_rows" semantic conventions. It represents the number of
+// rows returned by the operation.
+func DBResponseReturnedRows(val int) attribute.KeyValue {
+ return DBResponseReturnedRowsKey.Int(val)
+}
+
+// DBResponseStatusCode returns an attribute KeyValue conforming to the
+// "db.response.status_code" semantic conventions. It represents the database
+// response status code.
+func DBResponseStatusCode(val string) attribute.KeyValue {
+ return DBResponseStatusCodeKey.String(val)
+}
+
+// DBStoredProcedureName returns an attribute KeyValue conforming to the
+// "db.stored_procedure.name" semantic conventions. It represents the name of a
+// stored procedure within the database.
+func DBStoredProcedureName(val string) attribute.KeyValue {
+ return DBStoredProcedureNameKey.String(val)
+}
+
+// Enum values for db.client.connection.state
+var (
+ // idle
+ // Stability: development
+ DBClientConnectionStateIdle = DBClientConnectionStateKey.String("idle")
+ // used
+ // Stability: development
+ DBClientConnectionStateUsed = DBClientConnectionStateKey.String("used")
+)
+
+// Enum values for db.system.name
+var (
+ // Some other SQL database. Fallback only.
+ // Stability: development
+ DBSystemNameOtherSQL = DBSystemNameKey.String("other_sql")
+ // [Adabas (Adaptable Database System)]
+ // Stability: development
+ //
+ // [Adabas (Adaptable Database System)]: https://documentation.softwareag.com/?pf=adabas
+ DBSystemNameSoftwareagAdabas = DBSystemNameKey.String("softwareag.adabas")
+ // [Actian Ingres]
+ // Stability: development
+ //
+ // [Actian Ingres]: https://www.actian.com/databases/ingres/
+ DBSystemNameActianIngres = DBSystemNameKey.String("actian.ingres")
+ // [Amazon DynamoDB]
+ // Stability: development
+ //
+ // [Amazon DynamoDB]: https://aws.amazon.com/pm/dynamodb/
+ DBSystemNameAWSDynamoDB = DBSystemNameKey.String("aws.dynamodb")
+ // [Amazon Redshift]
+ // Stability: development
+ //
+ // [Amazon Redshift]: https://aws.amazon.com/redshift/
+ DBSystemNameAWSRedshift = DBSystemNameKey.String("aws.redshift")
+ // [Azure Cosmos DB]
+ // Stability: development
+ //
+ // [Azure Cosmos DB]: https://learn.microsoft.com/azure/cosmos-db
+ DBSystemNameAzureCosmosDB = DBSystemNameKey.String("azure.cosmosdb")
+ // [InterSystems Caché]
+ // Stability: development
+ //
+ // [InterSystems Caché]: https://www.intersystems.com/products/cache/
+ DBSystemNameIntersystemsCache = DBSystemNameKey.String("intersystems.cache")
+ // [Apache Cassandra]
+ // Stability: development
+ //
+ // [Apache Cassandra]: https://cassandra.apache.org/
+ DBSystemNameCassandra = DBSystemNameKey.String("cassandra")
+ // [ClickHouse]
+ // Stability: development
+ //
+ // [ClickHouse]: https://clickhouse.com/
+ DBSystemNameClickHouse = DBSystemNameKey.String("clickhouse")
+ // [CockroachDB]
+ // Stability: development
+ //
+ // [CockroachDB]: https://www.cockroachlabs.com/
+ DBSystemNameCockroachDB = DBSystemNameKey.String("cockroachdb")
+ // [Couchbase]
+ // Stability: development
+ //
+ // [Couchbase]: https://www.couchbase.com/
+ DBSystemNameCouchbase = DBSystemNameKey.String("couchbase")
+ // [Apache CouchDB]
+ // Stability: development
+ //
+ // [Apache CouchDB]: https://couchdb.apache.org/
+ DBSystemNameCouchDB = DBSystemNameKey.String("couchdb")
+ // [Apache Derby]
+ // Stability: development
+ //
+ // [Apache Derby]: https://db.apache.org/derby/
+ DBSystemNameDerby = DBSystemNameKey.String("derby")
+ // [Elasticsearch]
+ // Stability: development
+ //
+ // [Elasticsearch]: https://www.elastic.co/elasticsearch
+ DBSystemNameElasticsearch = DBSystemNameKey.String("elasticsearch")
+ // [Firebird]
+ // Stability: development
+ //
+ // [Firebird]: https://www.firebirdsql.org/
+ DBSystemNameFirebirdSQL = DBSystemNameKey.String("firebirdsql")
+ // [Google Cloud Spanner]
+ // Stability: development
+ //
+ // [Google Cloud Spanner]: https://cloud.google.com/spanner
+ DBSystemNameGCPSpanner = DBSystemNameKey.String("gcp.spanner")
+ // [Apache Geode]
+ // Stability: development
+ //
+ // [Apache Geode]: https://geode.apache.org/
+ DBSystemNameGeode = DBSystemNameKey.String("geode")
+ // [H2 Database]
+ // Stability: development
+ //
+ // [H2 Database]: https://h2database.com/
+ DBSystemNameH2database = DBSystemNameKey.String("h2database")
+ // [Apache HBase]
+ // Stability: development
+ //
+ // [Apache HBase]: https://hbase.apache.org/
+ DBSystemNameHBase = DBSystemNameKey.String("hbase")
+ // [Apache Hive]
+ // Stability: development
+ //
+ // [Apache Hive]: https://hive.apache.org/
+ DBSystemNameHive = DBSystemNameKey.String("hive")
+ // [HyperSQL Database]
+ // Stability: development
+ //
+ // [HyperSQL Database]: https://hsqldb.org/
+ DBSystemNameHSQLDB = DBSystemNameKey.String("hsqldb")
+ // [IBM Db2]
+ // Stability: development
+ //
+ // [IBM Db2]: https://www.ibm.com/db2
+ DBSystemNameIBMDB2 = DBSystemNameKey.String("ibm.db2")
+ // [IBM Informix]
+ // Stability: development
+ //
+ // [IBM Informix]: https://www.ibm.com/products/informix
+ DBSystemNameIBMInformix = DBSystemNameKey.String("ibm.informix")
+ // [IBM Netezza]
+ // Stability: development
+ //
+ // [IBM Netezza]: https://www.ibm.com/products/netezza
+ DBSystemNameIBMNetezza = DBSystemNameKey.String("ibm.netezza")
+ // [InfluxDB]
+ // Stability: development
+ //
+ // [InfluxDB]: https://www.influxdata.com/
+ DBSystemNameInfluxDB = DBSystemNameKey.String("influxdb")
+ // [Instant]
+ // Stability: development
+ //
+ // [Instant]: https://www.instantdb.com/
+ DBSystemNameInstantDB = DBSystemNameKey.String("instantdb")
+ // [MariaDB]
+ // Stability: stable
+ //
+ // [MariaDB]: https://mariadb.org/
+ DBSystemNameMariaDB = DBSystemNameKey.String("mariadb")
+ // [Memcached]
+ // Stability: development
+ //
+ // [Memcached]: https://memcached.org/
+ DBSystemNameMemcached = DBSystemNameKey.String("memcached")
+ // [MongoDB]
+ // Stability: development
+ //
+ // [MongoDB]: https://www.mongodb.com/
+ DBSystemNameMongoDB = DBSystemNameKey.String("mongodb")
+ // [Microsoft SQL Server]
+ // Stability: stable
+ //
+ // [Microsoft SQL Server]: https://www.microsoft.com/sql-server
+ DBSystemNameMicrosoftSQLServer = DBSystemNameKey.String("microsoft.sql_server")
+ // [MySQL]
+ // Stability: stable
+ //
+ // [MySQL]: https://www.mysql.com/
+ DBSystemNameMySQL = DBSystemNameKey.String("mysql")
+ // [Neo4j]
+ // Stability: development
+ //
+ // [Neo4j]: https://neo4j.com/
+ DBSystemNameNeo4j = DBSystemNameKey.String("neo4j")
+ // [OpenSearch]
+ // Stability: development
+ //
+ // [OpenSearch]: https://opensearch.org/
+ DBSystemNameOpenSearch = DBSystemNameKey.String("opensearch")
+ // [Oracle Database]
+ // Stability: development
+ //
+ // [Oracle Database]: https://www.oracle.com/database/
+ DBSystemNameOracleDB = DBSystemNameKey.String("oracle.db")
+ // [PostgreSQL]
+ // Stability: stable
+ //
+ // [PostgreSQL]: https://www.postgresql.org/
+ DBSystemNamePostgreSQL = DBSystemNameKey.String("postgresql")
+ // [Redis]
+ // Stability: development
+ //
+ // [Redis]: https://redis.io/
+ DBSystemNameRedis = DBSystemNameKey.String("redis")
+ // [SAP HANA]
+ // Stability: development
+ //
+ // [SAP HANA]: https://www.sap.com/products/technology-platform/hana/what-is-sap-hana.html
+ DBSystemNameSAPHANA = DBSystemNameKey.String("sap.hana")
+ // [SAP MaxDB]
+ // Stability: development
+ //
+ // [SAP MaxDB]: https://maxdb.sap.com/
+ DBSystemNameSAPMaxDB = DBSystemNameKey.String("sap.maxdb")
+ // [SQLite]
+ // Stability: development
+ //
+ // [SQLite]: https://www.sqlite.org/
+ DBSystemNameSQLite = DBSystemNameKey.String("sqlite")
+ // [Teradata]
+ // Stability: development
+ //
+ // [Teradata]: https://www.teradata.com/
+ DBSystemNameTeradata = DBSystemNameKey.String("teradata")
+ // [Trino]
+ // Stability: development
+ //
+ // [Trino]: https://trino.io/
+ DBSystemNameTrino = DBSystemNameKey.String("trino")
+)
+
+// Namespace: deployment
+const (
+ // DeploymentEnvironmentNameKey is the attribute Key conforming to the
+ // "deployment.environment.name" semantic conventions. It represents the name of
+ // the [deployment environment] (aka deployment tier).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "staging", "production"
+ // Note: `deployment.environment.name` does not affect the uniqueness
+ // constraints defined through
+ // the `service.namespace`, `service.name` and `service.instance.id` resource
+ // attributes.
+ // This implies that resources carrying the following attribute combinations
+ // MUST be
+ // considered to be identifying the same service:
+ //
+ // - `service.name=frontend`, `deployment.environment.name=production`
+ // - `service.name=frontend`, `deployment.environment.name=staging`.
+ //
+ //
+ // [deployment environment]: https://wikipedia.org/wiki/Deployment_environment
+ DeploymentEnvironmentNameKey = attribute.Key("deployment.environment.name")
+
+ // DeploymentIDKey is the attribute Key conforming to the "deployment.id"
+ // semantic conventions. It represents the id of the deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1208"
+ DeploymentIDKey = attribute.Key("deployment.id")
+
+ // DeploymentNameKey is the attribute Key conforming to the "deployment.name"
+ // semantic conventions. It represents the name of the deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "deploy my app", "deploy-frontend"
+ DeploymentNameKey = attribute.Key("deployment.name")
+
+ // DeploymentStatusKey is the attribute Key conforming to the
+ // "deployment.status" semantic conventions. It represents the status of the
+ // deployment.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ DeploymentStatusKey = attribute.Key("deployment.status")
+)
+
+// DeploymentEnvironmentName returns an attribute KeyValue conforming to the
+// "deployment.environment.name" semantic conventions. It represents the name of
+// the [deployment environment] (aka deployment tier).
+//
+// [deployment environment]: https://wikipedia.org/wiki/Deployment_environment
+func DeploymentEnvironmentName(val string) attribute.KeyValue {
+ return DeploymentEnvironmentNameKey.String(val)
+}
+
+// DeploymentID returns an attribute KeyValue conforming to the "deployment.id"
+// semantic conventions. It represents the id of the deployment.
+func DeploymentID(val string) attribute.KeyValue {
+ return DeploymentIDKey.String(val)
+}
+
+// DeploymentName returns an attribute KeyValue conforming to the
+// "deployment.name" semantic conventions. It represents the name of the
+// deployment.
+func DeploymentName(val string) attribute.KeyValue {
+ return DeploymentNameKey.String(val)
+}
+
+// Enum values for deployment.status
+var (
+ // failed
+ // Stability: development
+ DeploymentStatusFailed = DeploymentStatusKey.String("failed")
+ // succeeded
+ // Stability: development
+ DeploymentStatusSucceeded = DeploymentStatusKey.String("succeeded")
+)
+
+// Namespace: destination
+const (
+ // DestinationAddressKey is the attribute Key conforming to the
+ // "destination.address" semantic conventions. It represents the destination
+ // address - domain name if available without reverse DNS lookup; otherwise, IP
+ // address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "destination.example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the source side, and when communicating through an
+ // intermediary, `destination.address` SHOULD represent the destination address
+ // behind any intermediaries, for example proxies, if it's available.
+ DestinationAddressKey = attribute.Key("destination.address")
+
+ // DestinationPortKey is the attribute Key conforming to the "destination.port"
+ // semantic conventions. It represents the destination port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 3389, 2888
+ DestinationPortKey = attribute.Key("destination.port")
+)
+
+// DestinationAddress returns an attribute KeyValue conforming to the
+// "destination.address" semantic conventions. It represents the destination
+// address - domain name if available without reverse DNS lookup; otherwise, IP
+// address or Unix domain socket name.
+func DestinationAddress(val string) attribute.KeyValue {
+ return DestinationAddressKey.String(val)
+}
+
+// DestinationPort returns an attribute KeyValue conforming to the
+// "destination.port" semantic conventions. It represents the destination port
+// number.
+func DestinationPort(val int) attribute.KeyValue {
+ return DestinationPortKey.Int(val)
+}
+
+// Namespace: device
+const (
+ // DeviceIDKey is the attribute Key conforming to the "device.id" semantic
+ // conventions. It represents a unique identifier representing the device.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "123456789012345", "01:23:45:67:89:AB"
+ // Note: Its value SHOULD be identical for all apps on a device and it SHOULD
+ // NOT change if an app is uninstalled and re-installed.
+ // However, it might be resettable by the user for all apps on a device.
+ // Hardware IDs (e.g. vendor-specific serial number, IMEI or MAC address) MAY be
+ // used as values.
+ //
+ // More information about Android identifier best practices can be found [here]
+ // .
+ //
+ // > [!WARNING]> This attribute may contain sensitive (PII) information. Caution
+ // > should be taken when storing personal data or anything which can identify a
+ // > user. GDPR and data protection laws may apply,
+ // > ensure you do your own due diligence.> Due to these reasons, this
+ // > identifier is not recommended for consumer applications and will likely
+ // > result in rejection from both Google Play and App Store.
+ // > However, it may be appropriate for specific enterprise scenarios, such as
+ // > kiosk devices or enterprise-managed devices, with appropriate compliance
+ // > clearance.
+ // > Any instrumentation providing this identifier MUST implement it as an
+ // > opt-in feature.> See [`app.installation.id`]> for a more
+ // > privacy-preserving alternative.
+ //
+ // [here]: https://developer.android.com/training/articles/user-data-ids
+ // [`app.installation.id`]: /docs/registry/attributes/app.md#app-installation-id
+ DeviceIDKey = attribute.Key("device.id")
+
+ // DeviceManufacturerKey is the attribute Key conforming to the
+ // "device.manufacturer" semantic conventions. It represents the name of the
+ // device manufacturer.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Apple", "Samsung"
+ // Note: The Android OS provides this field via [Build]. iOS apps SHOULD
+ // hardcode the value `Apple`.
+ //
+ // [Build]: https://developer.android.com/reference/android/os/Build#MANUFACTURER
+ DeviceManufacturerKey = attribute.Key("device.manufacturer")
+
+ // DeviceModelIdentifierKey is the attribute Key conforming to the
+ // "device.model.identifier" semantic conventions. It represents the model
+ // identifier for the device.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "iPhone3,4", "SM-G920F"
+ // Note: It's recommended this value represents a machine-readable version of
+ // the model identifier rather than the market or consumer-friendly name of the
+ // device.
+ DeviceModelIdentifierKey = attribute.Key("device.model.identifier")
+
+ // DeviceModelNameKey is the attribute Key conforming to the "device.model.name"
+ // semantic conventions. It represents the marketing name for the device model.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "iPhone 6s Plus", "Samsung Galaxy S6"
+ // Note: It's recommended this value represents a human-readable version of the
+ // device model rather than a machine-readable alternative.
+ DeviceModelNameKey = attribute.Key("device.model.name")
+)
+
+// DeviceID returns an attribute KeyValue conforming to the "device.id" semantic
+// conventions. It represents a unique identifier representing the device.
+func DeviceID(val string) attribute.KeyValue {
+ return DeviceIDKey.String(val)
+}
+
+// DeviceManufacturer returns an attribute KeyValue conforming to the
+// "device.manufacturer" semantic conventions. It represents the name of the
+// device manufacturer.
+func DeviceManufacturer(val string) attribute.KeyValue {
+ return DeviceManufacturerKey.String(val)
+}
+
+// DeviceModelIdentifier returns an attribute KeyValue conforming to the
+// "device.model.identifier" semantic conventions. It represents the model
+// identifier for the device.
+func DeviceModelIdentifier(val string) attribute.KeyValue {
+ return DeviceModelIdentifierKey.String(val)
+}
+
+// DeviceModelName returns an attribute KeyValue conforming to the
+// "device.model.name" semantic conventions. It represents the marketing name for
+// the device model.
+func DeviceModelName(val string) attribute.KeyValue {
+ return DeviceModelNameKey.String(val)
+}
+
+// Namespace: disk
+const (
+ // DiskIODirectionKey is the attribute Key conforming to the "disk.io.direction"
+ // semantic conventions. It represents the disk IO operation direction.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "read"
+ DiskIODirectionKey = attribute.Key("disk.io.direction")
+)
+
+// Enum values for disk.io.direction
+var (
+ // read
+ // Stability: development
+ DiskIODirectionRead = DiskIODirectionKey.String("read")
+ // write
+ // Stability: development
+ DiskIODirectionWrite = DiskIODirectionKey.String("write")
+)
+
+// Namespace: dns
+const (
+ // DNSQuestionNameKey is the attribute Key conforming to the "dns.question.name"
+ // semantic conventions. It represents the name being queried.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "www.example.com", "opentelemetry.io"
+ // Note: If the name field contains non-printable characters (below 32 or above
+ // 126), those characters should be represented as escaped base 10 integers
+ // (\DDD). Back slashes and quotes should be escaped. Tabs, carriage returns,
+ // and line feeds should be converted to \t, \r, and \n respectively.
+ DNSQuestionNameKey = attribute.Key("dns.question.name")
+)
+
+// DNSQuestionName returns an attribute KeyValue conforming to the
+// "dns.question.name" semantic conventions. It represents the name being
+// queried.
+func DNSQuestionName(val string) attribute.KeyValue {
+ return DNSQuestionNameKey.String(val)
+}
+
+// Namespace: elasticsearch
+const (
+ // ElasticsearchNodeNameKey is the attribute Key conforming to the
+ // "elasticsearch.node.name" semantic conventions. It represents the represents
+ // the human-readable identifier of the node/instance to which a request was
+ // routed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "instance-0000000001"
+ ElasticsearchNodeNameKey = attribute.Key("elasticsearch.node.name")
+)
+
+// ElasticsearchNodeName returns an attribute KeyValue conforming to the
+// "elasticsearch.node.name" semantic conventions. It represents the represents
+// the human-readable identifier of the node/instance to which a request was
+// routed.
+func ElasticsearchNodeName(val string) attribute.KeyValue {
+ return ElasticsearchNodeNameKey.String(val)
+}
+
+// Namespace: enduser
+const (
+ // EnduserIDKey is the attribute Key conforming to the "enduser.id" semantic
+ // conventions. It represents the unique identifier of an end user in the
+ // system. It maybe a username, email address, or other identifier.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "username"
+ // Note: Unique identifier of an end user in the system.
+ //
+ // > [!Warning]
+ // > This field contains sensitive (PII) information.
+ EnduserIDKey = attribute.Key("enduser.id")
+
+ // EnduserPseudoIDKey is the attribute Key conforming to the "enduser.pseudo.id"
+ // semantic conventions. It represents the pseudonymous identifier of an end
+ // user. This identifier should be a random value that is not directly linked or
+ // associated with the end user's actual identity.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "QdH5CAWJgqVT4rOr0qtumf"
+ // Note: Pseudonymous identifier of an end user.
+ //
+ // > [!Warning]
+ // > This field contains sensitive (linkable PII) information.
+ EnduserPseudoIDKey = attribute.Key("enduser.pseudo.id")
+)
+
+// EnduserID returns an attribute KeyValue conforming to the "enduser.id"
+// semantic conventions. It represents the unique identifier of an end user in
+// the system. It maybe a username, email address, or other identifier.
+func EnduserID(val string) attribute.KeyValue {
+ return EnduserIDKey.String(val)
+}
+
+// EnduserPseudoID returns an attribute KeyValue conforming to the
+// "enduser.pseudo.id" semantic conventions. It represents the pseudonymous
+// identifier of an end user. This identifier should be a random value that is
+// not directly linked or associated with the end user's actual identity.
+func EnduserPseudoID(val string) attribute.KeyValue {
+ return EnduserPseudoIDKey.String(val)
+}
+
+// Namespace: error
+const (
+ // ErrorMessageKey is the attribute Key conforming to the "error.message"
+ // semantic conventions. It represents a message providing more detail about an
+ // error in human-readable form.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Unexpected input type: string", "The user has exceeded their
+ // storage quota"
+ // Note: `error.message` should provide additional context and detail about an
+ // error.
+ // It is NOT RECOMMENDED to duplicate the value of `error.type` in
+ // `error.message`.
+ // It is also NOT RECOMMENDED to duplicate the value of `exception.message` in
+ // `error.message`.
+ //
+ // `error.message` is NOT RECOMMENDED for metrics or spans due to its unbounded
+ // cardinality and overlap with span status.
+ ErrorMessageKey = attribute.Key("error.message")
+
+ // ErrorTypeKey is the attribute Key conforming to the "error.type" semantic
+ // conventions. It represents the describes a class of error the operation ended
+ // with.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "timeout", "java.net.UnknownHostException",
+ // "server_certificate_invalid", "500"
+ // Note: The `error.type` SHOULD be predictable, and SHOULD have low
+ // cardinality.
+ //
+ // When `error.type` is set to a type (e.g., an exception type), its
+ // canonical class name identifying the type within the artifact SHOULD be used.
+ //
+ // Instrumentations SHOULD document the list of errors they report.
+ //
+ // The cardinality of `error.type` within one instrumentation library SHOULD be
+ // low.
+ // Telemetry consumers that aggregate data from multiple instrumentation
+ // libraries and applications
+ // should be prepared for `error.type` to have high cardinality at query time
+ // when no
+ // additional filters are applied.
+ //
+ // If the operation has completed successfully, instrumentations SHOULD NOT set
+ // `error.type`.
+ //
+ // If a specific domain defines its own set of error identifiers (such as HTTP
+ // or gRPC status codes),
+ // it's RECOMMENDED to:
+ //
+ // - Use a domain-specific attribute
+ // - Set `error.type` to capture all errors, regardless of whether they are
+ // defined within the domain-specific set or not.
+ ErrorTypeKey = attribute.Key("error.type")
+)
+
+// ErrorMessage returns an attribute KeyValue conforming to the "error.message"
+// semantic conventions. It represents a message providing more detail about an
+// error in human-readable form.
+func ErrorMessage(val string) attribute.KeyValue {
+ return ErrorMessageKey.String(val)
+}
+
+// Enum values for error.type
+var (
+ // A fallback error value to be used when the instrumentation doesn't define a
+ // custom value.
+ //
+ // Stability: stable
+ ErrorTypeOther = ErrorTypeKey.String("_OTHER")
+)
+
+// Namespace: exception
+const (
+ // ExceptionMessageKey is the attribute Key conforming to the
+ // "exception.message" semantic conventions. It represents the exception
+ // message.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "Division by zero", "Can't convert 'int' object to str implicitly"
+ ExceptionMessageKey = attribute.Key("exception.message")
+
+ // ExceptionStacktraceKey is the attribute Key conforming to the
+ // "exception.stacktrace" semantic conventions. It represents a stacktrace as a
+ // string in the natural representation for the language runtime. The
+ // representation is to be determined and documented by each language SIG.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: Exception in thread "main" java.lang.RuntimeException: Test
+ // exception\n at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at
+ // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at
+ // com.example.GenerateTrace.main(GenerateTrace.java:5)
+ ExceptionStacktraceKey = attribute.Key("exception.stacktrace")
+
+ // ExceptionTypeKey is the attribute Key conforming to the "exception.type"
+ // semantic conventions. It represents the type of the exception (its
+ // fully-qualified class name, if applicable). The dynamic type of the exception
+ // should be preferred over the static type in languages that support it.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "java.net.ConnectException", "OSError"
+ ExceptionTypeKey = attribute.Key("exception.type")
+)
+
+// ExceptionMessage returns an attribute KeyValue conforming to the
+// "exception.message" semantic conventions. It represents the exception message.
+func ExceptionMessage(val string) attribute.KeyValue {
+ return ExceptionMessageKey.String(val)
+}
+
+// ExceptionStacktrace returns an attribute KeyValue conforming to the
+// "exception.stacktrace" semantic conventions. It represents a stacktrace as a
+// string in the natural representation for the language runtime. The
+// representation is to be determined and documented by each language SIG.
+func ExceptionStacktrace(val string) attribute.KeyValue {
+ return ExceptionStacktraceKey.String(val)
+}
+
+// ExceptionType returns an attribute KeyValue conforming to the "exception.type"
+// semantic conventions. It represents the type of the exception (its
+// fully-qualified class name, if applicable). The dynamic type of the exception
+// should be preferred over the static type in languages that support it.
+func ExceptionType(val string) attribute.KeyValue {
+ return ExceptionTypeKey.String(val)
+}
+
+// Namespace: faas
+const (
+ // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart"
+ // semantic conventions. It represents a boolean that is true if the serverless
+ // function is executed for the first time (aka cold-start).
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FaaSColdstartKey = attribute.Key("faas.coldstart")
+
+ // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic
+ // conventions. It represents a string containing the schedule period as
+ // [Cron Expression].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0/5 * * * ? *
+ //
+ // [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm
+ FaaSCronKey = attribute.Key("faas.cron")
+
+ // FaaSDocumentCollectionKey is the attribute Key conforming to the
+ // "faas.document.collection" semantic conventions. It represents the name of
+ // the source on which the triggering operation was performed. For example, in
+ // Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the
+ // database name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "myBucketName", "myDbName"
+ FaaSDocumentCollectionKey = attribute.Key("faas.document.collection")
+
+ // FaaSDocumentNameKey is the attribute Key conforming to the
+ // "faas.document.name" semantic conventions. It represents the document
+ // name/table subjected to the operation. For example, in Cloud Storage or S3 is
+ // the name of the file, and in Cosmos DB the table name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "myFile.txt", "myTableName"
+ FaaSDocumentNameKey = attribute.Key("faas.document.name")
+
+ // FaaSDocumentOperationKey is the attribute Key conforming to the
+ // "faas.document.operation" semantic conventions. It represents the describes
+ // the type of the operation that was performed on the data.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FaaSDocumentOperationKey = attribute.Key("faas.document.operation")
+
+ // FaaSDocumentTimeKey is the attribute Key conforming to the
+ // "faas.document.time" semantic conventions. It represents a string containing
+ // the time when the data was accessed in the [ISO 8601] format expressed in
+ // [UTC].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 2020-01-23T13:47:06Z
+ //
+ // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+ // [UTC]: https://www.w3.org/TR/NOTE-datetime
+ FaaSDocumentTimeKey = attribute.Key("faas.document.time")
+
+ // FaaSInstanceKey is the attribute Key conforming to the "faas.instance"
+ // semantic conventions. It represents the execution environment ID as a string,
+ // that will be potentially reused for other invocations to the same
+ // function/function version.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021/06/28/[$LATEST]2f399eb14537447da05ab2a2e39309de"
+ // Note: - **AWS Lambda:** Use the (full) log stream name.
+ FaaSInstanceKey = attribute.Key("faas.instance")
+
+ // FaaSInvocationIDKey is the attribute Key conforming to the
+ // "faas.invocation_id" semantic conventions. It represents the invocation ID of
+ // the current function invocation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: af9d5aa4-a685-4c5f-a22b-444f80b3cc28
+ FaaSInvocationIDKey = attribute.Key("faas.invocation_id")
+
+ // FaaSInvokedNameKey is the attribute Key conforming to the "faas.invoked_name"
+ // semantic conventions. It represents the name of the invoked function.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: my-function
+ // Note: SHOULD be equal to the `faas.name` resource attribute of the invoked
+ // function.
+ FaaSInvokedNameKey = attribute.Key("faas.invoked_name")
+
+ // FaaSInvokedProviderKey is the attribute Key conforming to the
+ // "faas.invoked_provider" semantic conventions. It represents the cloud
+ // provider of the invoked function.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: SHOULD be equal to the `cloud.provider` resource attribute of the
+ // invoked function.
+ FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider")
+
+ // FaaSInvokedRegionKey is the attribute Key conforming to the
+ // "faas.invoked_region" semantic conventions. It represents the cloud region of
+ // the invoked function.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: eu-central-1
+ // Note: SHOULD be equal to the `cloud.region` resource attribute of the invoked
+ // function.
+ FaaSInvokedRegionKey = attribute.Key("faas.invoked_region")
+
+ // FaaSMaxMemoryKey is the attribute Key conforming to the "faas.max_memory"
+ // semantic conventions. It represents the amount of memory available to the
+ // serverless function converted to Bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Note: It's recommended to set this attribute since e.g. too little memory can
+ // easily stop a Java AWS Lambda function from working correctly. On AWS Lambda,
+ // the environment variable `AWS_LAMBDA_FUNCTION_MEMORY_SIZE` provides this
+ // information (which must be multiplied by 1,048,576).
+ FaaSMaxMemoryKey = attribute.Key("faas.max_memory")
+
+ // FaaSNameKey is the attribute Key conforming to the "faas.name" semantic
+ // conventions. It represents the name of the single function that this runtime
+ // instance executes.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-function", "myazurefunctionapp/some-function-name"
+ // Note: This is the name of the function as configured/deployed on the FaaS
+ // platform and is usually different from the name of the callback
+ // function (which may be stored in the
+ // [`code.namespace`/`code.function.name`]
+ // span attributes).
+ //
+ // For some cloud providers, the above definition is ambiguous. The following
+ // definition of function name MUST be used for this attribute
+ // (and consequently the span name) for the listed cloud providers/products:
+ //
+ // - **Azure:** The full name `/`, i.e., function app name
+ // followed by a forward slash followed by the function name (this form
+ // can also be seen in the resource JSON for the function).
+ // This means that a span attribute MUST be used, as an Azure function
+ // app can host multiple functions that would usually share
+ // a TracerProvider (see also the `cloud.resource_id` attribute).
+ //
+ //
+ // [`code.namespace`/`code.function.name`]: /docs/general/attributes.md#source-code-attributes
+ FaaSNameKey = attribute.Key("faas.name")
+
+ // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic
+ // conventions. It represents a string containing the function invocation time
+ // in the [ISO 8601] format expressed in [UTC].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 2020-01-23T13:47:06Z
+ //
+ // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+ // [UTC]: https://www.w3.org/TR/NOTE-datetime
+ FaaSTimeKey = attribute.Key("faas.time")
+
+ // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger" semantic
+ // conventions. It represents the type of the trigger which caused this function
+ // invocation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FaaSTriggerKey = attribute.Key("faas.trigger")
+
+ // FaaSVersionKey is the attribute Key conforming to the "faas.version" semantic
+ // conventions. It represents the immutable version of the function being
+ // executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "26", "pinkfroid-00002"
+ // Note: Depending on the cloud provider and platform, use:
+ //
+ // - **AWS Lambda:** The [function version]
+ // (an integer represented as a decimal string).
+ // - **Google Cloud Run (Services):** The [revision]
+ // (i.e., the function name plus the revision suffix).
+ // - **Google Cloud Functions:** The value of the
+ // [`K_REVISION` environment variable].
+ // - **Azure Functions:** Not applicable. Do not set this attribute.
+ //
+ //
+ // [function version]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-versions.html
+ // [revision]: https://cloud.google.com/run/docs/managing/revisions
+ // [`K_REVISION` environment variable]: https://cloud.google.com/functions/docs/env-var#runtime_environment_variables_set_automatically
+ FaaSVersionKey = attribute.Key("faas.version")
+)
+
+// FaaSColdstart returns an attribute KeyValue conforming to the "faas.coldstart"
+// semantic conventions. It represents a boolean that is true if the serverless
+// function is executed for the first time (aka cold-start).
+func FaaSColdstart(val bool) attribute.KeyValue {
+ return FaaSColdstartKey.Bool(val)
+}
+
+// FaaSCron returns an attribute KeyValue conforming to the "faas.cron" semantic
+// conventions. It represents a string containing the schedule period as
+// [Cron Expression].
+//
+// [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm
+func FaaSCron(val string) attribute.KeyValue {
+ return FaaSCronKey.String(val)
+}
+
+// FaaSDocumentCollection returns an attribute KeyValue conforming to the
+// "faas.document.collection" semantic conventions. It represents the name of the
+// source on which the triggering operation was performed. For example, in Cloud
+// Storage or S3 corresponds to the bucket name, and in Cosmos DB to the database
+// name.
+func FaaSDocumentCollection(val string) attribute.KeyValue {
+ return FaaSDocumentCollectionKey.String(val)
+}
+
+// FaaSDocumentName returns an attribute KeyValue conforming to the
+// "faas.document.name" semantic conventions. It represents the document
+// name/table subjected to the operation. For example, in Cloud Storage or S3 is
+// the name of the file, and in Cosmos DB the table name.
+func FaaSDocumentName(val string) attribute.KeyValue {
+ return FaaSDocumentNameKey.String(val)
+}
+
+// FaaSDocumentTime returns an attribute KeyValue conforming to the
+// "faas.document.time" semantic conventions. It represents a string containing
+// the time when the data was accessed in the [ISO 8601] format expressed in
+// [UTC].
+//
+// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+// [UTC]: https://www.w3.org/TR/NOTE-datetime
+func FaaSDocumentTime(val string) attribute.KeyValue {
+ return FaaSDocumentTimeKey.String(val)
+}
+
+// FaaSInstance returns an attribute KeyValue conforming to the "faas.instance"
+// semantic conventions. It represents the execution environment ID as a string,
+// that will be potentially reused for other invocations to the same
+// function/function version.
+func FaaSInstance(val string) attribute.KeyValue {
+ return FaaSInstanceKey.String(val)
+}
+
+// FaaSInvocationID returns an attribute KeyValue conforming to the
+// "faas.invocation_id" semantic conventions. It represents the invocation ID of
+// the current function invocation.
+func FaaSInvocationID(val string) attribute.KeyValue {
+ return FaaSInvocationIDKey.String(val)
+}
+
+// FaaSInvokedName returns an attribute KeyValue conforming to the
+// "faas.invoked_name" semantic conventions. It represents the name of the
+// invoked function.
+func FaaSInvokedName(val string) attribute.KeyValue {
+ return FaaSInvokedNameKey.String(val)
+}
+
+// FaaSInvokedRegion returns an attribute KeyValue conforming to the
+// "faas.invoked_region" semantic conventions. It represents the cloud region of
+// the invoked function.
+func FaaSInvokedRegion(val string) attribute.KeyValue {
+ return FaaSInvokedRegionKey.String(val)
+}
+
+// FaaSMaxMemory returns an attribute KeyValue conforming to the
+// "faas.max_memory" semantic conventions. It represents the amount of memory
+// available to the serverless function converted to Bytes.
+func FaaSMaxMemory(val int) attribute.KeyValue {
+ return FaaSMaxMemoryKey.Int(val)
+}
+
+// FaaSName returns an attribute KeyValue conforming to the "faas.name" semantic
+// conventions. It represents the name of the single function that this runtime
+// instance executes.
+func FaaSName(val string) attribute.KeyValue {
+ return FaaSNameKey.String(val)
+}
+
+// FaaSTime returns an attribute KeyValue conforming to the "faas.time" semantic
+// conventions. It represents a string containing the function invocation time in
+// the [ISO 8601] format expressed in [UTC].
+//
+// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html
+// [UTC]: https://www.w3.org/TR/NOTE-datetime
+func FaaSTime(val string) attribute.KeyValue {
+ return FaaSTimeKey.String(val)
+}
+
+// FaaSVersion returns an attribute KeyValue conforming to the "faas.version"
+// semantic conventions. It represents the immutable version of the function
+// being executed.
+func FaaSVersion(val string) attribute.KeyValue {
+ return FaaSVersionKey.String(val)
+}
+
+// Enum values for faas.document.operation
+var (
+ // When a new object is created.
+ // Stability: development
+ FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert")
+ // When an object is modified.
+ // Stability: development
+ FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit")
+ // When an object is deleted.
+ // Stability: development
+ FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete")
+)
+
+// Enum values for faas.invoked_provider
+var (
+ // Alibaba Cloud
+ // Stability: development
+ FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud")
+ // Amazon Web Services
+ // Stability: development
+ FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws")
+ // Microsoft Azure
+ // Stability: development
+ FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure")
+ // Google Cloud Platform
+ // Stability: development
+ FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp")
+ // Tencent Cloud
+ // Stability: development
+ FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud")
+)
+
+// Enum values for faas.trigger
+var (
+ // A response to some data source operation such as a database or filesystem
+ // read/write
+ // Stability: development
+ FaaSTriggerDatasource = FaaSTriggerKey.String("datasource")
+ // To provide an answer to an inbound HTTP request
+ // Stability: development
+ FaaSTriggerHTTP = FaaSTriggerKey.String("http")
+ // A function is set to be executed when messages are sent to a messaging system
+ // Stability: development
+ FaaSTriggerPubSub = FaaSTriggerKey.String("pubsub")
+ // A function is scheduled to be executed regularly
+ // Stability: development
+ FaaSTriggerTimer = FaaSTriggerKey.String("timer")
+ // If none of the others apply
+ // Stability: development
+ FaaSTriggerOther = FaaSTriggerKey.String("other")
+)
+
+// Namespace: feature_flag
+const (
+ // FeatureFlagContextIDKey is the attribute Key conforming to the
+ // "feature_flag.context.id" semantic conventions. It represents the unique
+ // identifier for the flag evaluation context. For example, the targeting key.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "5157782b-2203-4c80-a857-dbbd5e7761db"
+ FeatureFlagContextIDKey = attribute.Key("feature_flag.context.id")
+
+ // FeatureFlagKeyKey is the attribute Key conforming to the "feature_flag.key"
+ // semantic conventions. It represents the lookup key of the feature flag.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "logo-color"
+ FeatureFlagKeyKey = attribute.Key("feature_flag.key")
+
+ // FeatureFlagProviderNameKey is the attribute Key conforming to the
+ // "feature_flag.provider.name" semantic conventions. It represents the
+ // identifies the feature flag provider.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Flag Manager"
+ FeatureFlagProviderNameKey = attribute.Key("feature_flag.provider.name")
+
+ // FeatureFlagResultReasonKey is the attribute Key conforming to the
+ // "feature_flag.result.reason" semantic conventions. It represents the reason
+ // code which shows how a feature flag value was determined.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "static", "targeting_match", "error", "default"
+ FeatureFlagResultReasonKey = attribute.Key("feature_flag.result.reason")
+
+ // FeatureFlagResultValueKey is the attribute Key conforming to the
+ // "feature_flag.result.value" semantic conventions. It represents the evaluated
+ // value of the feature flag.
+ //
+ // Type: any
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "#ff0000", true, 3
+ // Note: With some feature flag providers, feature flag results can be quite
+ // large or contain private or sensitive details.
+ // Because of this, `feature_flag.result.variant` is often the preferred
+ // attribute if it is available.
+ //
+ // It may be desirable to redact or otherwise limit the size and scope of
+ // `feature_flag.result.value` if possible.
+ // Because the evaluated flag value is unstructured and may be any type, it is
+ // left to the instrumentation author to determine how best to achieve this.
+ FeatureFlagResultValueKey = attribute.Key("feature_flag.result.value")
+
+ // FeatureFlagResultVariantKey is the attribute Key conforming to the
+ // "feature_flag.result.variant" semantic conventions. It represents a semantic
+ // identifier for an evaluated flag value.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "red", "true", "on"
+ // Note: A semantic identifier, commonly referred to as a variant, provides a
+ // means
+ // for referring to a value without including the value itself. This can
+ // provide additional context for understanding the meaning behind a value.
+ // For example, the variant `red` maybe be used for the value `#c05543`.
+ FeatureFlagResultVariantKey = attribute.Key("feature_flag.result.variant")
+
+ // FeatureFlagSetIDKey is the attribute Key conforming to the
+ // "feature_flag.set.id" semantic conventions. It represents the identifier of
+ // the [flag set] to which the feature flag belongs.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "proj-1", "ab98sgs", "service1/dev"
+ //
+ // [flag set]: https://openfeature.dev/specification/glossary/#flag-set
+ FeatureFlagSetIDKey = attribute.Key("feature_flag.set.id")
+
+ // FeatureFlagVersionKey is the attribute Key conforming to the
+ // "feature_flag.version" semantic conventions. It represents the version of the
+ // ruleset used during the evaluation. This may be any stable value which
+ // uniquely identifies the ruleset.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1", "01ABCDEF"
+ FeatureFlagVersionKey = attribute.Key("feature_flag.version")
+)
+
+// FeatureFlagContextID returns an attribute KeyValue conforming to the
+// "feature_flag.context.id" semantic conventions. It represents the unique
+// identifier for the flag evaluation context. For example, the targeting key.
+func FeatureFlagContextID(val string) attribute.KeyValue {
+ return FeatureFlagContextIDKey.String(val)
+}
+
+// FeatureFlagKey returns an attribute KeyValue conforming to the
+// "feature_flag.key" semantic conventions. It represents the lookup key of the
+// feature flag.
+func FeatureFlagKey(val string) attribute.KeyValue {
+ return FeatureFlagKeyKey.String(val)
+}
+
+// FeatureFlagProviderName returns an attribute KeyValue conforming to the
+// "feature_flag.provider.name" semantic conventions. It represents the
+// identifies the feature flag provider.
+func FeatureFlagProviderName(val string) attribute.KeyValue {
+ return FeatureFlagProviderNameKey.String(val)
+}
+
+// FeatureFlagResultVariant returns an attribute KeyValue conforming to the
+// "feature_flag.result.variant" semantic conventions. It represents a semantic
+// identifier for an evaluated flag value.
+func FeatureFlagResultVariant(val string) attribute.KeyValue {
+ return FeatureFlagResultVariantKey.String(val)
+}
+
+// FeatureFlagSetID returns an attribute KeyValue conforming to the
+// "feature_flag.set.id" semantic conventions. It represents the identifier of
+// the [flag set] to which the feature flag belongs.
+//
+// [flag set]: https://openfeature.dev/specification/glossary/#flag-set
+func FeatureFlagSetID(val string) attribute.KeyValue {
+ return FeatureFlagSetIDKey.String(val)
+}
+
+// FeatureFlagVersion returns an attribute KeyValue conforming to the
+// "feature_flag.version" semantic conventions. It represents the version of the
+// ruleset used during the evaluation. This may be any stable value which
+// uniquely identifies the ruleset.
+func FeatureFlagVersion(val string) attribute.KeyValue {
+ return FeatureFlagVersionKey.String(val)
+}
+
+// Enum values for feature_flag.result.reason
+var (
+ // The resolved value is static (no dynamic evaluation).
+ // Stability: development
+ FeatureFlagResultReasonStatic = FeatureFlagResultReasonKey.String("static")
+ // The resolved value fell back to a pre-configured value (no dynamic evaluation
+ // occurred or dynamic evaluation yielded no result).
+ // Stability: development
+ FeatureFlagResultReasonDefault = FeatureFlagResultReasonKey.String("default")
+ // The resolved value was the result of a dynamic evaluation, such as a rule or
+ // specific user-targeting.
+ // Stability: development
+ FeatureFlagResultReasonTargetingMatch = FeatureFlagResultReasonKey.String("targeting_match")
+ // The resolved value was the result of pseudorandom assignment.
+ // Stability: development
+ FeatureFlagResultReasonSplit = FeatureFlagResultReasonKey.String("split")
+ // The resolved value was retrieved from cache.
+ // Stability: development
+ FeatureFlagResultReasonCached = FeatureFlagResultReasonKey.String("cached")
+ // The resolved value was the result of the flag being disabled in the
+ // management system.
+ // Stability: development
+ FeatureFlagResultReasonDisabled = FeatureFlagResultReasonKey.String("disabled")
+ // The reason for the resolved value could not be determined.
+ // Stability: development
+ FeatureFlagResultReasonUnknown = FeatureFlagResultReasonKey.String("unknown")
+ // The resolved value is non-authoritative or possibly out of date
+ // Stability: development
+ FeatureFlagResultReasonStale = FeatureFlagResultReasonKey.String("stale")
+ // The resolved value was the result of an error.
+ // Stability: development
+ FeatureFlagResultReasonError = FeatureFlagResultReasonKey.String("error")
+)
+
+// Namespace: file
+const (
+ // FileAccessedKey is the attribute Key conforming to the "file.accessed"
+ // semantic conventions. It represents the time when the file was last accessed,
+ // in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ // Note: This attribute might not be supported by some file systems — NFS,
+ // FAT32, in embedded OS, etc.
+ FileAccessedKey = attribute.Key("file.accessed")
+
+ // FileAttributesKey is the attribute Key conforming to the "file.attributes"
+ // semantic conventions. It represents the array of file attributes.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "readonly", "hidden"
+ // Note: Attributes names depend on the OS or file system. Here’s a
+ // non-exhaustive list of values expected for this attribute: `archive`,
+ // `compressed`, `directory`, `encrypted`, `execute`, `hidden`, `immutable`,
+ // `journaled`, `read`, `readonly`, `symbolic link`, `system`, `temporary`,
+ // `write`.
+ FileAttributesKey = attribute.Key("file.attributes")
+
+ // FileChangedKey is the attribute Key conforming to the "file.changed" semantic
+ // conventions. It represents the time when the file attributes or metadata was
+ // last changed, in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ // Note: `file.changed` captures the time when any of the file's properties or
+ // attributes (including the content) are changed, while `file.modified`
+ // captures the timestamp when the file content is modified.
+ FileChangedKey = attribute.Key("file.changed")
+
+ // FileCreatedKey is the attribute Key conforming to the "file.created" semantic
+ // conventions. It represents the time when the file was created, in ISO 8601
+ // format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ // Note: This attribute might not be supported by some file systems — NFS,
+ // FAT32, in embedded OS, etc.
+ FileCreatedKey = attribute.Key("file.created")
+
+ // FileDirectoryKey is the attribute Key conforming to the "file.directory"
+ // semantic conventions. It represents the directory where the file is located.
+ // It should include the drive letter, when appropriate.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/home/user", "C:\Program Files\MyApp"
+ FileDirectoryKey = attribute.Key("file.directory")
+
+ // FileExtensionKey is the attribute Key conforming to the "file.extension"
+ // semantic conventions. It represents the file extension, excluding the leading
+ // dot.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "png", "gz"
+ // Note: When the file name has multiple extensions (example.tar.gz), only the
+ // last one should be captured ("gz", not "tar.gz").
+ FileExtensionKey = attribute.Key("file.extension")
+
+ // FileForkNameKey is the attribute Key conforming to the "file.fork_name"
+ // semantic conventions. It represents the name of the fork. A fork is
+ // additional data associated with a filesystem object.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Zone.Identifer"
+ // Note: On Linux, a resource fork is used to store additional data with a
+ // filesystem object. A file always has at least one fork for the data portion,
+ // and additional forks may exist.
+ // On NTFS, this is analogous to an Alternate Data Stream (ADS), and the default
+ // data stream for a file is just called $DATA. Zone.Identifier is commonly used
+ // by Windows to track contents downloaded from the Internet. An ADS is
+ // typically of the form: C:\path\to\filename.extension:some_fork_name, and
+ // some_fork_name is the value that should populate `fork_name`.
+ // `filename.extension` should populate `file.name`, and `extension` should
+ // populate `file.extension`. The full path, `file.path`, will include the fork
+ // name.
+ FileForkNameKey = attribute.Key("file.fork_name")
+
+ // FileGroupIDKey is the attribute Key conforming to the "file.group.id"
+ // semantic conventions. It represents the primary Group ID (GID) of the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1000"
+ FileGroupIDKey = attribute.Key("file.group.id")
+
+ // FileGroupNameKey is the attribute Key conforming to the "file.group.name"
+ // semantic conventions. It represents the primary group name of the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "users"
+ FileGroupNameKey = attribute.Key("file.group.name")
+
+ // FileInodeKey is the attribute Key conforming to the "file.inode" semantic
+ // conventions. It represents the inode representing the file in the filesystem.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "256383"
+ FileInodeKey = attribute.Key("file.inode")
+
+ // FileModeKey is the attribute Key conforming to the "file.mode" semantic
+ // conventions. It represents the mode of the file in octal representation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0640"
+ FileModeKey = attribute.Key("file.mode")
+
+ // FileModifiedKey is the attribute Key conforming to the "file.modified"
+ // semantic conventions. It represents the time when the file content was last
+ // modified, in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T12:00:00Z"
+ FileModifiedKey = attribute.Key("file.modified")
+
+ // FileNameKey is the attribute Key conforming to the "file.name" semantic
+ // conventions. It represents the name of the file including the extension,
+ // without the directory.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "example.png"
+ FileNameKey = attribute.Key("file.name")
+
+ // FileOwnerIDKey is the attribute Key conforming to the "file.owner.id"
+ // semantic conventions. It represents the user ID (UID) or security identifier
+ // (SID) of the file owner.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1000"
+ FileOwnerIDKey = attribute.Key("file.owner.id")
+
+ // FileOwnerNameKey is the attribute Key conforming to the "file.owner.name"
+ // semantic conventions. It represents the username of the file owner.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "root"
+ FileOwnerNameKey = attribute.Key("file.owner.name")
+
+ // FilePathKey is the attribute Key conforming to the "file.path" semantic
+ // conventions. It represents the full path to the file, including the file
+ // name. It should include the drive letter, when appropriate.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/home/alice/example.png", "C:\Program Files\MyApp\myapp.exe"
+ FilePathKey = attribute.Key("file.path")
+
+ // FileSizeKey is the attribute Key conforming to the "file.size" semantic
+ // conventions. It represents the file size in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ FileSizeKey = attribute.Key("file.size")
+
+ // FileSymbolicLinkTargetPathKey is the attribute Key conforming to the
+ // "file.symbolic_link.target_path" semantic conventions. It represents the path
+ // to the target of a symbolic link.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/usr/bin/python3"
+ // Note: This attribute is only applicable to symbolic links.
+ FileSymbolicLinkTargetPathKey = attribute.Key("file.symbolic_link.target_path")
+)
+
+// FileAccessed returns an attribute KeyValue conforming to the "file.accessed"
+// semantic conventions. It represents the time when the file was last accessed,
+// in ISO 8601 format.
+func FileAccessed(val string) attribute.KeyValue {
+ return FileAccessedKey.String(val)
+}
+
+// FileAttributes returns an attribute KeyValue conforming to the
+// "file.attributes" semantic conventions. It represents the array of file
+// attributes.
+func FileAttributes(val ...string) attribute.KeyValue {
+ return FileAttributesKey.StringSlice(val)
+}
+
+// FileChanged returns an attribute KeyValue conforming to the "file.changed"
+// semantic conventions. It represents the time when the file attributes or
+// metadata was last changed, in ISO 8601 format.
+func FileChanged(val string) attribute.KeyValue {
+ return FileChangedKey.String(val)
+}
+
+// FileCreated returns an attribute KeyValue conforming to the "file.created"
+// semantic conventions. It represents the time when the file was created, in ISO
+// 8601 format.
+func FileCreated(val string) attribute.KeyValue {
+ return FileCreatedKey.String(val)
+}
+
+// FileDirectory returns an attribute KeyValue conforming to the "file.directory"
+// semantic conventions. It represents the directory where the file is located.
+// It should include the drive letter, when appropriate.
+func FileDirectory(val string) attribute.KeyValue {
+ return FileDirectoryKey.String(val)
+}
+
+// FileExtension returns an attribute KeyValue conforming to the "file.extension"
+// semantic conventions. It represents the file extension, excluding the leading
+// dot.
+func FileExtension(val string) attribute.KeyValue {
+ return FileExtensionKey.String(val)
+}
+
+// FileForkName returns an attribute KeyValue conforming to the "file.fork_name"
+// semantic conventions. It represents the name of the fork. A fork is additional
+// data associated with a filesystem object.
+func FileForkName(val string) attribute.KeyValue {
+ return FileForkNameKey.String(val)
+}
+
+// FileGroupID returns an attribute KeyValue conforming to the "file.group.id"
+// semantic conventions. It represents the primary Group ID (GID) of the file.
+func FileGroupID(val string) attribute.KeyValue {
+ return FileGroupIDKey.String(val)
+}
+
+// FileGroupName returns an attribute KeyValue conforming to the
+// "file.group.name" semantic conventions. It represents the primary group name
+// of the file.
+func FileGroupName(val string) attribute.KeyValue {
+ return FileGroupNameKey.String(val)
+}
+
+// FileInode returns an attribute KeyValue conforming to the "file.inode"
+// semantic conventions. It represents the inode representing the file in the
+// filesystem.
+func FileInode(val string) attribute.KeyValue {
+ return FileInodeKey.String(val)
+}
+
+// FileMode returns an attribute KeyValue conforming to the "file.mode" semantic
+// conventions. It represents the mode of the file in octal representation.
+func FileMode(val string) attribute.KeyValue {
+ return FileModeKey.String(val)
+}
+
+// FileModified returns an attribute KeyValue conforming to the "file.modified"
+// semantic conventions. It represents the time when the file content was last
+// modified, in ISO 8601 format.
+func FileModified(val string) attribute.KeyValue {
+ return FileModifiedKey.String(val)
+}
+
+// FileName returns an attribute KeyValue conforming to the "file.name" semantic
+// conventions. It represents the name of the file including the extension,
+// without the directory.
+func FileName(val string) attribute.KeyValue {
+ return FileNameKey.String(val)
+}
+
+// FileOwnerID returns an attribute KeyValue conforming to the "file.owner.id"
+// semantic conventions. It represents the user ID (UID) or security identifier
+// (SID) of the file owner.
+func FileOwnerID(val string) attribute.KeyValue {
+ return FileOwnerIDKey.String(val)
+}
+
+// FileOwnerName returns an attribute KeyValue conforming to the
+// "file.owner.name" semantic conventions. It represents the username of the file
+// owner.
+func FileOwnerName(val string) attribute.KeyValue {
+ return FileOwnerNameKey.String(val)
+}
+
+// FilePath returns an attribute KeyValue conforming to the "file.path" semantic
+// conventions. It represents the full path to the file, including the file name.
+// It should include the drive letter, when appropriate.
+func FilePath(val string) attribute.KeyValue {
+ return FilePathKey.String(val)
+}
+
+// FileSize returns an attribute KeyValue conforming to the "file.size" semantic
+// conventions. It represents the file size in bytes.
+func FileSize(val int) attribute.KeyValue {
+ return FileSizeKey.Int(val)
+}
+
+// FileSymbolicLinkTargetPath returns an attribute KeyValue conforming to the
+// "file.symbolic_link.target_path" semantic conventions. It represents the path
+// to the target of a symbolic link.
+func FileSymbolicLinkTargetPath(val string) attribute.KeyValue {
+ return FileSymbolicLinkTargetPathKey.String(val)
+}
+
+// Namespace: gcp
+const (
+ // GCPAppHubApplicationContainerKey is the attribute Key conforming to the
+ // "gcp.apphub.application.container" semantic conventions. It represents the
+ // container within GCP where the AppHub application is defined.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "projects/my-container-project"
+ GCPAppHubApplicationContainerKey = attribute.Key("gcp.apphub.application.container")
+
+ // GCPAppHubApplicationIDKey is the attribute Key conforming to the
+ // "gcp.apphub.application.id" semantic conventions. It represents the name of
+ // the application as configured in AppHub.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-application"
+ GCPAppHubApplicationIDKey = attribute.Key("gcp.apphub.application.id")
+
+ // GCPAppHubApplicationLocationKey is the attribute Key conforming to the
+ // "gcp.apphub.application.location" semantic conventions. It represents the GCP
+ // zone or region where the application is defined.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "us-central1"
+ GCPAppHubApplicationLocationKey = attribute.Key("gcp.apphub.application.location")
+
+ // GCPAppHubServiceCriticalityTypeKey is the attribute Key conforming to the
+ // "gcp.apphub.service.criticality_type" semantic conventions. It represents the
+ // criticality of a service indicates its importance to the business.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: [See AppHub type enum]
+ //
+ // [See AppHub type enum]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type
+ GCPAppHubServiceCriticalityTypeKey = attribute.Key("gcp.apphub.service.criticality_type")
+
+ // GCPAppHubServiceEnvironmentTypeKey is the attribute Key conforming to the
+ // "gcp.apphub.service.environment_type" semantic conventions. It represents the
+ // environment of a service is the stage of a software lifecycle.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: [See AppHub environment type]
+ //
+ // [See AppHub environment type]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type_1
+ GCPAppHubServiceEnvironmentTypeKey = attribute.Key("gcp.apphub.service.environment_type")
+
+ // GCPAppHubServiceIDKey is the attribute Key conforming to the
+ // "gcp.apphub.service.id" semantic conventions. It represents the name of the
+ // service as configured in AppHub.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-service"
+ GCPAppHubServiceIDKey = attribute.Key("gcp.apphub.service.id")
+
+ // GCPAppHubWorkloadCriticalityTypeKey is the attribute Key conforming to the
+ // "gcp.apphub.workload.criticality_type" semantic conventions. It represents
+ // the criticality of a workload indicates its importance to the business.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: [See AppHub type enum]
+ //
+ // [See AppHub type enum]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type
+ GCPAppHubWorkloadCriticalityTypeKey = attribute.Key("gcp.apphub.workload.criticality_type")
+
+ // GCPAppHubWorkloadEnvironmentTypeKey is the attribute Key conforming to the
+ // "gcp.apphub.workload.environment_type" semantic conventions. It represents
+ // the environment of a workload is the stage of a software lifecycle.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: [See AppHub environment type]
+ //
+ // [See AppHub environment type]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type_1
+ GCPAppHubWorkloadEnvironmentTypeKey = attribute.Key("gcp.apphub.workload.environment_type")
+
+ // GCPAppHubWorkloadIDKey is the attribute Key conforming to the
+ // "gcp.apphub.workload.id" semantic conventions. It represents the name of the
+ // workload as configured in AppHub.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-workload"
+ GCPAppHubWorkloadIDKey = attribute.Key("gcp.apphub.workload.id")
+
+ // GCPClientServiceKey is the attribute Key conforming to the
+ // "gcp.client.service" semantic conventions. It represents the identifies the
+ // Google Cloud service for which the official client library is intended.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "appengine", "run", "firestore", "alloydb", "spanner"
+ // Note: Intended to be a stable identifier for Google Cloud client libraries
+ // that is uniform across implementation languages. The value should be derived
+ // from the canonical service domain for the service; for example,
+ // 'foo.googleapis.com' should result in a value of 'foo'.
+ GCPClientServiceKey = attribute.Key("gcp.client.service")
+
+ // GCPCloudRunJobExecutionKey is the attribute Key conforming to the
+ // "gcp.cloud_run.job.execution" semantic conventions. It represents the name of
+ // the Cloud Run [execution] being run for the Job, as set by the
+ // [`CLOUD_RUN_EXECUTION`] environment variable.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "job-name-xxxx", "sample-job-mdw84"
+ //
+ // [execution]: https://cloud.google.com/run/docs/managing/job-executions
+ // [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+ GCPCloudRunJobExecutionKey = attribute.Key("gcp.cloud_run.job.execution")
+
+ // GCPCloudRunJobTaskIndexKey is the attribute Key conforming to the
+ // "gcp.cloud_run.job.task_index" semantic conventions. It represents the index
+ // for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`]
+ // environment variable.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0, 1
+ //
+ // [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+ GCPCloudRunJobTaskIndexKey = attribute.Key("gcp.cloud_run.job.task_index")
+
+ // GCPGCEInstanceHostnameKey is the attribute Key conforming to the
+ // "gcp.gce.instance.hostname" semantic conventions. It represents the hostname
+ // of a GCE instance. This is the full value of the default or [custom hostname]
+ // .
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-host1234.example.com",
+ // "sample-vm.us-west1-b.c.my-project.internal"
+ //
+ // [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm
+ GCPGCEInstanceHostnameKey = attribute.Key("gcp.gce.instance.hostname")
+
+ // GCPGCEInstanceNameKey is the attribute Key conforming to the
+ // "gcp.gce.instance.name" semantic conventions. It represents the instance name
+ // of a GCE instance. This is the value provided by `host.name`, the visible
+ // name of the instance in the Cloud Console UI, and the prefix for the default
+ // hostname of the instance as defined by the [default internal DNS name].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "instance-1", "my-vm-name"
+ //
+ // [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names
+ GCPGCEInstanceNameKey = attribute.Key("gcp.gce.instance.name")
+)
+
+// GCPAppHubApplicationContainer returns an attribute KeyValue conforming to the
+// "gcp.apphub.application.container" semantic conventions. It represents the
+// container within GCP where the AppHub application is defined.
+func GCPAppHubApplicationContainer(val string) attribute.KeyValue {
+ return GCPAppHubApplicationContainerKey.String(val)
+}
+
+// GCPAppHubApplicationID returns an attribute KeyValue conforming to the
+// "gcp.apphub.application.id" semantic conventions. It represents the name of
+// the application as configured in AppHub.
+func GCPAppHubApplicationID(val string) attribute.KeyValue {
+ return GCPAppHubApplicationIDKey.String(val)
+}
+
+// GCPAppHubApplicationLocation returns an attribute KeyValue conforming to the
+// "gcp.apphub.application.location" semantic conventions. It represents the GCP
+// zone or region where the application is defined.
+func GCPAppHubApplicationLocation(val string) attribute.KeyValue {
+ return GCPAppHubApplicationLocationKey.String(val)
+}
+
+// GCPAppHubServiceID returns an attribute KeyValue conforming to the
+// "gcp.apphub.service.id" semantic conventions. It represents the name of the
+// service as configured in AppHub.
+func GCPAppHubServiceID(val string) attribute.KeyValue {
+ return GCPAppHubServiceIDKey.String(val)
+}
+
+// GCPAppHubWorkloadID returns an attribute KeyValue conforming to the
+// "gcp.apphub.workload.id" semantic conventions. It represents the name of the
+// workload as configured in AppHub.
+func GCPAppHubWorkloadID(val string) attribute.KeyValue {
+ return GCPAppHubWorkloadIDKey.String(val)
+}
+
+// GCPClientService returns an attribute KeyValue conforming to the
+// "gcp.client.service" semantic conventions. It represents the identifies the
+// Google Cloud service for which the official client library is intended.
+func GCPClientService(val string) attribute.KeyValue {
+ return GCPClientServiceKey.String(val)
+}
+
+// GCPCloudRunJobExecution returns an attribute KeyValue conforming to the
+// "gcp.cloud_run.job.execution" semantic conventions. It represents the name of
+// the Cloud Run [execution] being run for the Job, as set by the
+// [`CLOUD_RUN_EXECUTION`] environment variable.
+//
+// [execution]: https://cloud.google.com/run/docs/managing/job-executions
+// [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+func GCPCloudRunJobExecution(val string) attribute.KeyValue {
+ return GCPCloudRunJobExecutionKey.String(val)
+}
+
+// GCPCloudRunJobTaskIndex returns an attribute KeyValue conforming to the
+// "gcp.cloud_run.job.task_index" semantic conventions. It represents the index
+// for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`]
+// environment variable.
+//
+// [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars
+func GCPCloudRunJobTaskIndex(val int) attribute.KeyValue {
+ return GCPCloudRunJobTaskIndexKey.Int(val)
+}
+
+// GCPGCEInstanceHostname returns an attribute KeyValue conforming to the
+// "gcp.gce.instance.hostname" semantic conventions. It represents the hostname
+// of a GCE instance. This is the full value of the default or [custom hostname]
+// .
+//
+// [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm
+func GCPGCEInstanceHostname(val string) attribute.KeyValue {
+ return GCPGCEInstanceHostnameKey.String(val)
+}
+
+// GCPGCEInstanceName returns an attribute KeyValue conforming to the
+// "gcp.gce.instance.name" semantic conventions. It represents the instance name
+// of a GCE instance. This is the value provided by `host.name`, the visible name
+// of the instance in the Cloud Console UI, and the prefix for the default
+// hostname of the instance as defined by the [default internal DNS name].
+//
+// [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names
+func GCPGCEInstanceName(val string) attribute.KeyValue {
+ return GCPGCEInstanceNameKey.String(val)
+}
+
+// Enum values for gcp.apphub.service.criticality_type
+var (
+ // Mission critical service.
+ // Stability: development
+ GCPAppHubServiceCriticalityTypeMissionCritical = GCPAppHubServiceCriticalityTypeKey.String("MISSION_CRITICAL")
+ // High impact.
+ // Stability: development
+ GCPAppHubServiceCriticalityTypeHigh = GCPAppHubServiceCriticalityTypeKey.String("HIGH")
+ // Medium impact.
+ // Stability: development
+ GCPAppHubServiceCriticalityTypeMedium = GCPAppHubServiceCriticalityTypeKey.String("MEDIUM")
+ // Low impact.
+ // Stability: development
+ GCPAppHubServiceCriticalityTypeLow = GCPAppHubServiceCriticalityTypeKey.String("LOW")
+)
+
+// Enum values for gcp.apphub.service.environment_type
+var (
+ // Production environment.
+ // Stability: development
+ GCPAppHubServiceEnvironmentTypeProduction = GCPAppHubServiceEnvironmentTypeKey.String("PRODUCTION")
+ // Staging environment.
+ // Stability: development
+ GCPAppHubServiceEnvironmentTypeStaging = GCPAppHubServiceEnvironmentTypeKey.String("STAGING")
+ // Test environment.
+ // Stability: development
+ GCPAppHubServiceEnvironmentTypeTest = GCPAppHubServiceEnvironmentTypeKey.String("TEST")
+ // Development environment.
+ // Stability: development
+ GCPAppHubServiceEnvironmentTypeDevelopment = GCPAppHubServiceEnvironmentTypeKey.String("DEVELOPMENT")
+)
+
+// Enum values for gcp.apphub.workload.criticality_type
+var (
+ // Mission critical service.
+ // Stability: development
+ GCPAppHubWorkloadCriticalityTypeMissionCritical = GCPAppHubWorkloadCriticalityTypeKey.String("MISSION_CRITICAL")
+ // High impact.
+ // Stability: development
+ GCPAppHubWorkloadCriticalityTypeHigh = GCPAppHubWorkloadCriticalityTypeKey.String("HIGH")
+ // Medium impact.
+ // Stability: development
+ GCPAppHubWorkloadCriticalityTypeMedium = GCPAppHubWorkloadCriticalityTypeKey.String("MEDIUM")
+ // Low impact.
+ // Stability: development
+ GCPAppHubWorkloadCriticalityTypeLow = GCPAppHubWorkloadCriticalityTypeKey.String("LOW")
+)
+
+// Enum values for gcp.apphub.workload.environment_type
+var (
+ // Production environment.
+ // Stability: development
+ GCPAppHubWorkloadEnvironmentTypeProduction = GCPAppHubWorkloadEnvironmentTypeKey.String("PRODUCTION")
+ // Staging environment.
+ // Stability: development
+ GCPAppHubWorkloadEnvironmentTypeStaging = GCPAppHubWorkloadEnvironmentTypeKey.String("STAGING")
+ // Test environment.
+ // Stability: development
+ GCPAppHubWorkloadEnvironmentTypeTest = GCPAppHubWorkloadEnvironmentTypeKey.String("TEST")
+ // Development environment.
+ // Stability: development
+ GCPAppHubWorkloadEnvironmentTypeDevelopment = GCPAppHubWorkloadEnvironmentTypeKey.String("DEVELOPMENT")
+)
+
+// Namespace: gen_ai
+const (
+ // GenAIAgentDescriptionKey is the attribute Key conforming to the
+ // "gen_ai.agent.description" semantic conventions. It represents the free-form
+ // description of the GenAI agent provided by the application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Helps with math problems", "Generates fiction stories"
+ GenAIAgentDescriptionKey = attribute.Key("gen_ai.agent.description")
+
+ // GenAIAgentIDKey is the attribute Key conforming to the "gen_ai.agent.id"
+ // semantic conventions. It represents the unique identifier of the GenAI agent.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "asst_5j66UpCpwteGg4YSxUnt7lPY"
+ GenAIAgentIDKey = attribute.Key("gen_ai.agent.id")
+
+ // GenAIAgentNameKey is the attribute Key conforming to the "gen_ai.agent.name"
+ // semantic conventions. It represents the human-readable name of the GenAI
+ // agent provided by the application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Math Tutor", "Fiction Writer"
+ GenAIAgentNameKey = attribute.Key("gen_ai.agent.name")
+
+ // GenAIConversationIDKey is the attribute Key conforming to the
+ // "gen_ai.conversation.id" semantic conventions. It represents the unique
+ // identifier for a conversation (session, thread), used to store and correlate
+ // messages within this conversation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "conv_5j66UpCpwteGg4YSxUnt7lPY"
+ GenAIConversationIDKey = attribute.Key("gen_ai.conversation.id")
+
+ // GenAIDataSourceIDKey is the attribute Key conforming to the
+ // "gen_ai.data_source.id" semantic conventions. It represents the data source
+ // identifier.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "H7STPQYOND"
+ // Note: Data sources are used by AI agents and RAG applications to store
+ // grounding data. A data source may be an external database, object store,
+ // document collection, website, or any other storage system used by the GenAI
+ // agent or application. The `gen_ai.data_source.id` SHOULD match the identifier
+ // used by the GenAI system rather than a name specific to the external storage,
+ // such as a database or object store. Semantic conventions referencing
+ // `gen_ai.data_source.id` MAY also leverage additional attributes, such as
+ // `db.*`, to further identify and describe the data source.
+ GenAIDataSourceIDKey = attribute.Key("gen_ai.data_source.id")
+
+ // GenAIOpenAIRequestServiceTierKey is the attribute Key conforming to the
+ // "gen_ai.openai.request.service_tier" semantic conventions. It represents the
+ // service tier requested. May be a specific tier, default, or auto.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "auto", "default"
+ GenAIOpenAIRequestServiceTierKey = attribute.Key("gen_ai.openai.request.service_tier")
+
+ // GenAIOpenAIResponseServiceTierKey is the attribute Key conforming to the
+ // "gen_ai.openai.response.service_tier" semantic conventions. It represents the
+ // service tier used for the response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "scale", "default"
+ GenAIOpenAIResponseServiceTierKey = attribute.Key("gen_ai.openai.response.service_tier")
+
+ // GenAIOpenAIResponseSystemFingerprintKey is the attribute Key conforming to
+ // the "gen_ai.openai.response.system_fingerprint" semantic conventions. It
+ // represents a fingerprint to track any eventual change in the Generative AI
+ // environment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "fp_44709d6fcb"
+ GenAIOpenAIResponseSystemFingerprintKey = attribute.Key("gen_ai.openai.response.system_fingerprint")
+
+ // GenAIOperationNameKey is the attribute Key conforming to the
+ // "gen_ai.operation.name" semantic conventions. It represents the name of the
+ // operation being performed.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: If one of the predefined values applies, but specific system uses a
+ // different name it's RECOMMENDED to document it in the semantic conventions
+ // for specific GenAI system and use system-specific name in the
+ // instrumentation. If a different name is not documented, instrumentation
+ // libraries SHOULD use applicable predefined value.
+ GenAIOperationNameKey = attribute.Key("gen_ai.operation.name")
+
+ // GenAIOutputTypeKey is the attribute Key conforming to the
+ // "gen_ai.output.type" semantic conventions. It represents the represents the
+ // content type requested by the client.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: This attribute SHOULD be used when the client requests output of a
+ // specific type. The model may return zero or more outputs of this type.
+ // This attribute specifies the output modality and not the actual output
+ // format. For example, if an image is requested, the actual output could be a
+ // URL pointing to an image file.
+ // Additional output format details may be recorded in the future in the
+ // `gen_ai.output.{type}.*` attributes.
+ GenAIOutputTypeKey = attribute.Key("gen_ai.output.type")
+
+ // GenAIRequestChoiceCountKey is the attribute Key conforming to the
+ // "gen_ai.request.choice.count" semantic conventions. It represents the target
+ // number of candidate completions to return.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 3
+ GenAIRequestChoiceCountKey = attribute.Key("gen_ai.request.choice.count")
+
+ // GenAIRequestEncodingFormatsKey is the attribute Key conforming to the
+ // "gen_ai.request.encoding_formats" semantic conventions. It represents the
+ // encoding formats requested in an embeddings operation, if specified.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "base64"], ["float", "binary"
+ // Note: In some GenAI systems the encoding formats are called embedding types.
+ // Also, some GenAI systems only accept a single format per request.
+ GenAIRequestEncodingFormatsKey = attribute.Key("gen_ai.request.encoding_formats")
+
+ // GenAIRequestFrequencyPenaltyKey is the attribute Key conforming to the
+ // "gen_ai.request.frequency_penalty" semantic conventions. It represents the
+ // frequency penalty setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0.1
+ GenAIRequestFrequencyPenaltyKey = attribute.Key("gen_ai.request.frequency_penalty")
+
+ // GenAIRequestMaxTokensKey is the attribute Key conforming to the
+ // "gen_ai.request.max_tokens" semantic conventions. It represents the maximum
+ // number of tokens the model generates for a request.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ GenAIRequestMaxTokensKey = attribute.Key("gen_ai.request.max_tokens")
+
+ // GenAIRequestModelKey is the attribute Key conforming to the
+ // "gen_ai.request.model" semantic conventions. It represents the name of the
+ // GenAI model a request is being made to.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: gpt-4
+ GenAIRequestModelKey = attribute.Key("gen_ai.request.model")
+
+ // GenAIRequestPresencePenaltyKey is the attribute Key conforming to the
+ // "gen_ai.request.presence_penalty" semantic conventions. It represents the
+ // presence penalty setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0.1
+ GenAIRequestPresencePenaltyKey = attribute.Key("gen_ai.request.presence_penalty")
+
+ // GenAIRequestSeedKey is the attribute Key conforming to the
+ // "gen_ai.request.seed" semantic conventions. It represents the requests with
+ // same seed value more likely to return same result.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ GenAIRequestSeedKey = attribute.Key("gen_ai.request.seed")
+
+ // GenAIRequestStopSequencesKey is the attribute Key conforming to the
+ // "gen_ai.request.stop_sequences" semantic conventions. It represents the list
+ // of sequences that the model will use to stop generating further tokens.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "forest", "lived"
+ GenAIRequestStopSequencesKey = attribute.Key("gen_ai.request.stop_sequences")
+
+ // GenAIRequestTemperatureKey is the attribute Key conforming to the
+ // "gen_ai.request.temperature" semantic conventions. It represents the
+ // temperature setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0.0
+ GenAIRequestTemperatureKey = attribute.Key("gen_ai.request.temperature")
+
+ // GenAIRequestTopKKey is the attribute Key conforming to the
+ // "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling
+ // setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0
+ GenAIRequestTopKKey = attribute.Key("gen_ai.request.top_k")
+
+ // GenAIRequestTopPKey is the attribute Key conforming to the
+ // "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling
+ // setting for the GenAI request.
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1.0
+ GenAIRequestTopPKey = attribute.Key("gen_ai.request.top_p")
+
+ // GenAIResponseFinishReasonsKey is the attribute Key conforming to the
+ // "gen_ai.response.finish_reasons" semantic conventions. It represents the
+ // array of reasons the model stopped generating tokens, corresponding to each
+ // generation received.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "stop"], ["stop", "length"
+ GenAIResponseFinishReasonsKey = attribute.Key("gen_ai.response.finish_reasons")
+
+ // GenAIResponseIDKey is the attribute Key conforming to the
+ // "gen_ai.response.id" semantic conventions. It represents the unique
+ // identifier for the completion.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "chatcmpl-123"
+ GenAIResponseIDKey = attribute.Key("gen_ai.response.id")
+
+ // GenAIResponseModelKey is the attribute Key conforming to the
+ // "gen_ai.response.model" semantic conventions. It represents the name of the
+ // model that generated the response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "gpt-4-0613"
+ GenAIResponseModelKey = attribute.Key("gen_ai.response.model")
+
+ // GenAISystemKey is the attribute Key conforming to the "gen_ai.system"
+ // semantic conventions. It represents the Generative AI product as identified
+ // by the client or server instrumentation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: openai
+ // Note: The `gen_ai.system` describes a family of GenAI models with specific
+ // model identified
+ // by `gen_ai.request.model` and `gen_ai.response.model` attributes.
+ //
+ // The actual GenAI product may differ from the one identified by the client.
+ // Multiple systems, including Azure OpenAI and Gemini, are accessible by OpenAI
+ // client
+ // libraries. In such cases, the `gen_ai.system` is set to `openai` based on the
+ // instrumentation's best knowledge, instead of the actual system. The
+ // `server.address`
+ // attribute may help identify the actual system in use for `openai`.
+ //
+ // For custom model, a custom friendly name SHOULD be used.
+ // If none of these options apply, the `gen_ai.system` SHOULD be set to `_OTHER`
+ // .
+ GenAISystemKey = attribute.Key("gen_ai.system")
+
+ // GenAITokenTypeKey is the attribute Key conforming to the "gen_ai.token.type"
+ // semantic conventions. It represents the type of token being counted.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "input", "output"
+ GenAITokenTypeKey = attribute.Key("gen_ai.token.type")
+
+ // GenAIToolCallIDKey is the attribute Key conforming to the
+ // "gen_ai.tool.call.id" semantic conventions. It represents the tool call
+ // identifier.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "call_mszuSIzqtI65i1wAUOE8w5H4"
+ GenAIToolCallIDKey = attribute.Key("gen_ai.tool.call.id")
+
+ // GenAIToolDescriptionKey is the attribute Key conforming to the
+ // "gen_ai.tool.description" semantic conventions. It represents the tool
+ // description.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Multiply two numbers"
+ GenAIToolDescriptionKey = attribute.Key("gen_ai.tool.description")
+
+ // GenAIToolNameKey is the attribute Key conforming to the "gen_ai.tool.name"
+ // semantic conventions. It represents the name of the tool utilized by the
+ // agent.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Flights"
+ GenAIToolNameKey = attribute.Key("gen_ai.tool.name")
+
+ // GenAIToolTypeKey is the attribute Key conforming to the "gen_ai.tool.type"
+ // semantic conventions. It represents the type of the tool utilized by the
+ // agent.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "function", "extension", "datastore"
+ // Note: Extension: A tool executed on the agent-side to directly call external
+ // APIs, bridging the gap between the agent and real-world systems.
+ // Agent-side operations involve actions that are performed by the agent on the
+ // server or within the agent's controlled environment.
+ // Function: A tool executed on the client-side, where the agent generates
+ // parameters for a predefined function, and the client executes the logic.
+ // Client-side operations are actions taken on the user's end or within the
+ // client application.
+ // Datastore: A tool used by the agent to access and query structured or
+ // unstructured external data for retrieval-augmented tasks or knowledge
+ // updates.
+ GenAIToolTypeKey = attribute.Key("gen_ai.tool.type")
+
+ // GenAIUsageInputTokensKey is the attribute Key conforming to the
+ // "gen_ai.usage.input_tokens" semantic conventions. It represents the number of
+ // tokens used in the GenAI input (prompt).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 100
+ GenAIUsageInputTokensKey = attribute.Key("gen_ai.usage.input_tokens")
+
+ // GenAIUsageOutputTokensKey is the attribute Key conforming to the
+ // "gen_ai.usage.output_tokens" semantic conventions. It represents the number
+ // of tokens used in the GenAI response (completion).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 180
+ GenAIUsageOutputTokensKey = attribute.Key("gen_ai.usage.output_tokens")
+)
+
+// GenAIAgentDescription returns an attribute KeyValue conforming to the
+// "gen_ai.agent.description" semantic conventions. It represents the free-form
+// description of the GenAI agent provided by the application.
+func GenAIAgentDescription(val string) attribute.KeyValue {
+ return GenAIAgentDescriptionKey.String(val)
+}
+
+// GenAIAgentID returns an attribute KeyValue conforming to the "gen_ai.agent.id"
+// semantic conventions. It represents the unique identifier of the GenAI agent.
+func GenAIAgentID(val string) attribute.KeyValue {
+ return GenAIAgentIDKey.String(val)
+}
+
+// GenAIAgentName returns an attribute KeyValue conforming to the
+// "gen_ai.agent.name" semantic conventions. It represents the human-readable
+// name of the GenAI agent provided by the application.
+func GenAIAgentName(val string) attribute.KeyValue {
+ return GenAIAgentNameKey.String(val)
+}
+
+// GenAIConversationID returns an attribute KeyValue conforming to the
+// "gen_ai.conversation.id" semantic conventions. It represents the unique
+// identifier for a conversation (session, thread), used to store and correlate
+// messages within this conversation.
+func GenAIConversationID(val string) attribute.KeyValue {
+ return GenAIConversationIDKey.String(val)
+}
+
+// GenAIDataSourceID returns an attribute KeyValue conforming to the
+// "gen_ai.data_source.id" semantic conventions. It represents the data source
+// identifier.
+func GenAIDataSourceID(val string) attribute.KeyValue {
+ return GenAIDataSourceIDKey.String(val)
+}
+
+// GenAIOpenAIResponseServiceTier returns an attribute KeyValue conforming to the
+// "gen_ai.openai.response.service_tier" semantic conventions. It represents the
+// service tier used for the response.
+func GenAIOpenAIResponseServiceTier(val string) attribute.KeyValue {
+ return GenAIOpenAIResponseServiceTierKey.String(val)
+}
+
+// GenAIOpenAIResponseSystemFingerprint returns an attribute KeyValue conforming
+// to the "gen_ai.openai.response.system_fingerprint" semantic conventions. It
+// represents a fingerprint to track any eventual change in the Generative AI
+// environment.
+func GenAIOpenAIResponseSystemFingerprint(val string) attribute.KeyValue {
+ return GenAIOpenAIResponseSystemFingerprintKey.String(val)
+}
+
+// GenAIRequestChoiceCount returns an attribute KeyValue conforming to the
+// "gen_ai.request.choice.count" semantic conventions. It represents the target
+// number of candidate completions to return.
+func GenAIRequestChoiceCount(val int) attribute.KeyValue {
+ return GenAIRequestChoiceCountKey.Int(val)
+}
+
+// GenAIRequestEncodingFormats returns an attribute KeyValue conforming to the
+// "gen_ai.request.encoding_formats" semantic conventions. It represents the
+// encoding formats requested in an embeddings operation, if specified.
+func GenAIRequestEncodingFormats(val ...string) attribute.KeyValue {
+ return GenAIRequestEncodingFormatsKey.StringSlice(val)
+}
+
+// GenAIRequestFrequencyPenalty returns an attribute KeyValue conforming to the
+// "gen_ai.request.frequency_penalty" semantic conventions. It represents the
+// frequency penalty setting for the GenAI request.
+func GenAIRequestFrequencyPenalty(val float64) attribute.KeyValue {
+ return GenAIRequestFrequencyPenaltyKey.Float64(val)
+}
+
+// GenAIRequestMaxTokens returns an attribute KeyValue conforming to the
+// "gen_ai.request.max_tokens" semantic conventions. It represents the maximum
+// number of tokens the model generates for a request.
+func GenAIRequestMaxTokens(val int) attribute.KeyValue {
+ return GenAIRequestMaxTokensKey.Int(val)
+}
+
+// GenAIRequestModel returns an attribute KeyValue conforming to the
+// "gen_ai.request.model" semantic conventions. It represents the name of the
+// GenAI model a request is being made to.
+func GenAIRequestModel(val string) attribute.KeyValue {
+ return GenAIRequestModelKey.String(val)
+}
+
+// GenAIRequestPresencePenalty returns an attribute KeyValue conforming to the
+// "gen_ai.request.presence_penalty" semantic conventions. It represents the
+// presence penalty setting for the GenAI request.
+func GenAIRequestPresencePenalty(val float64) attribute.KeyValue {
+ return GenAIRequestPresencePenaltyKey.Float64(val)
+}
+
+// GenAIRequestSeed returns an attribute KeyValue conforming to the
+// "gen_ai.request.seed" semantic conventions. It represents the requests with
+// same seed value more likely to return same result.
+func GenAIRequestSeed(val int) attribute.KeyValue {
+ return GenAIRequestSeedKey.Int(val)
+}
+
+// GenAIRequestStopSequences returns an attribute KeyValue conforming to the
+// "gen_ai.request.stop_sequences" semantic conventions. It represents the list
+// of sequences that the model will use to stop generating further tokens.
+func GenAIRequestStopSequences(val ...string) attribute.KeyValue {
+ return GenAIRequestStopSequencesKey.StringSlice(val)
+}
+
+// GenAIRequestTemperature returns an attribute KeyValue conforming to the
+// "gen_ai.request.temperature" semantic conventions. It represents the
+// temperature setting for the GenAI request.
+func GenAIRequestTemperature(val float64) attribute.KeyValue {
+ return GenAIRequestTemperatureKey.Float64(val)
+}
+
+// GenAIRequestTopK returns an attribute KeyValue conforming to the
+// "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling
+// setting for the GenAI request.
+func GenAIRequestTopK(val float64) attribute.KeyValue {
+ return GenAIRequestTopKKey.Float64(val)
+}
+
+// GenAIRequestTopP returns an attribute KeyValue conforming to the
+// "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling
+// setting for the GenAI request.
+func GenAIRequestTopP(val float64) attribute.KeyValue {
+ return GenAIRequestTopPKey.Float64(val)
+}
+
+// GenAIResponseFinishReasons returns an attribute KeyValue conforming to the
+// "gen_ai.response.finish_reasons" semantic conventions. It represents the array
+// of reasons the model stopped generating tokens, corresponding to each
+// generation received.
+func GenAIResponseFinishReasons(val ...string) attribute.KeyValue {
+ return GenAIResponseFinishReasonsKey.StringSlice(val)
+}
+
+// GenAIResponseID returns an attribute KeyValue conforming to the
+// "gen_ai.response.id" semantic conventions. It represents the unique identifier
+// for the completion.
+func GenAIResponseID(val string) attribute.KeyValue {
+ return GenAIResponseIDKey.String(val)
+}
+
+// GenAIResponseModel returns an attribute KeyValue conforming to the
+// "gen_ai.response.model" semantic conventions. It represents the name of the
+// model that generated the response.
+func GenAIResponseModel(val string) attribute.KeyValue {
+ return GenAIResponseModelKey.String(val)
+}
+
+// GenAIToolCallID returns an attribute KeyValue conforming to the
+// "gen_ai.tool.call.id" semantic conventions. It represents the tool call
+// identifier.
+func GenAIToolCallID(val string) attribute.KeyValue {
+ return GenAIToolCallIDKey.String(val)
+}
+
+// GenAIToolDescription returns an attribute KeyValue conforming to the
+// "gen_ai.tool.description" semantic conventions. It represents the tool
+// description.
+func GenAIToolDescription(val string) attribute.KeyValue {
+ return GenAIToolDescriptionKey.String(val)
+}
+
+// GenAIToolName returns an attribute KeyValue conforming to the
+// "gen_ai.tool.name" semantic conventions. It represents the name of the tool
+// utilized by the agent.
+func GenAIToolName(val string) attribute.KeyValue {
+ return GenAIToolNameKey.String(val)
+}
+
+// GenAIToolType returns an attribute KeyValue conforming to the
+// "gen_ai.tool.type" semantic conventions. It represents the type of the tool
+// utilized by the agent.
+func GenAIToolType(val string) attribute.KeyValue {
+ return GenAIToolTypeKey.String(val)
+}
+
+// GenAIUsageInputTokens returns an attribute KeyValue conforming to the
+// "gen_ai.usage.input_tokens" semantic conventions. It represents the number of
+// tokens used in the GenAI input (prompt).
+func GenAIUsageInputTokens(val int) attribute.KeyValue {
+ return GenAIUsageInputTokensKey.Int(val)
+}
+
+// GenAIUsageOutputTokens returns an attribute KeyValue conforming to the
+// "gen_ai.usage.output_tokens" semantic conventions. It represents the number of
+// tokens used in the GenAI response (completion).
+func GenAIUsageOutputTokens(val int) attribute.KeyValue {
+ return GenAIUsageOutputTokensKey.Int(val)
+}
+
+// Enum values for gen_ai.openai.request.service_tier
+var (
+ // The system will utilize scale tier credits until they are exhausted.
+ // Stability: development
+ GenAIOpenAIRequestServiceTierAuto = GenAIOpenAIRequestServiceTierKey.String("auto")
+ // The system will utilize the default scale tier.
+ // Stability: development
+ GenAIOpenAIRequestServiceTierDefault = GenAIOpenAIRequestServiceTierKey.String("default")
+)
+
+// Enum values for gen_ai.operation.name
+var (
+ // Chat completion operation such as [OpenAI Chat API]
+ // Stability: development
+ //
+ // [OpenAI Chat API]: https://platform.openai.com/docs/api-reference/chat
+ GenAIOperationNameChat = GenAIOperationNameKey.String("chat")
+ // Multimodal content generation operation such as [Gemini Generate Content]
+ // Stability: development
+ //
+ // [Gemini Generate Content]: https://ai.google.dev/api/generate-content
+ GenAIOperationNameGenerateContent = GenAIOperationNameKey.String("generate_content")
+ // Text completions operation such as [OpenAI Completions API (Legacy)]
+ // Stability: development
+ //
+ // [OpenAI Completions API (Legacy)]: https://platform.openai.com/docs/api-reference/completions
+ GenAIOperationNameTextCompletion = GenAIOperationNameKey.String("text_completion")
+ // Embeddings operation such as [OpenAI Create embeddings API]
+ // Stability: development
+ //
+ // [OpenAI Create embeddings API]: https://platform.openai.com/docs/api-reference/embeddings/create
+ GenAIOperationNameEmbeddings = GenAIOperationNameKey.String("embeddings")
+ // Create GenAI agent
+ // Stability: development
+ GenAIOperationNameCreateAgent = GenAIOperationNameKey.String("create_agent")
+ // Invoke GenAI agent
+ // Stability: development
+ GenAIOperationNameInvokeAgent = GenAIOperationNameKey.String("invoke_agent")
+ // Execute a tool
+ // Stability: development
+ GenAIOperationNameExecuteTool = GenAIOperationNameKey.String("execute_tool")
+)
+
+// Enum values for gen_ai.output.type
+var (
+ // Plain text
+ // Stability: development
+ GenAIOutputTypeText = GenAIOutputTypeKey.String("text")
+ // JSON object with known or unknown schema
+ // Stability: development
+ GenAIOutputTypeJSON = GenAIOutputTypeKey.String("json")
+ // Image
+ // Stability: development
+ GenAIOutputTypeImage = GenAIOutputTypeKey.String("image")
+ // Speech
+ // Stability: development
+ GenAIOutputTypeSpeech = GenAIOutputTypeKey.String("speech")
+)
+
+// Enum values for gen_ai.system
+var (
+ // OpenAI
+ // Stability: development
+ GenAISystemOpenAI = GenAISystemKey.String("openai")
+ // Any Google generative AI endpoint
+ // Stability: development
+ GenAISystemGCPGenAI = GenAISystemKey.String("gcp.gen_ai")
+ // Vertex AI
+ // Stability: development
+ GenAISystemGCPVertexAI = GenAISystemKey.String("gcp.vertex_ai")
+ // Gemini
+ // Stability: development
+ GenAISystemGCPGemini = GenAISystemKey.String("gcp.gemini")
+ // Deprecated: Use 'gcp.vertex_ai' instead.
+ GenAISystemVertexAI = GenAISystemKey.String("vertex_ai")
+ // Deprecated: Use 'gcp.gemini' instead.
+ GenAISystemGemini = GenAISystemKey.String("gemini")
+ // Anthropic
+ // Stability: development
+ GenAISystemAnthropic = GenAISystemKey.String("anthropic")
+ // Cohere
+ // Stability: development
+ GenAISystemCohere = GenAISystemKey.String("cohere")
+ // Azure AI Inference
+ // Stability: development
+ GenAISystemAzAIInference = GenAISystemKey.String("az.ai.inference")
+ // Azure OpenAI
+ // Stability: development
+ GenAISystemAzAIOpenAI = GenAISystemKey.String("az.ai.openai")
+ // IBM Watsonx AI
+ // Stability: development
+ GenAISystemIBMWatsonxAI = GenAISystemKey.String("ibm.watsonx.ai")
+ // AWS Bedrock
+ // Stability: development
+ GenAISystemAWSBedrock = GenAISystemKey.String("aws.bedrock")
+ // Perplexity
+ // Stability: development
+ GenAISystemPerplexity = GenAISystemKey.String("perplexity")
+ // xAI
+ // Stability: development
+ GenAISystemXai = GenAISystemKey.String("xai")
+ // DeepSeek
+ // Stability: development
+ GenAISystemDeepseek = GenAISystemKey.String("deepseek")
+ // Groq
+ // Stability: development
+ GenAISystemGroq = GenAISystemKey.String("groq")
+ // Mistral AI
+ // Stability: development
+ GenAISystemMistralAI = GenAISystemKey.String("mistral_ai")
+)
+
+// Enum values for gen_ai.token.type
+var (
+ // Input tokens (prompt, input, etc.)
+ // Stability: development
+ GenAITokenTypeInput = GenAITokenTypeKey.String("input")
+ // Deprecated: Replaced by `output`.
+ GenAITokenTypeCompletion = GenAITokenTypeKey.String("output")
+ // Output tokens (completion, response, etc.)
+ // Stability: development
+ GenAITokenTypeOutput = GenAITokenTypeKey.String("output")
+)
+
+// Namespace: geo
+const (
+ // GeoContinentCodeKey is the attribute Key conforming to the
+ // "geo.continent.code" semantic conventions. It represents the two-letter code
+ // representing continent’s name.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ GeoContinentCodeKey = attribute.Key("geo.continent.code")
+
+ // GeoCountryISOCodeKey is the attribute Key conforming to the
+ // "geo.country.iso_code" semantic conventions. It represents the two-letter ISO
+ // Country Code ([ISO 3166-1 alpha2]).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CA"
+ //
+ // [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes
+ GeoCountryISOCodeKey = attribute.Key("geo.country.iso_code")
+
+ // GeoLocalityNameKey is the attribute Key conforming to the "geo.locality.name"
+ // semantic conventions. It represents the locality name. Represents the name of
+ // a city, town, village, or similar populated place.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Montreal", "Berlin"
+ GeoLocalityNameKey = attribute.Key("geo.locality.name")
+
+ // GeoLocationLatKey is the attribute Key conforming to the "geo.location.lat"
+ // semantic conventions. It represents the latitude of the geo location in
+ // [WGS84].
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 45.505918
+ //
+ // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+ GeoLocationLatKey = attribute.Key("geo.location.lat")
+
+ // GeoLocationLonKey is the attribute Key conforming to the "geo.location.lon"
+ // semantic conventions. It represents the longitude of the geo location in
+ // [WGS84].
+ //
+ // Type: double
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: -73.61483
+ //
+ // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+ GeoLocationLonKey = attribute.Key("geo.location.lon")
+
+ // GeoPostalCodeKey is the attribute Key conforming to the "geo.postal_code"
+ // semantic conventions. It represents the postal code associated with the
+ // location. Values appropriate for this field may also be known as a postcode
+ // or ZIP code and will vary widely from country to country.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "94040"
+ GeoPostalCodeKey = attribute.Key("geo.postal_code")
+
+ // GeoRegionISOCodeKey is the attribute Key conforming to the
+ // "geo.region.iso_code" semantic conventions. It represents the region ISO code
+ // ([ISO 3166-2]).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CA-QC"
+ //
+ // [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2
+ GeoRegionISOCodeKey = attribute.Key("geo.region.iso_code")
+)
+
+// GeoCountryISOCode returns an attribute KeyValue conforming to the
+// "geo.country.iso_code" semantic conventions. It represents the two-letter ISO
+// Country Code ([ISO 3166-1 alpha2]).
+//
+// [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes
+func GeoCountryISOCode(val string) attribute.KeyValue {
+ return GeoCountryISOCodeKey.String(val)
+}
+
+// GeoLocalityName returns an attribute KeyValue conforming to the
+// "geo.locality.name" semantic conventions. It represents the locality name.
+// Represents the name of a city, town, village, or similar populated place.
+func GeoLocalityName(val string) attribute.KeyValue {
+ return GeoLocalityNameKey.String(val)
+}
+
+// GeoLocationLat returns an attribute KeyValue conforming to the
+// "geo.location.lat" semantic conventions. It represents the latitude of the geo
+// location in [WGS84].
+//
+// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+func GeoLocationLat(val float64) attribute.KeyValue {
+ return GeoLocationLatKey.Float64(val)
+}
+
+// GeoLocationLon returns an attribute KeyValue conforming to the
+// "geo.location.lon" semantic conventions. It represents the longitude of the
+// geo location in [WGS84].
+//
+// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84
+func GeoLocationLon(val float64) attribute.KeyValue {
+ return GeoLocationLonKey.Float64(val)
+}
+
+// GeoPostalCode returns an attribute KeyValue conforming to the
+// "geo.postal_code" semantic conventions. It represents the postal code
+// associated with the location. Values appropriate for this field may also be
+// known as a postcode or ZIP code and will vary widely from country to country.
+func GeoPostalCode(val string) attribute.KeyValue {
+ return GeoPostalCodeKey.String(val)
+}
+
+// GeoRegionISOCode returns an attribute KeyValue conforming to the
+// "geo.region.iso_code" semantic conventions. It represents the region ISO code
+// ([ISO 3166-2]).
+//
+// [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2
+func GeoRegionISOCode(val string) attribute.KeyValue {
+ return GeoRegionISOCodeKey.String(val)
+}
+
+// Enum values for geo.continent.code
+var (
+ // Africa
+ // Stability: development
+ GeoContinentCodeAf = GeoContinentCodeKey.String("AF")
+ // Antarctica
+ // Stability: development
+ GeoContinentCodeAn = GeoContinentCodeKey.String("AN")
+ // Asia
+ // Stability: development
+ GeoContinentCodeAs = GeoContinentCodeKey.String("AS")
+ // Europe
+ // Stability: development
+ GeoContinentCodeEu = GeoContinentCodeKey.String("EU")
+ // North America
+ // Stability: development
+ GeoContinentCodeNa = GeoContinentCodeKey.String("NA")
+ // Oceania
+ // Stability: development
+ GeoContinentCodeOc = GeoContinentCodeKey.String("OC")
+ // South America
+ // Stability: development
+ GeoContinentCodeSa = GeoContinentCodeKey.String("SA")
+)
+
+// Namespace: go
+const (
+ // GoMemoryTypeKey is the attribute Key conforming to the "go.memory.type"
+ // semantic conventions. It represents the type of memory.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "other", "stack"
+ GoMemoryTypeKey = attribute.Key("go.memory.type")
+)
+
+// Enum values for go.memory.type
+var (
+ // Memory allocated from the heap that is reserved for stack space, whether or
+ // not it is currently in-use.
+ // Stability: development
+ GoMemoryTypeStack = GoMemoryTypeKey.String("stack")
+ // Memory used by the Go runtime, excluding other categories of memory usage
+ // described in this enumeration.
+ // Stability: development
+ GoMemoryTypeOther = GoMemoryTypeKey.String("other")
+)
+
+// Namespace: graphql
+const (
+ // GraphQLDocumentKey is the attribute Key conforming to the "graphql.document"
+ // semantic conventions. It represents the GraphQL document being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: query findBookById { bookById(id: ?) { name } }
+ // Note: The value may be sanitized to exclude sensitive information.
+ GraphQLDocumentKey = attribute.Key("graphql.document")
+
+ // GraphQLOperationNameKey is the attribute Key conforming to the
+ // "graphql.operation.name" semantic conventions. It represents the name of the
+ // operation being executed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: findBookById
+ GraphQLOperationNameKey = attribute.Key("graphql.operation.name")
+
+ // GraphQLOperationTypeKey is the attribute Key conforming to the
+ // "graphql.operation.type" semantic conventions. It represents the type of the
+ // operation being executed.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "query", "mutation", "subscription"
+ GraphQLOperationTypeKey = attribute.Key("graphql.operation.type")
+)
+
+// GraphQLDocument returns an attribute KeyValue conforming to the
+// "graphql.document" semantic conventions. It represents the GraphQL document
+// being executed.
+func GraphQLDocument(val string) attribute.KeyValue {
+ return GraphQLDocumentKey.String(val)
+}
+
+// GraphQLOperationName returns an attribute KeyValue conforming to the
+// "graphql.operation.name" semantic conventions. It represents the name of the
+// operation being executed.
+func GraphQLOperationName(val string) attribute.KeyValue {
+ return GraphQLOperationNameKey.String(val)
+}
+
+// Enum values for graphql.operation.type
+var (
+ // GraphQL query
+ // Stability: development
+ GraphQLOperationTypeQuery = GraphQLOperationTypeKey.String("query")
+ // GraphQL mutation
+ // Stability: development
+ GraphQLOperationTypeMutation = GraphQLOperationTypeKey.String("mutation")
+ // GraphQL subscription
+ // Stability: development
+ GraphQLOperationTypeSubscription = GraphQLOperationTypeKey.String("subscription")
+)
+
+// Namespace: heroku
+const (
+ // HerokuAppIDKey is the attribute Key conforming to the "heroku.app.id"
+ // semantic conventions. It represents the unique identifier for the
+ // application.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2daa2797-e42b-4624-9322-ec3f968df4da"
+ HerokuAppIDKey = attribute.Key("heroku.app.id")
+
+ // HerokuReleaseCommitKey is the attribute Key conforming to the
+ // "heroku.release.commit" semantic conventions. It represents the commit hash
+ // for the current release.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "e6134959463efd8966b20e75b913cafe3f5ec"
+ HerokuReleaseCommitKey = attribute.Key("heroku.release.commit")
+
+ // HerokuReleaseCreationTimestampKey is the attribute Key conforming to the
+ // "heroku.release.creation_timestamp" semantic conventions. It represents the
+ // time and date the release was created.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2022-10-23T18:00:42Z"
+ HerokuReleaseCreationTimestampKey = attribute.Key("heroku.release.creation_timestamp")
+)
+
+// HerokuAppID returns an attribute KeyValue conforming to the "heroku.app.id"
+// semantic conventions. It represents the unique identifier for the application.
+func HerokuAppID(val string) attribute.KeyValue {
+ return HerokuAppIDKey.String(val)
+}
+
+// HerokuReleaseCommit returns an attribute KeyValue conforming to the
+// "heroku.release.commit" semantic conventions. It represents the commit hash
+// for the current release.
+func HerokuReleaseCommit(val string) attribute.KeyValue {
+ return HerokuReleaseCommitKey.String(val)
+}
+
+// HerokuReleaseCreationTimestamp returns an attribute KeyValue conforming to the
+// "heroku.release.creation_timestamp" semantic conventions. It represents the
+// time and date the release was created.
+func HerokuReleaseCreationTimestamp(val string) attribute.KeyValue {
+ return HerokuReleaseCreationTimestampKey.String(val)
+}
+
+// Namespace: host
+const (
+ // HostArchKey is the attribute Key conforming to the "host.arch" semantic
+ // conventions. It represents the CPU architecture the host system is running
+ // on.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ HostArchKey = attribute.Key("host.arch")
+
+ // HostCPUCacheL2SizeKey is the attribute Key conforming to the
+ // "host.cpu.cache.l2.size" semantic conventions. It represents the amount of
+ // level 2 memory cache available to the processor (in Bytes).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 12288000
+ HostCPUCacheL2SizeKey = attribute.Key("host.cpu.cache.l2.size")
+
+ // HostCPUFamilyKey is the attribute Key conforming to the "host.cpu.family"
+ // semantic conventions. It represents the family or generation of the CPU.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "6", "PA-RISC 1.1e"
+ HostCPUFamilyKey = attribute.Key("host.cpu.family")
+
+ // HostCPUModelIDKey is the attribute Key conforming to the "host.cpu.model.id"
+ // semantic conventions. It represents the model identifier. It provides more
+ // granular information about the CPU, distinguishing it from other CPUs within
+ // the same family.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "6", "9000/778/B180L"
+ HostCPUModelIDKey = attribute.Key("host.cpu.model.id")
+
+ // HostCPUModelNameKey is the attribute Key conforming to the
+ // "host.cpu.model.name" semantic conventions. It represents the model
+ // designation of the processor.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "11th Gen Intel(R) Core(TM) i7-1185G7 @ 3.00GHz"
+ HostCPUModelNameKey = attribute.Key("host.cpu.model.name")
+
+ // HostCPUSteppingKey is the attribute Key conforming to the "host.cpu.stepping"
+ // semantic conventions. It represents the stepping or core revisions.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1", "r1p1"
+ HostCPUSteppingKey = attribute.Key("host.cpu.stepping")
+
+ // HostCPUVendorIDKey is the attribute Key conforming to the
+ // "host.cpu.vendor.id" semantic conventions. It represents the processor
+ // manufacturer identifier. A maximum 12-character string.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "GenuineIntel"
+ // Note: [CPUID] command returns the vendor ID string in EBX, EDX and ECX
+ // registers. Writing these to memory in this order results in a 12-character
+ // string.
+ //
+ // [CPUID]: https://wiki.osdev.org/CPUID
+ HostCPUVendorIDKey = attribute.Key("host.cpu.vendor.id")
+
+ // HostIDKey is the attribute Key conforming to the "host.id" semantic
+ // conventions. It represents the unique host ID. For Cloud, this must be the
+ // instance_id assigned by the cloud provider. For non-containerized systems,
+ // this should be the `machine-id`. See the table below for the sources to use
+ // to determine the `machine-id` based on operating system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "fdbf79e8af94cb7f9e8df36789187052"
+ HostIDKey = attribute.Key("host.id")
+
+ // HostImageIDKey is the attribute Key conforming to the "host.image.id"
+ // semantic conventions. It represents the VM image ID or host OS image ID. For
+ // Cloud, this value is from the provider.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ami-07b06b442921831e5"
+ HostImageIDKey = attribute.Key("host.image.id")
+
+ // HostImageNameKey is the attribute Key conforming to the "host.image.name"
+ // semantic conventions. It represents the name of the VM image or OS install
+ // the host was instantiated from.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "infra-ami-eks-worker-node-7d4ec78312", "CentOS-8-x86_64-1905"
+ HostImageNameKey = attribute.Key("host.image.name")
+
+ // HostImageVersionKey is the attribute Key conforming to the
+ // "host.image.version" semantic conventions. It represents the version string
+ // of the VM image or host OS as defined in [Version Attributes].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0.1"
+ //
+ // [Version Attributes]: /docs/resource/README.md#version-attributes
+ HostImageVersionKey = attribute.Key("host.image.version")
+
+ // HostIPKey is the attribute Key conforming to the "host.ip" semantic
+ // conventions. It represents the available IP addresses of the host, excluding
+ // loopback interfaces.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "192.168.1.140", "fe80::abc2:4a28:737a:609e"
+ // Note: IPv4 Addresses MUST be specified in dotted-quad notation. IPv6
+ // addresses MUST be specified in the [RFC 5952] format.
+ //
+ // [RFC 5952]: https://www.rfc-editor.org/rfc/rfc5952.html
+ HostIPKey = attribute.Key("host.ip")
+
+ // HostMacKey is the attribute Key conforming to the "host.mac" semantic
+ // conventions. It represents the available MAC addresses of the host, excluding
+ // loopback interfaces.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "AC-DE-48-23-45-67", "AC-DE-48-23-45-67-01-9F"
+ // Note: MAC Addresses MUST be represented in [IEEE RA hexadecimal form]: as
+ // hyphen-separated octets in uppercase hexadecimal form from most to least
+ // significant.
+ //
+ // [IEEE RA hexadecimal form]: https://standards.ieee.org/wp-content/uploads/import/documents/tutorials/eui.pdf
+ HostMacKey = attribute.Key("host.mac")
+
+ // HostNameKey is the attribute Key conforming to the "host.name" semantic
+ // conventions. It represents the name of the host. On Unix systems, it may
+ // contain what the hostname command returns, or the fully qualified hostname,
+ // or another name specified by the user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-test"
+ HostNameKey = attribute.Key("host.name")
+
+ // HostTypeKey is the attribute Key conforming to the "host.type" semantic
+ // conventions. It represents the type of host. For Cloud, this must be the
+ // machine type.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "n1-standard-1"
+ HostTypeKey = attribute.Key("host.type")
+)
+
+// HostCPUCacheL2Size returns an attribute KeyValue conforming to the
+// "host.cpu.cache.l2.size" semantic conventions. It represents the amount of
+// level 2 memory cache available to the processor (in Bytes).
+func HostCPUCacheL2Size(val int) attribute.KeyValue {
+ return HostCPUCacheL2SizeKey.Int(val)
+}
+
+// HostCPUFamily returns an attribute KeyValue conforming to the
+// "host.cpu.family" semantic conventions. It represents the family or generation
+// of the CPU.
+func HostCPUFamily(val string) attribute.KeyValue {
+ return HostCPUFamilyKey.String(val)
+}
+
+// HostCPUModelID returns an attribute KeyValue conforming to the
+// "host.cpu.model.id" semantic conventions. It represents the model identifier.
+// It provides more granular information about the CPU, distinguishing it from
+// other CPUs within the same family.
+func HostCPUModelID(val string) attribute.KeyValue {
+ return HostCPUModelIDKey.String(val)
+}
+
+// HostCPUModelName returns an attribute KeyValue conforming to the
+// "host.cpu.model.name" semantic conventions. It represents the model
+// designation of the processor.
+func HostCPUModelName(val string) attribute.KeyValue {
+ return HostCPUModelNameKey.String(val)
+}
+
+// HostCPUStepping returns an attribute KeyValue conforming to the
+// "host.cpu.stepping" semantic conventions. It represents the stepping or core
+// revisions.
+func HostCPUStepping(val string) attribute.KeyValue {
+ return HostCPUSteppingKey.String(val)
+}
+
+// HostCPUVendorID returns an attribute KeyValue conforming to the
+// "host.cpu.vendor.id" semantic conventions. It represents the processor
+// manufacturer identifier. A maximum 12-character string.
+func HostCPUVendorID(val string) attribute.KeyValue {
+ return HostCPUVendorIDKey.String(val)
+}
+
+// HostID returns an attribute KeyValue conforming to the "host.id" semantic
+// conventions. It represents the unique host ID. For Cloud, this must be the
+// instance_id assigned by the cloud provider. For non-containerized systems,
+// this should be the `machine-id`. See the table below for the sources to use to
+// determine the `machine-id` based on operating system.
+func HostID(val string) attribute.KeyValue {
+ return HostIDKey.String(val)
+}
+
+// HostImageID returns an attribute KeyValue conforming to the "host.image.id"
+// semantic conventions. It represents the VM image ID or host OS image ID. For
+// Cloud, this value is from the provider.
+func HostImageID(val string) attribute.KeyValue {
+ return HostImageIDKey.String(val)
+}
+
+// HostImageName returns an attribute KeyValue conforming to the
+// "host.image.name" semantic conventions. It represents the name of the VM image
+// or OS install the host was instantiated from.
+func HostImageName(val string) attribute.KeyValue {
+ return HostImageNameKey.String(val)
+}
+
+// HostImageVersion returns an attribute KeyValue conforming to the
+// "host.image.version" semantic conventions. It represents the version string of
+// the VM image or host OS as defined in [Version Attributes].
+//
+// [Version Attributes]: /docs/resource/README.md#version-attributes
+func HostImageVersion(val string) attribute.KeyValue {
+ return HostImageVersionKey.String(val)
+}
+
+// HostIP returns an attribute KeyValue conforming to the "host.ip" semantic
+// conventions. It represents the available IP addresses of the host, excluding
+// loopback interfaces.
+func HostIP(val ...string) attribute.KeyValue {
+ return HostIPKey.StringSlice(val)
+}
+
+// HostMac returns an attribute KeyValue conforming to the "host.mac" semantic
+// conventions. It represents the available MAC addresses of the host, excluding
+// loopback interfaces.
+func HostMac(val ...string) attribute.KeyValue {
+ return HostMacKey.StringSlice(val)
+}
+
+// HostName returns an attribute KeyValue conforming to the "host.name" semantic
+// conventions. It represents the name of the host. On Unix systems, it may
+// contain what the hostname command returns, or the fully qualified hostname, or
+// another name specified by the user.
+func HostName(val string) attribute.KeyValue {
+ return HostNameKey.String(val)
+}
+
+// HostType returns an attribute KeyValue conforming to the "host.type" semantic
+// conventions. It represents the type of host. For Cloud, this must be the
+// machine type.
+func HostType(val string) attribute.KeyValue {
+ return HostTypeKey.String(val)
+}
+
+// Enum values for host.arch
+var (
+ // AMD64
+ // Stability: development
+ HostArchAMD64 = HostArchKey.String("amd64")
+ // ARM32
+ // Stability: development
+ HostArchARM32 = HostArchKey.String("arm32")
+ // ARM64
+ // Stability: development
+ HostArchARM64 = HostArchKey.String("arm64")
+ // Itanium
+ // Stability: development
+ HostArchIA64 = HostArchKey.String("ia64")
+ // 32-bit PowerPC
+ // Stability: development
+ HostArchPPC32 = HostArchKey.String("ppc32")
+ // 64-bit PowerPC
+ // Stability: development
+ HostArchPPC64 = HostArchKey.String("ppc64")
+ // IBM z/Architecture
+ // Stability: development
+ HostArchS390x = HostArchKey.String("s390x")
+ // 32-bit x86
+ // Stability: development
+ HostArchX86 = HostArchKey.String("x86")
+)
+
+// Namespace: http
+const (
+ // HTTPConnectionStateKey is the attribute Key conforming to the
+ // "http.connection.state" semantic conventions. It represents the state of the
+ // HTTP connection in the HTTP connection pool.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "active", "idle"
+ HTTPConnectionStateKey = attribute.Key("http.connection.state")
+
+ // HTTPRequestBodySizeKey is the attribute Key conforming to the
+ // "http.request.body.size" semantic conventions. It represents the size of the
+ // request payload body in bytes. This is the number of bytes transferred
+ // excluding headers and is often, but not always, present as the
+ // [Content-Length] header. For requests using transport encoding, this should
+ // be the compressed size.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+ HTTPRequestBodySizeKey = attribute.Key("http.request.body.size")
+
+ // HTTPRequestMethodKey is the attribute Key conforming to the
+ // "http.request.method" semantic conventions. It represents the HTTP request
+ // method.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "GET", "POST", "HEAD"
+ // Note: HTTP request method value SHOULD be "known" to the instrumentation.
+ // By default, this convention defines "known" methods as the ones listed in
+ // [RFC9110]
+ // and the PATCH method defined in [RFC5789].
+ //
+ // If the HTTP request method is not known to instrumentation, it MUST set the
+ // `http.request.method` attribute to `_OTHER`.
+ //
+ // If the HTTP instrumentation could end up converting valid HTTP request
+ // methods to `_OTHER`, then it MUST provide a way to override
+ // the list of known HTTP methods. If this override is done via environment
+ // variable, then the environment variable MUST be named
+ // OTEL_INSTRUMENTATION_HTTP_KNOWN_METHODS and support a comma-separated list of
+ // case-sensitive known HTTP methods
+ // (this list MUST be a full override of the default known method, it is not a
+ // list of known methods in addition to the defaults).
+ //
+ // HTTP method names are case-sensitive and `http.request.method` attribute
+ // value MUST match a known HTTP method name exactly.
+ // Instrumentations for specific web frameworks that consider HTTP methods to be
+ // case insensitive, SHOULD populate a canonical equivalent.
+ // Tracing instrumentations that do so, MUST also set
+ // `http.request.method_original` to the original value.
+ //
+ // [RFC9110]: https://www.rfc-editor.org/rfc/rfc9110.html#name-methods
+ // [RFC5789]: https://www.rfc-editor.org/rfc/rfc5789.html
+ HTTPRequestMethodKey = attribute.Key("http.request.method")
+
+ // HTTPRequestMethodOriginalKey is the attribute Key conforming to the
+ // "http.request.method_original" semantic conventions. It represents the
+ // original HTTP method sent by the client in the request line.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "GeT", "ACL", "foo"
+ HTTPRequestMethodOriginalKey = attribute.Key("http.request.method_original")
+
+ // HTTPRequestResendCountKey is the attribute Key conforming to the
+ // "http.request.resend_count" semantic conventions. It represents the ordinal
+ // number of request resending attempt (for any reason, including redirects).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Note: The resend count SHOULD be updated each time an HTTP request gets
+ // resent by the client, regardless of what was the cause of the resending (e.g.
+ // redirection, authorization failure, 503 Server Unavailable, network issues,
+ // or any other).
+ HTTPRequestResendCountKey = attribute.Key("http.request.resend_count")
+
+ // HTTPRequestSizeKey is the attribute Key conforming to the "http.request.size"
+ // semantic conventions. It represents the total size of the request in bytes.
+ // This should be the total number of bytes sent over the wire, including the
+ // request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, and request
+ // body if any.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ HTTPRequestSizeKey = attribute.Key("http.request.size")
+
+ // HTTPResponseBodySizeKey is the attribute Key conforming to the
+ // "http.response.body.size" semantic conventions. It represents the size of the
+ // response payload body in bytes. This is the number of bytes transferred
+ // excluding headers and is often, but not always, present as the
+ // [Content-Length] header. For requests using transport encoding, this should
+ // be the compressed size.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+ HTTPResponseBodySizeKey = attribute.Key("http.response.body.size")
+
+ // HTTPResponseSizeKey is the attribute Key conforming to the
+ // "http.response.size" semantic conventions. It represents the total size of
+ // the response in bytes. This should be the total number of bytes sent over the
+ // wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3),
+ // headers, and response body and trailers if any.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ HTTPResponseSizeKey = attribute.Key("http.response.size")
+
+ // HTTPResponseStatusCodeKey is the attribute Key conforming to the
+ // "http.response.status_code" semantic conventions. It represents the
+ // [HTTP response status code].
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 200
+ //
+ // [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6
+ HTTPResponseStatusCodeKey = attribute.Key("http.response.status_code")
+
+ // HTTPRouteKey is the attribute Key conforming to the "http.route" semantic
+ // conventions. It represents the matched route, that is, the path template in
+ // the format used by the respective server framework.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "/users/:userID?", "{controller}/{action}/{id?}"
+ // Note: MUST NOT be populated when this is not supported by the HTTP server
+ // framework as the route attribute should have low-cardinality and the URI path
+ // can NOT substitute it.
+ // SHOULD include the [application root] if there is one.
+ //
+ // [application root]: /docs/http/http-spans.md#http-server-definitions
+ HTTPRouteKey = attribute.Key("http.route")
+)
+
+// HTTPRequestBodySize returns an attribute KeyValue conforming to the
+// "http.request.body.size" semantic conventions. It represents the size of the
+// request payload body in bytes. This is the number of bytes transferred
+// excluding headers and is often, but not always, present as the
+// [Content-Length] header. For requests using transport encoding, this should be
+// the compressed size.
+//
+// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+func HTTPRequestBodySize(val int) attribute.KeyValue {
+ return HTTPRequestBodySizeKey.Int(val)
+}
+
+// HTTPRequestMethodOriginal returns an attribute KeyValue conforming to the
+// "http.request.method_original" semantic conventions. It represents the
+// original HTTP method sent by the client in the request line.
+func HTTPRequestMethodOriginal(val string) attribute.KeyValue {
+ return HTTPRequestMethodOriginalKey.String(val)
+}
+
+// HTTPRequestResendCount returns an attribute KeyValue conforming to the
+// "http.request.resend_count" semantic conventions. It represents the ordinal
+// number of request resending attempt (for any reason, including redirects).
+func HTTPRequestResendCount(val int) attribute.KeyValue {
+ return HTTPRequestResendCountKey.Int(val)
+}
+
+// HTTPRequestSize returns an attribute KeyValue conforming to the
+// "http.request.size" semantic conventions. It represents the total size of the
+// request in bytes. This should be the total number of bytes sent over the wire,
+// including the request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers,
+// and request body if any.
+func HTTPRequestSize(val int) attribute.KeyValue {
+ return HTTPRequestSizeKey.Int(val)
+}
+
+// HTTPResponseBodySize returns an attribute KeyValue conforming to the
+// "http.response.body.size" semantic conventions. It represents the size of the
+// response payload body in bytes. This is the number of bytes transferred
+// excluding headers and is often, but not always, present as the
+// [Content-Length] header. For requests using transport encoding, this should be
+// the compressed size.
+//
+// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length
+func HTTPResponseBodySize(val int) attribute.KeyValue {
+ return HTTPResponseBodySizeKey.Int(val)
+}
+
+// HTTPResponseSize returns an attribute KeyValue conforming to the
+// "http.response.size" semantic conventions. It represents the total size of the
+// response in bytes. This should be the total number of bytes sent over the
+// wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3),
+// headers, and response body and trailers if any.
+func HTTPResponseSize(val int) attribute.KeyValue {
+ return HTTPResponseSizeKey.Int(val)
+}
+
+// HTTPResponseStatusCode returns an attribute KeyValue conforming to the
+// "http.response.status_code" semantic conventions. It represents the
+// [HTTP response status code].
+//
+// [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6
+func HTTPResponseStatusCode(val int) attribute.KeyValue {
+ return HTTPResponseStatusCodeKey.Int(val)
+}
+
+// HTTPRoute returns an attribute KeyValue conforming to the "http.route"
+// semantic conventions. It represents the matched route, that is, the path
+// template in the format used by the respective server framework.
+func HTTPRoute(val string) attribute.KeyValue {
+ return HTTPRouteKey.String(val)
+}
+
+// Enum values for http.connection.state
+var (
+ // active state.
+ // Stability: development
+ HTTPConnectionStateActive = HTTPConnectionStateKey.String("active")
+ // idle state.
+ // Stability: development
+ HTTPConnectionStateIdle = HTTPConnectionStateKey.String("idle")
+)
+
+// Enum values for http.request.method
+var (
+ // CONNECT method.
+ // Stability: stable
+ HTTPRequestMethodConnect = HTTPRequestMethodKey.String("CONNECT")
+ // DELETE method.
+ // Stability: stable
+ HTTPRequestMethodDelete = HTTPRequestMethodKey.String("DELETE")
+ // GET method.
+ // Stability: stable
+ HTTPRequestMethodGet = HTTPRequestMethodKey.String("GET")
+ // HEAD method.
+ // Stability: stable
+ HTTPRequestMethodHead = HTTPRequestMethodKey.String("HEAD")
+ // OPTIONS method.
+ // Stability: stable
+ HTTPRequestMethodOptions = HTTPRequestMethodKey.String("OPTIONS")
+ // PATCH method.
+ // Stability: stable
+ HTTPRequestMethodPatch = HTTPRequestMethodKey.String("PATCH")
+ // POST method.
+ // Stability: stable
+ HTTPRequestMethodPost = HTTPRequestMethodKey.String("POST")
+ // PUT method.
+ // Stability: stable
+ HTTPRequestMethodPut = HTTPRequestMethodKey.String("PUT")
+ // TRACE method.
+ // Stability: stable
+ HTTPRequestMethodTrace = HTTPRequestMethodKey.String("TRACE")
+ // Any HTTP method that the instrumentation has no prior knowledge of.
+ // Stability: stable
+ HTTPRequestMethodOther = HTTPRequestMethodKey.String("_OTHER")
+)
+
+// Namespace: hw
+const (
+ // HwIDKey is the attribute Key conforming to the "hw.id" semantic conventions.
+ // It represents an identifier for the hardware component, unique within the
+ // monitored host.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "win32battery_battery_testsysa33_1"
+ HwIDKey = attribute.Key("hw.id")
+
+ // HwNameKey is the attribute Key conforming to the "hw.name" semantic
+ // conventions. It represents an easily-recognizable name for the hardware
+ // component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "eth0"
+ HwNameKey = attribute.Key("hw.name")
+
+ // HwParentKey is the attribute Key conforming to the "hw.parent" semantic
+ // conventions. It represents the unique identifier of the parent component
+ // (typically the `hw.id` attribute of the enclosure, or disk controller).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "dellStorage_perc_0"
+ HwParentKey = attribute.Key("hw.parent")
+
+ // HwStateKey is the attribute Key conforming to the "hw.state" semantic
+ // conventions. It represents the current state of the component.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ HwStateKey = attribute.Key("hw.state")
+
+ // HwTypeKey is the attribute Key conforming to the "hw.type" semantic
+ // conventions. It represents the type of the component.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: Describes the category of the hardware component for which `hw.state`
+ // is being reported. For example, `hw.type=temperature` along with
+ // `hw.state=degraded` would indicate that the temperature of the hardware
+ // component has been reported as `degraded`.
+ HwTypeKey = attribute.Key("hw.type")
+)
+
+// HwID returns an attribute KeyValue conforming to the "hw.id" semantic
+// conventions. It represents an identifier for the hardware component, unique
+// within the monitored host.
+func HwID(val string) attribute.KeyValue {
+ return HwIDKey.String(val)
+}
+
+// HwName returns an attribute KeyValue conforming to the "hw.name" semantic
+// conventions. It represents an easily-recognizable name for the hardware
+// component.
+func HwName(val string) attribute.KeyValue {
+ return HwNameKey.String(val)
+}
+
+// HwParent returns an attribute KeyValue conforming to the "hw.parent" semantic
+// conventions. It represents the unique identifier of the parent component
+// (typically the `hw.id` attribute of the enclosure, or disk controller).
+func HwParent(val string) attribute.KeyValue {
+ return HwParentKey.String(val)
+}
+
+// Enum values for hw.state
+var (
+ // Ok
+ // Stability: development
+ HwStateOk = HwStateKey.String("ok")
+ // Degraded
+ // Stability: development
+ HwStateDegraded = HwStateKey.String("degraded")
+ // Failed
+ // Stability: development
+ HwStateFailed = HwStateKey.String("failed")
+)
+
+// Enum values for hw.type
+var (
+ // Battery
+ // Stability: development
+ HwTypeBattery = HwTypeKey.String("battery")
+ // CPU
+ // Stability: development
+ HwTypeCPU = HwTypeKey.String("cpu")
+ // Disk controller
+ // Stability: development
+ HwTypeDiskController = HwTypeKey.String("disk_controller")
+ // Enclosure
+ // Stability: development
+ HwTypeEnclosure = HwTypeKey.String("enclosure")
+ // Fan
+ // Stability: development
+ HwTypeFan = HwTypeKey.String("fan")
+ // GPU
+ // Stability: development
+ HwTypeGpu = HwTypeKey.String("gpu")
+ // Logical disk
+ // Stability: development
+ HwTypeLogicalDisk = HwTypeKey.String("logical_disk")
+ // Memory
+ // Stability: development
+ HwTypeMemory = HwTypeKey.String("memory")
+ // Network
+ // Stability: development
+ HwTypeNetwork = HwTypeKey.String("network")
+ // Physical disk
+ // Stability: development
+ HwTypePhysicalDisk = HwTypeKey.String("physical_disk")
+ // Power supply
+ // Stability: development
+ HwTypePowerSupply = HwTypeKey.String("power_supply")
+ // Tape drive
+ // Stability: development
+ HwTypeTapeDrive = HwTypeKey.String("tape_drive")
+ // Temperature
+ // Stability: development
+ HwTypeTemperature = HwTypeKey.String("temperature")
+ // Voltage
+ // Stability: development
+ HwTypeVoltage = HwTypeKey.String("voltage")
+)
+
+// Namespace: ios
+const (
+ // IOSAppStateKey is the attribute Key conforming to the "ios.app.state"
+ // semantic conventions. It represents the this attribute represents the state
+ // of the application.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: The iOS lifecycle states are defined in the
+ // [UIApplicationDelegate documentation], and from which the `OS terminology`
+ // column values are derived.
+ //
+ // [UIApplicationDelegate documentation]: https://developer.apple.com/documentation/uikit/uiapplicationdelegate
+ IOSAppStateKey = attribute.Key("ios.app.state")
+)
+
+// Enum values for ios.app.state
+var (
+ // The app has become `active`. Associated with UIKit notification
+ // `applicationDidBecomeActive`.
+ //
+ // Stability: development
+ IOSAppStateActive = IOSAppStateKey.String("active")
+ // The app is now `inactive`. Associated with UIKit notification
+ // `applicationWillResignActive`.
+ //
+ // Stability: development
+ IOSAppStateInactive = IOSAppStateKey.String("inactive")
+ // The app is now in the background. This value is associated with UIKit
+ // notification `applicationDidEnterBackground`.
+ //
+ // Stability: development
+ IOSAppStateBackground = IOSAppStateKey.String("background")
+ // The app is now in the foreground. This value is associated with UIKit
+ // notification `applicationWillEnterForeground`.
+ //
+ // Stability: development
+ IOSAppStateForeground = IOSAppStateKey.String("foreground")
+ // The app is about to terminate. Associated with UIKit notification
+ // `applicationWillTerminate`.
+ //
+ // Stability: development
+ IOSAppStateTerminate = IOSAppStateKey.String("terminate")
+)
+
+// Namespace: k8s
+const (
+ // K8SClusterNameKey is the attribute Key conforming to the "k8s.cluster.name"
+ // semantic conventions. It represents the name of the cluster.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-cluster"
+ K8SClusterNameKey = attribute.Key("k8s.cluster.name")
+
+ // K8SClusterUIDKey is the attribute Key conforming to the "k8s.cluster.uid"
+ // semantic conventions. It represents a pseudo-ID for the cluster, set to the
+ // UID of the `kube-system` namespace.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d"
+ // Note: K8s doesn't have support for obtaining a cluster ID. If this is ever
+ // added, we will recommend collecting the `k8s.cluster.uid` through the
+ // official APIs. In the meantime, we are able to use the `uid` of the
+ // `kube-system` namespace as a proxy for cluster ID. Read on for the
+ // rationale.
+ //
+ // Every object created in a K8s cluster is assigned a distinct UID. The
+ // `kube-system` namespace is used by Kubernetes itself and will exist
+ // for the lifetime of the cluster. Using the `uid` of the `kube-system`
+ // namespace is a reasonable proxy for the K8s ClusterID as it will only
+ // change if the cluster is rebuilt. Furthermore, Kubernetes UIDs are
+ // UUIDs as standardized by
+ // [ISO/IEC 9834-8 and ITU-T X.667].
+ // Which states:
+ //
+ // > If generated according to one of the mechanisms defined in Rec.
+ // > ITU-T X.667 | ISO/IEC 9834-8, a UUID is either guaranteed to be
+ // > different from all other UUIDs generated before 3603 A.D., or is
+ // > extremely likely to be different (depending on the mechanism chosen).
+ //
+ // Therefore, UIDs between clusters should be extremely unlikely to
+ // conflict.
+ //
+ // [ISO/IEC 9834-8 and ITU-T X.667]: https://www.itu.int/ITU-T/studygroups/com17/oid.html
+ K8SClusterUIDKey = attribute.Key("k8s.cluster.uid")
+
+ // K8SContainerNameKey is the attribute Key conforming to the
+ // "k8s.container.name" semantic conventions. It represents the name of the
+ // Container from Pod specification, must be unique within a Pod. Container
+ // runtime usually uses different globally unique name (`container.name`).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "redis"
+ K8SContainerNameKey = attribute.Key("k8s.container.name")
+
+ // K8SContainerRestartCountKey is the attribute Key conforming to the
+ // "k8s.container.restart_count" semantic conventions. It represents the number
+ // of times the container was restarted. This attribute can be used to identify
+ // a particular container (running or stopped) within a container spec.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ K8SContainerRestartCountKey = attribute.Key("k8s.container.restart_count")
+
+ // K8SContainerStatusLastTerminatedReasonKey is the attribute Key conforming to
+ // the "k8s.container.status.last_terminated_reason" semantic conventions. It
+ // represents the last terminated reason of the Container.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Evicted", "Error"
+ K8SContainerStatusLastTerminatedReasonKey = attribute.Key("k8s.container.status.last_terminated_reason")
+
+ // K8SCronJobNameKey is the attribute Key conforming to the "k8s.cronjob.name"
+ // semantic conventions. It represents the name of the CronJob.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SCronJobNameKey = attribute.Key("k8s.cronjob.name")
+
+ // K8SCronJobUIDKey is the attribute Key conforming to the "k8s.cronjob.uid"
+ // semantic conventions. It represents the UID of the CronJob.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SCronJobUIDKey = attribute.Key("k8s.cronjob.uid")
+
+ // K8SDaemonSetNameKey is the attribute Key conforming to the
+ // "k8s.daemonset.name" semantic conventions. It represents the name of the
+ // DaemonSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SDaemonSetNameKey = attribute.Key("k8s.daemonset.name")
+
+ // K8SDaemonSetUIDKey is the attribute Key conforming to the "k8s.daemonset.uid"
+ // semantic conventions. It represents the UID of the DaemonSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SDaemonSetUIDKey = attribute.Key("k8s.daemonset.uid")
+
+ // K8SDeploymentNameKey is the attribute Key conforming to the
+ // "k8s.deployment.name" semantic conventions. It represents the name of the
+ // Deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SDeploymentNameKey = attribute.Key("k8s.deployment.name")
+
+ // K8SDeploymentUIDKey is the attribute Key conforming to the
+ // "k8s.deployment.uid" semantic conventions. It represents the UID of the
+ // Deployment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SDeploymentUIDKey = attribute.Key("k8s.deployment.uid")
+
+ // K8SHPANameKey is the attribute Key conforming to the "k8s.hpa.name" semantic
+ // conventions. It represents the name of the horizontal pod autoscaler.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SHPANameKey = attribute.Key("k8s.hpa.name")
+
+ // K8SHPAUIDKey is the attribute Key conforming to the "k8s.hpa.uid" semantic
+ // conventions. It represents the UID of the horizontal pod autoscaler.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SHPAUIDKey = attribute.Key("k8s.hpa.uid")
+
+ // K8SJobNameKey is the attribute Key conforming to the "k8s.job.name" semantic
+ // conventions. It represents the name of the Job.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SJobNameKey = attribute.Key("k8s.job.name")
+
+ // K8SJobUIDKey is the attribute Key conforming to the "k8s.job.uid" semantic
+ // conventions. It represents the UID of the Job.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SJobUIDKey = attribute.Key("k8s.job.uid")
+
+ // K8SNamespaceNameKey is the attribute Key conforming to the
+ // "k8s.namespace.name" semantic conventions. It represents the name of the
+ // namespace that the pod is running in.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "default"
+ K8SNamespaceNameKey = attribute.Key("k8s.namespace.name")
+
+ // K8SNamespacePhaseKey is the attribute Key conforming to the
+ // "k8s.namespace.phase" semantic conventions. It represents the phase of the
+ // K8s namespace.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "active", "terminating"
+ // Note: This attribute aligns with the `phase` field of the
+ // [K8s NamespaceStatus]
+ //
+ // [K8s NamespaceStatus]: https://kubernetes.io/docs/reference/generated/kubernetes-api/v1.30/#namespacestatus-v1-core
+ K8SNamespacePhaseKey = attribute.Key("k8s.namespace.phase")
+
+ // K8SNodeNameKey is the attribute Key conforming to the "k8s.node.name"
+ // semantic conventions. It represents the name of the Node.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "node-1"
+ K8SNodeNameKey = attribute.Key("k8s.node.name")
+
+ // K8SNodeUIDKey is the attribute Key conforming to the "k8s.node.uid" semantic
+ // conventions. It represents the UID of the Node.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1eb3a0c6-0477-4080-a9cb-0cb7db65c6a2"
+ K8SNodeUIDKey = attribute.Key("k8s.node.uid")
+
+ // K8SPodNameKey is the attribute Key conforming to the "k8s.pod.name" semantic
+ // conventions. It represents the name of the Pod.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry-pod-autoconf"
+ K8SPodNameKey = attribute.Key("k8s.pod.name")
+
+ // K8SPodUIDKey is the attribute Key conforming to the "k8s.pod.uid" semantic
+ // conventions. It represents the UID of the Pod.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SPodUIDKey = attribute.Key("k8s.pod.uid")
+
+ // K8SReplicaSetNameKey is the attribute Key conforming to the
+ // "k8s.replicaset.name" semantic conventions. It represents the name of the
+ // ReplicaSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SReplicaSetNameKey = attribute.Key("k8s.replicaset.name")
+
+ // K8SReplicaSetUIDKey is the attribute Key conforming to the
+ // "k8s.replicaset.uid" semantic conventions. It represents the UID of the
+ // ReplicaSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SReplicaSetUIDKey = attribute.Key("k8s.replicaset.uid")
+
+ // K8SReplicationControllerNameKey is the attribute Key conforming to the
+ // "k8s.replicationcontroller.name" semantic conventions. It represents the name
+ // of the replication controller.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SReplicationControllerNameKey = attribute.Key("k8s.replicationcontroller.name")
+
+ // K8SReplicationControllerUIDKey is the attribute Key conforming to the
+ // "k8s.replicationcontroller.uid" semantic conventions. It represents the UID
+ // of the replication controller.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SReplicationControllerUIDKey = attribute.Key("k8s.replicationcontroller.uid")
+
+ // K8SResourceQuotaNameKey is the attribute Key conforming to the
+ // "k8s.resourcequota.name" semantic conventions. It represents the name of the
+ // resource quota.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SResourceQuotaNameKey = attribute.Key("k8s.resourcequota.name")
+
+ // K8SResourceQuotaUIDKey is the attribute Key conforming to the
+ // "k8s.resourcequota.uid" semantic conventions. It represents the UID of the
+ // resource quota.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SResourceQuotaUIDKey = attribute.Key("k8s.resourcequota.uid")
+
+ // K8SStatefulSetNameKey is the attribute Key conforming to the
+ // "k8s.statefulset.name" semantic conventions. It represents the name of the
+ // StatefulSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "opentelemetry"
+ K8SStatefulSetNameKey = attribute.Key("k8s.statefulset.name")
+
+ // K8SStatefulSetUIDKey is the attribute Key conforming to the
+ // "k8s.statefulset.uid" semantic conventions. It represents the UID of the
+ // StatefulSet.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff"
+ K8SStatefulSetUIDKey = attribute.Key("k8s.statefulset.uid")
+
+ // K8SVolumeNameKey is the attribute Key conforming to the "k8s.volume.name"
+ // semantic conventions. It represents the name of the K8s volume.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "volume0"
+ K8SVolumeNameKey = attribute.Key("k8s.volume.name")
+
+ // K8SVolumeTypeKey is the attribute Key conforming to the "k8s.volume.type"
+ // semantic conventions. It represents the type of the K8s volume.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "emptyDir", "persistentVolumeClaim"
+ K8SVolumeTypeKey = attribute.Key("k8s.volume.type")
+)
+
+// K8SClusterName returns an attribute KeyValue conforming to the
+// "k8s.cluster.name" semantic conventions. It represents the name of the
+// cluster.
+func K8SClusterName(val string) attribute.KeyValue {
+ return K8SClusterNameKey.String(val)
+}
+
+// K8SClusterUID returns an attribute KeyValue conforming to the
+// "k8s.cluster.uid" semantic conventions. It represents a pseudo-ID for the
+// cluster, set to the UID of the `kube-system` namespace.
+func K8SClusterUID(val string) attribute.KeyValue {
+ return K8SClusterUIDKey.String(val)
+}
+
+// K8SContainerName returns an attribute KeyValue conforming to the
+// "k8s.container.name" semantic conventions. It represents the name of the
+// Container from Pod specification, must be unique within a Pod. Container
+// runtime usually uses different globally unique name (`container.name`).
+func K8SContainerName(val string) attribute.KeyValue {
+ return K8SContainerNameKey.String(val)
+}
+
+// K8SContainerRestartCount returns an attribute KeyValue conforming to the
+// "k8s.container.restart_count" semantic conventions. It represents the number
+// of times the container was restarted. This attribute can be used to identify a
+// particular container (running or stopped) within a container spec.
+func K8SContainerRestartCount(val int) attribute.KeyValue {
+ return K8SContainerRestartCountKey.Int(val)
+}
+
+// K8SContainerStatusLastTerminatedReason returns an attribute KeyValue
+// conforming to the "k8s.container.status.last_terminated_reason" semantic
+// conventions. It represents the last terminated reason of the Container.
+func K8SContainerStatusLastTerminatedReason(val string) attribute.KeyValue {
+ return K8SContainerStatusLastTerminatedReasonKey.String(val)
+}
+
+// K8SCronJobName returns an attribute KeyValue conforming to the
+// "k8s.cronjob.name" semantic conventions. It represents the name of the
+// CronJob.
+func K8SCronJobName(val string) attribute.KeyValue {
+ return K8SCronJobNameKey.String(val)
+}
+
+// K8SCronJobUID returns an attribute KeyValue conforming to the
+// "k8s.cronjob.uid" semantic conventions. It represents the UID of the CronJob.
+func K8SCronJobUID(val string) attribute.KeyValue {
+ return K8SCronJobUIDKey.String(val)
+}
+
+// K8SDaemonSetName returns an attribute KeyValue conforming to the
+// "k8s.daemonset.name" semantic conventions. It represents the name of the
+// DaemonSet.
+func K8SDaemonSetName(val string) attribute.KeyValue {
+ return K8SDaemonSetNameKey.String(val)
+}
+
+// K8SDaemonSetUID returns an attribute KeyValue conforming to the
+// "k8s.daemonset.uid" semantic conventions. It represents the UID of the
+// DaemonSet.
+func K8SDaemonSetUID(val string) attribute.KeyValue {
+ return K8SDaemonSetUIDKey.String(val)
+}
+
+// K8SDeploymentName returns an attribute KeyValue conforming to the
+// "k8s.deployment.name" semantic conventions. It represents the name of the
+// Deployment.
+func K8SDeploymentName(val string) attribute.KeyValue {
+ return K8SDeploymentNameKey.String(val)
+}
+
+// K8SDeploymentUID returns an attribute KeyValue conforming to the
+// "k8s.deployment.uid" semantic conventions. It represents the UID of the
+// Deployment.
+func K8SDeploymentUID(val string) attribute.KeyValue {
+ return K8SDeploymentUIDKey.String(val)
+}
+
+// K8SHPAName returns an attribute KeyValue conforming to the "k8s.hpa.name"
+// semantic conventions. It represents the name of the horizontal pod autoscaler.
+func K8SHPAName(val string) attribute.KeyValue {
+ return K8SHPANameKey.String(val)
+}
+
+// K8SHPAUID returns an attribute KeyValue conforming to the "k8s.hpa.uid"
+// semantic conventions. It represents the UID of the horizontal pod autoscaler.
+func K8SHPAUID(val string) attribute.KeyValue {
+ return K8SHPAUIDKey.String(val)
+}
+
+// K8SJobName returns an attribute KeyValue conforming to the "k8s.job.name"
+// semantic conventions. It represents the name of the Job.
+func K8SJobName(val string) attribute.KeyValue {
+ return K8SJobNameKey.String(val)
+}
+
+// K8SJobUID returns an attribute KeyValue conforming to the "k8s.job.uid"
+// semantic conventions. It represents the UID of the Job.
+func K8SJobUID(val string) attribute.KeyValue {
+ return K8SJobUIDKey.String(val)
+}
+
+// K8SNamespaceName returns an attribute KeyValue conforming to the
+// "k8s.namespace.name" semantic conventions. It represents the name of the
+// namespace that the pod is running in.
+func K8SNamespaceName(val string) attribute.KeyValue {
+ return K8SNamespaceNameKey.String(val)
+}
+
+// K8SNodeName returns an attribute KeyValue conforming to the "k8s.node.name"
+// semantic conventions. It represents the name of the Node.
+func K8SNodeName(val string) attribute.KeyValue {
+ return K8SNodeNameKey.String(val)
+}
+
+// K8SNodeUID returns an attribute KeyValue conforming to the "k8s.node.uid"
+// semantic conventions. It represents the UID of the Node.
+func K8SNodeUID(val string) attribute.KeyValue {
+ return K8SNodeUIDKey.String(val)
+}
+
+// K8SPodName returns an attribute KeyValue conforming to the "k8s.pod.name"
+// semantic conventions. It represents the name of the Pod.
+func K8SPodName(val string) attribute.KeyValue {
+ return K8SPodNameKey.String(val)
+}
+
+// K8SPodUID returns an attribute KeyValue conforming to the "k8s.pod.uid"
+// semantic conventions. It represents the UID of the Pod.
+func K8SPodUID(val string) attribute.KeyValue {
+ return K8SPodUIDKey.String(val)
+}
+
+// K8SReplicaSetName returns an attribute KeyValue conforming to the
+// "k8s.replicaset.name" semantic conventions. It represents the name of the
+// ReplicaSet.
+func K8SReplicaSetName(val string) attribute.KeyValue {
+ return K8SReplicaSetNameKey.String(val)
+}
+
+// K8SReplicaSetUID returns an attribute KeyValue conforming to the
+// "k8s.replicaset.uid" semantic conventions. It represents the UID of the
+// ReplicaSet.
+func K8SReplicaSetUID(val string) attribute.KeyValue {
+ return K8SReplicaSetUIDKey.String(val)
+}
+
+// K8SReplicationControllerName returns an attribute KeyValue conforming to the
+// "k8s.replicationcontroller.name" semantic conventions. It represents the name
+// of the replication controller.
+func K8SReplicationControllerName(val string) attribute.KeyValue {
+ return K8SReplicationControllerNameKey.String(val)
+}
+
+// K8SReplicationControllerUID returns an attribute KeyValue conforming to the
+// "k8s.replicationcontroller.uid" semantic conventions. It represents the UID of
+// the replication controller.
+func K8SReplicationControllerUID(val string) attribute.KeyValue {
+ return K8SReplicationControllerUIDKey.String(val)
+}
+
+// K8SResourceQuotaName returns an attribute KeyValue conforming to the
+// "k8s.resourcequota.name" semantic conventions. It represents the name of the
+// resource quota.
+func K8SResourceQuotaName(val string) attribute.KeyValue {
+ return K8SResourceQuotaNameKey.String(val)
+}
+
+// K8SResourceQuotaUID returns an attribute KeyValue conforming to the
+// "k8s.resourcequota.uid" semantic conventions. It represents the UID of the
+// resource quota.
+func K8SResourceQuotaUID(val string) attribute.KeyValue {
+ return K8SResourceQuotaUIDKey.String(val)
+}
+
+// K8SStatefulSetName returns an attribute KeyValue conforming to the
+// "k8s.statefulset.name" semantic conventions. It represents the name of the
+// StatefulSet.
+func K8SStatefulSetName(val string) attribute.KeyValue {
+ return K8SStatefulSetNameKey.String(val)
+}
+
+// K8SStatefulSetUID returns an attribute KeyValue conforming to the
+// "k8s.statefulset.uid" semantic conventions. It represents the UID of the
+// StatefulSet.
+func K8SStatefulSetUID(val string) attribute.KeyValue {
+ return K8SStatefulSetUIDKey.String(val)
+}
+
+// K8SVolumeName returns an attribute KeyValue conforming to the
+// "k8s.volume.name" semantic conventions. It represents the name of the K8s
+// volume.
+func K8SVolumeName(val string) attribute.KeyValue {
+ return K8SVolumeNameKey.String(val)
+}
+
+// Enum values for k8s.namespace.phase
+var (
+ // Active namespace phase as described by [K8s API]
+ // Stability: development
+ //
+ // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase
+ K8SNamespacePhaseActive = K8SNamespacePhaseKey.String("active")
+ // Terminating namespace phase as described by [K8s API]
+ // Stability: development
+ //
+ // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase
+ K8SNamespacePhaseTerminating = K8SNamespacePhaseKey.String("terminating")
+)
+
+// Enum values for k8s.volume.type
+var (
+ // A [persistentVolumeClaim] volume
+ // Stability: development
+ //
+ // [persistentVolumeClaim]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#persistentvolumeclaim
+ K8SVolumeTypePersistentVolumeClaim = K8SVolumeTypeKey.String("persistentVolumeClaim")
+ // A [configMap] volume
+ // Stability: development
+ //
+ // [configMap]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#configmap
+ K8SVolumeTypeConfigMap = K8SVolumeTypeKey.String("configMap")
+ // A [downwardAPI] volume
+ // Stability: development
+ //
+ // [downwardAPI]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#downwardapi
+ K8SVolumeTypeDownwardAPI = K8SVolumeTypeKey.String("downwardAPI")
+ // An [emptyDir] volume
+ // Stability: development
+ //
+ // [emptyDir]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#emptydir
+ K8SVolumeTypeEmptyDir = K8SVolumeTypeKey.String("emptyDir")
+ // A [secret] volume
+ // Stability: development
+ //
+ // [secret]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#secret
+ K8SVolumeTypeSecret = K8SVolumeTypeKey.String("secret")
+ // A [local] volume
+ // Stability: development
+ //
+ // [local]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#local
+ K8SVolumeTypeLocal = K8SVolumeTypeKey.String("local")
+)
+
+// Namespace: linux
+const (
+ // LinuxMemorySlabStateKey is the attribute Key conforming to the
+ // "linux.memory.slab.state" semantic conventions. It represents the Linux Slab
+ // memory state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "reclaimable", "unreclaimable"
+ LinuxMemorySlabStateKey = attribute.Key("linux.memory.slab.state")
+)
+
+// Enum values for linux.memory.slab.state
+var (
+ // reclaimable
+ // Stability: development
+ LinuxMemorySlabStateReclaimable = LinuxMemorySlabStateKey.String("reclaimable")
+ // unreclaimable
+ // Stability: development
+ LinuxMemorySlabStateUnreclaimable = LinuxMemorySlabStateKey.String("unreclaimable")
+)
+
+// Namespace: log
+const (
+ // LogFileNameKey is the attribute Key conforming to the "log.file.name"
+ // semantic conventions. It represents the basename of the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "audit.log"
+ LogFileNameKey = attribute.Key("log.file.name")
+
+ // LogFileNameResolvedKey is the attribute Key conforming to the
+ // "log.file.name_resolved" semantic conventions. It represents the basename of
+ // the file, with symlinks resolved.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "uuid.log"
+ LogFileNameResolvedKey = attribute.Key("log.file.name_resolved")
+
+ // LogFilePathKey is the attribute Key conforming to the "log.file.path"
+ // semantic conventions. It represents the full path to the file.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/var/log/mysql/audit.log"
+ LogFilePathKey = attribute.Key("log.file.path")
+
+ // LogFilePathResolvedKey is the attribute Key conforming to the
+ // "log.file.path_resolved" semantic conventions. It represents the full path to
+ // the file, with symlinks resolved.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/var/lib/docker/uuid.log"
+ LogFilePathResolvedKey = attribute.Key("log.file.path_resolved")
+
+ // LogIostreamKey is the attribute Key conforming to the "log.iostream" semantic
+ // conventions. It represents the stream associated with the log. See below for
+ // a list of well-known values.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ LogIostreamKey = attribute.Key("log.iostream")
+
+ // LogRecordOriginalKey is the attribute Key conforming to the
+ // "log.record.original" semantic conventions. It represents the complete
+ // original Log Record.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "77 <86>1 2015-08-06T21:58:59.694Z 192.168.2.133 inactive - - -
+ // Something happened", "[INFO] 8/3/24 12:34:56 Something happened"
+ // Note: This value MAY be added when processing a Log Record which was
+ // originally transmitted as a string or equivalent data type AND the Body field
+ // of the Log Record does not contain the same value. (e.g. a syslog or a log
+ // record read from a file.)
+ LogRecordOriginalKey = attribute.Key("log.record.original")
+
+ // LogRecordUIDKey is the attribute Key conforming to the "log.record.uid"
+ // semantic conventions. It represents a unique identifier for the Log Record.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "01ARZ3NDEKTSV4RRFFQ69G5FAV"
+ // Note: If an id is provided, other log records with the same id will be
+ // considered duplicates and can be removed safely. This means, that two
+ // distinguishable log records MUST have different values.
+ // The id MAY be an
+ // [Universally Unique Lexicographically Sortable Identifier (ULID)], but other
+ // identifiers (e.g. UUID) may be used as needed.
+ //
+ // [Universally Unique Lexicographically Sortable Identifier (ULID)]: https://github.com/ulid/spec
+ LogRecordUIDKey = attribute.Key("log.record.uid")
+)
+
+// LogFileName returns an attribute KeyValue conforming to the "log.file.name"
+// semantic conventions. It represents the basename of the file.
+func LogFileName(val string) attribute.KeyValue {
+ return LogFileNameKey.String(val)
+}
+
+// LogFileNameResolved returns an attribute KeyValue conforming to the
+// "log.file.name_resolved" semantic conventions. It represents the basename of
+// the file, with symlinks resolved.
+func LogFileNameResolved(val string) attribute.KeyValue {
+ return LogFileNameResolvedKey.String(val)
+}
+
+// LogFilePath returns an attribute KeyValue conforming to the "log.file.path"
+// semantic conventions. It represents the full path to the file.
+func LogFilePath(val string) attribute.KeyValue {
+ return LogFilePathKey.String(val)
+}
+
+// LogFilePathResolved returns an attribute KeyValue conforming to the
+// "log.file.path_resolved" semantic conventions. It represents the full path to
+// the file, with symlinks resolved.
+func LogFilePathResolved(val string) attribute.KeyValue {
+ return LogFilePathResolvedKey.String(val)
+}
+
+// LogRecordOriginal returns an attribute KeyValue conforming to the
+// "log.record.original" semantic conventions. It represents the complete
+// original Log Record.
+func LogRecordOriginal(val string) attribute.KeyValue {
+ return LogRecordOriginalKey.String(val)
+}
+
+// LogRecordUID returns an attribute KeyValue conforming to the "log.record.uid"
+// semantic conventions. It represents a unique identifier for the Log Record.
+func LogRecordUID(val string) attribute.KeyValue {
+ return LogRecordUIDKey.String(val)
+}
+
+// Enum values for log.iostream
+var (
+ // Logs from stdout stream
+ // Stability: development
+ LogIostreamStdout = LogIostreamKey.String("stdout")
+ // Events from stderr stream
+ // Stability: development
+ LogIostreamStderr = LogIostreamKey.String("stderr")
+)
+
+// Namespace: messaging
+const (
+ // MessagingBatchMessageCountKey is the attribute Key conforming to the
+ // "messaging.batch.message_count" semantic conventions. It represents the
+ // number of messages sent, received, or processed in the scope of the batching
+ // operation.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 0, 1, 2
+ // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on
+ // spans that operate with a single message. When a messaging client library
+ // supports both batch and single-message API for the same operation,
+ // instrumentations SHOULD use `messaging.batch.message_count` for batching APIs
+ // and SHOULD NOT use it for single-message APIs.
+ MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count")
+
+ // MessagingClientIDKey is the attribute Key conforming to the
+ // "messaging.client.id" semantic conventions. It represents a unique identifier
+ // for the client that consumes or produces a message.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "client-5", "myhost@8742@s8083jm"
+ MessagingClientIDKey = attribute.Key("messaging.client.id")
+
+ // MessagingConsumerGroupNameKey is the attribute Key conforming to the
+ // "messaging.consumer.group.name" semantic conventions. It represents the name
+ // of the consumer group with which a consumer is associated.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-group", "indexer"
+ // Note: Semantic conventions for individual messaging systems SHOULD document
+ // whether `messaging.consumer.group.name` is applicable and what it means in
+ // the context of that system.
+ MessagingConsumerGroupNameKey = attribute.Key("messaging.consumer.group.name")
+
+ // MessagingDestinationAnonymousKey is the attribute Key conforming to the
+ // "messaging.destination.anonymous" semantic conventions. It represents a
+ // boolean that is true if the message destination is anonymous (could be
+ // unnamed or have auto-generated name).
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingDestinationAnonymousKey = attribute.Key("messaging.destination.anonymous")
+
+ // MessagingDestinationNameKey is the attribute Key conforming to the
+ // "messaging.destination.name" semantic conventions. It represents the message
+ // destination name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MyQueue", "MyTopic"
+ // Note: Destination name SHOULD uniquely identify a specific queue, topic or
+ // other entity within the broker. If
+ // the broker doesn't have such notion, the destination name SHOULD uniquely
+ // identify the broker.
+ MessagingDestinationNameKey = attribute.Key("messaging.destination.name")
+
+ // MessagingDestinationPartitionIDKey is the attribute Key conforming to the
+ // "messaging.destination.partition.id" semantic conventions. It represents the
+ // identifier of the partition messages are sent to or received from, unique
+ // within the `messaging.destination.name`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1
+ MessagingDestinationPartitionIDKey = attribute.Key("messaging.destination.partition.id")
+
+ // MessagingDestinationSubscriptionNameKey is the attribute Key conforming to
+ // the "messaging.destination.subscription.name" semantic conventions. It
+ // represents the name of the destination subscription from which a message is
+ // consumed.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "subscription-a"
+ // Note: Semantic conventions for individual messaging systems SHOULD document
+ // whether `messaging.destination.subscription.name` is applicable and what it
+ // means in the context of that system.
+ MessagingDestinationSubscriptionNameKey = attribute.Key("messaging.destination.subscription.name")
+
+ // MessagingDestinationTemplateKey is the attribute Key conforming to the
+ // "messaging.destination.template" semantic conventions. It represents the low
+ // cardinality representation of the messaging destination name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/customers/{customerId}"
+ // Note: Destination names could be constructed from templates. An example would
+ // be a destination name involving a user name or product id. Although the
+ // destination name in this case is of high cardinality, the underlying template
+ // is of low cardinality and can be effectively used for grouping and
+ // aggregation.
+ MessagingDestinationTemplateKey = attribute.Key("messaging.destination.template")
+
+ // MessagingDestinationTemporaryKey is the attribute Key conforming to the
+ // "messaging.destination.temporary" semantic conventions. It represents a
+ // boolean that is true if the message destination is temporary and might not
+ // exist anymore after messages are processed.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingDestinationTemporaryKey = attribute.Key("messaging.destination.temporary")
+
+ // MessagingEventHubsMessageEnqueuedTimeKey is the attribute Key conforming to
+ // the "messaging.eventhubs.message.enqueued_time" semantic conventions. It
+ // represents the UTC epoch seconds at which the message has been accepted and
+ // stored in the entity.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingEventHubsMessageEnqueuedTimeKey = attribute.Key("messaging.eventhubs.message.enqueued_time")
+
+ // MessagingGCPPubSubMessageAckDeadlineKey is the attribute Key conforming to
+ // the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It
+ // represents the ack deadline in seconds set for the modify ack deadline
+ // request.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingGCPPubSubMessageAckDeadlineKey = attribute.Key("messaging.gcp_pubsub.message.ack_deadline")
+
+ // MessagingGCPPubSubMessageAckIDKey is the attribute Key conforming to the
+ // "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the
+ // ack id for a given message.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: ack_id
+ MessagingGCPPubSubMessageAckIDKey = attribute.Key("messaging.gcp_pubsub.message.ack_id")
+
+ // MessagingGCPPubSubMessageDeliveryAttemptKey is the attribute Key conforming
+ // to the "messaging.gcp_pubsub.message.delivery_attempt" semantic conventions.
+ // It represents the delivery attempt for a given message.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingGCPPubSubMessageDeliveryAttemptKey = attribute.Key("messaging.gcp_pubsub.message.delivery_attempt")
+
+ // MessagingGCPPubSubMessageOrderingKeyKey is the attribute Key conforming to
+ // the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It
+ // represents the ordering key for a given message. If the attribute is not
+ // present, the message does not have an ordering key.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: ordering_key
+ MessagingGCPPubSubMessageOrderingKeyKey = attribute.Key("messaging.gcp_pubsub.message.ordering_key")
+
+ // MessagingKafkaMessageKeyKey is the attribute Key conforming to the
+ // "messaging.kafka.message.key" semantic conventions. It represents the message
+ // keys in Kafka are used for grouping alike messages to ensure they're
+ // processed on the same partition. They differ from `messaging.message.id` in
+ // that they're not unique. If the key is `null`, the attribute MUST NOT be set.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myKey
+ // Note: If the key type is not string, it's string representation has to be
+ // supplied for the attribute. If the key has no unambiguous, canonical string
+ // form, don't include its value.
+ MessagingKafkaMessageKeyKey = attribute.Key("messaging.kafka.message.key")
+
+ // MessagingKafkaMessageTombstoneKey is the attribute Key conforming to the
+ // "messaging.kafka.message.tombstone" semantic conventions. It represents a
+ // boolean that is true if the message is a tombstone.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingKafkaMessageTombstoneKey = attribute.Key("messaging.kafka.message.tombstone")
+
+ // MessagingKafkaOffsetKey is the attribute Key conforming to the
+ // "messaging.kafka.offset" semantic conventions. It represents the offset of a
+ // record in the corresponding Kafka partition.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingKafkaOffsetKey = attribute.Key("messaging.kafka.offset")
+
+ // MessagingMessageBodySizeKey is the attribute Key conforming to the
+ // "messaging.message.body.size" semantic conventions. It represents the size of
+ // the message body in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Note: This can refer to both the compressed or uncompressed body size. If
+ // both sizes are known, the uncompressed
+ // body size should be used.
+ MessagingMessageBodySizeKey = attribute.Key("messaging.message.body.size")
+
+ // MessagingMessageConversationIDKey is the attribute Key conforming to the
+ // "messaging.message.conversation_id" semantic conventions. It represents the
+ // conversation ID identifying the conversation to which the message belongs,
+ // represented as a string. Sometimes called "Correlation ID".
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: MyConversationId
+ MessagingMessageConversationIDKey = attribute.Key("messaging.message.conversation_id")
+
+ // MessagingMessageEnvelopeSizeKey is the attribute Key conforming to the
+ // "messaging.message.envelope.size" semantic conventions. It represents the
+ // size of the message body and metadata in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Note: This can refer to both the compressed or uncompressed size. If both
+ // sizes are known, the uncompressed
+ // size should be used.
+ MessagingMessageEnvelopeSizeKey = attribute.Key("messaging.message.envelope.size")
+
+ // MessagingMessageIDKey is the attribute Key conforming to the
+ // "messaging.message.id" semantic conventions. It represents a value used by
+ // the messaging system as an identifier for the message, represented as a
+ // string.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 452a7c7c7c7048c2f887f61572b18fc2
+ MessagingMessageIDKey = attribute.Key("messaging.message.id")
+
+ // MessagingOperationNameKey is the attribute Key conforming to the
+ // "messaging.operation.name" semantic conventions. It represents the
+ // system-specific name of the messaging operation.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ack", "nack", "send"
+ MessagingOperationNameKey = attribute.Key("messaging.operation.name")
+
+ // MessagingOperationTypeKey is the attribute Key conforming to the
+ // "messaging.operation.type" semantic conventions. It represents a string
+ // identifying the type of the messaging operation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: If a custom value is used, it MUST be of low cardinality.
+ MessagingOperationTypeKey = attribute.Key("messaging.operation.type")
+
+ // MessagingRabbitMQDestinationRoutingKeyKey is the attribute Key conforming to
+ // the "messaging.rabbitmq.destination.routing_key" semantic conventions. It
+ // represents the rabbitMQ message routing key.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myKey
+ MessagingRabbitMQDestinationRoutingKeyKey = attribute.Key("messaging.rabbitmq.destination.routing_key")
+
+ // MessagingRabbitMQMessageDeliveryTagKey is the attribute Key conforming to the
+ // "messaging.rabbitmq.message.delivery_tag" semantic conventions. It represents
+ // the rabbitMQ message delivery tag.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingRabbitMQMessageDeliveryTagKey = attribute.Key("messaging.rabbitmq.message.delivery_tag")
+
+ // MessagingRocketMQConsumptionModelKey is the attribute Key conforming to the
+ // "messaging.rocketmq.consumption_model" semantic conventions. It represents
+ // the model of message consumption. This only applies to consumer spans.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingRocketMQConsumptionModelKey = attribute.Key("messaging.rocketmq.consumption_model")
+
+ // MessagingRocketMQMessageDelayTimeLevelKey is the attribute Key conforming to
+ // the "messaging.rocketmq.message.delay_time_level" semantic conventions. It
+ // represents the delay time level for delay message, which determines the
+ // message delay time.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingRocketMQMessageDelayTimeLevelKey = attribute.Key("messaging.rocketmq.message.delay_time_level")
+
+ // MessagingRocketMQMessageDeliveryTimestampKey is the attribute Key conforming
+ // to the "messaging.rocketmq.message.delivery_timestamp" semantic conventions.
+ // It represents the timestamp in milliseconds that the delay message is
+ // expected to be delivered to consumer.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingRocketMQMessageDeliveryTimestampKey = attribute.Key("messaging.rocketmq.message.delivery_timestamp")
+
+ // MessagingRocketMQMessageGroupKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.group" semantic conventions. It represents the it
+ // is essential for FIFO message. Messages that belong to the same message group
+ // are always processed one by one within the same consumer group.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myMessageGroup
+ MessagingRocketMQMessageGroupKey = attribute.Key("messaging.rocketmq.message.group")
+
+ // MessagingRocketMQMessageKeysKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.keys" semantic conventions. It represents the
+ // key(s) of message, another way to mark message besides message id.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "keyA", "keyB"
+ MessagingRocketMQMessageKeysKey = attribute.Key("messaging.rocketmq.message.keys")
+
+ // MessagingRocketMQMessageTagKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.tag" semantic conventions. It represents the
+ // secondary classifier of message besides topic.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: tagA
+ MessagingRocketMQMessageTagKey = attribute.Key("messaging.rocketmq.message.tag")
+
+ // MessagingRocketMQMessageTypeKey is the attribute Key conforming to the
+ // "messaging.rocketmq.message.type" semantic conventions. It represents the
+ // type of message.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ MessagingRocketMQMessageTypeKey = attribute.Key("messaging.rocketmq.message.type")
+
+ // MessagingRocketMQNamespaceKey is the attribute Key conforming to the
+ // "messaging.rocketmq.namespace" semantic conventions. It represents the
+ // namespace of RocketMQ resources, resources in different namespaces are
+ // individual.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myNamespace
+ MessagingRocketMQNamespaceKey = attribute.Key("messaging.rocketmq.namespace")
+
+ // MessagingServiceBusDispositionStatusKey is the attribute Key conforming to
+ // the "messaging.servicebus.disposition_status" semantic conventions. It
+ // represents the describes the [settlement type].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [settlement type]: https://learn.microsoft.com/azure/service-bus-messaging/message-transfers-locks-settlement#peeklock
+ MessagingServiceBusDispositionStatusKey = attribute.Key("messaging.servicebus.disposition_status")
+
+ // MessagingServiceBusMessageDeliveryCountKey is the attribute Key conforming to
+ // the "messaging.servicebus.message.delivery_count" semantic conventions. It
+ // represents the number of deliveries that have been attempted for this
+ // message.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingServiceBusMessageDeliveryCountKey = attribute.Key("messaging.servicebus.message.delivery_count")
+
+ // MessagingServiceBusMessageEnqueuedTimeKey is the attribute Key conforming to
+ // the "messaging.servicebus.message.enqueued_time" semantic conventions. It
+ // represents the UTC epoch seconds at which the message has been accepted and
+ // stored in the entity.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ MessagingServiceBusMessageEnqueuedTimeKey = attribute.Key("messaging.servicebus.message.enqueued_time")
+
+ // MessagingSystemKey is the attribute Key conforming to the "messaging.system"
+ // semantic conventions. It represents the messaging system as identified by the
+ // client instrumentation.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: The actual messaging system may differ from the one known by the
+ // client. For example, when using Kafka client libraries to communicate with
+ // Azure Event Hubs, the `messaging.system` is set to `kafka` based on the
+ // instrumentation's best knowledge.
+ MessagingSystemKey = attribute.Key("messaging.system")
+)
+
+// MessagingBatchMessageCount returns an attribute KeyValue conforming to the
+// "messaging.batch.message_count" semantic conventions. It represents the number
+// of messages sent, received, or processed in the scope of the batching
+// operation.
+func MessagingBatchMessageCount(val int) attribute.KeyValue {
+ return MessagingBatchMessageCountKey.Int(val)
+}
+
+// MessagingClientID returns an attribute KeyValue conforming to the
+// "messaging.client.id" semantic conventions. It represents a unique identifier
+// for the client that consumes or produces a message.
+func MessagingClientID(val string) attribute.KeyValue {
+ return MessagingClientIDKey.String(val)
+}
+
+// MessagingConsumerGroupName returns an attribute KeyValue conforming to the
+// "messaging.consumer.group.name" semantic conventions. It represents the name
+// of the consumer group with which a consumer is associated.
+func MessagingConsumerGroupName(val string) attribute.KeyValue {
+ return MessagingConsumerGroupNameKey.String(val)
+}
+
+// MessagingDestinationAnonymous returns an attribute KeyValue conforming to the
+// "messaging.destination.anonymous" semantic conventions. It represents a
+// boolean that is true if the message destination is anonymous (could be unnamed
+// or have auto-generated name).
+func MessagingDestinationAnonymous(val bool) attribute.KeyValue {
+ return MessagingDestinationAnonymousKey.Bool(val)
+}
+
+// MessagingDestinationName returns an attribute KeyValue conforming to the
+// "messaging.destination.name" semantic conventions. It represents the message
+// destination name.
+func MessagingDestinationName(val string) attribute.KeyValue {
+ return MessagingDestinationNameKey.String(val)
+}
+
+// MessagingDestinationPartitionID returns an attribute KeyValue conforming to
+// the "messaging.destination.partition.id" semantic conventions. It represents
+// the identifier of the partition messages are sent to or received from, unique
+// within the `messaging.destination.name`.
+func MessagingDestinationPartitionID(val string) attribute.KeyValue {
+ return MessagingDestinationPartitionIDKey.String(val)
+}
+
+// MessagingDestinationSubscriptionName returns an attribute KeyValue conforming
+// to the "messaging.destination.subscription.name" semantic conventions. It
+// represents the name of the destination subscription from which a message is
+// consumed.
+func MessagingDestinationSubscriptionName(val string) attribute.KeyValue {
+ return MessagingDestinationSubscriptionNameKey.String(val)
+}
+
+// MessagingDestinationTemplate returns an attribute KeyValue conforming to the
+// "messaging.destination.template" semantic conventions. It represents the low
+// cardinality representation of the messaging destination name.
+func MessagingDestinationTemplate(val string) attribute.KeyValue {
+ return MessagingDestinationTemplateKey.String(val)
+}
+
+// MessagingDestinationTemporary returns an attribute KeyValue conforming to the
+// "messaging.destination.temporary" semantic conventions. It represents a
+// boolean that is true if the message destination is temporary and might not
+// exist anymore after messages are processed.
+func MessagingDestinationTemporary(val bool) attribute.KeyValue {
+ return MessagingDestinationTemporaryKey.Bool(val)
+}
+
+// MessagingEventHubsMessageEnqueuedTime returns an attribute KeyValue conforming
+// to the "messaging.eventhubs.message.enqueued_time" semantic conventions. It
+// represents the UTC epoch seconds at which the message has been accepted and
+// stored in the entity.
+func MessagingEventHubsMessageEnqueuedTime(val int) attribute.KeyValue {
+ return MessagingEventHubsMessageEnqueuedTimeKey.Int(val)
+}
+
+// MessagingGCPPubSubMessageAckDeadline returns an attribute KeyValue conforming
+// to the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It
+// represents the ack deadline in seconds set for the modify ack deadline
+// request.
+func MessagingGCPPubSubMessageAckDeadline(val int) attribute.KeyValue {
+ return MessagingGCPPubSubMessageAckDeadlineKey.Int(val)
+}
+
+// MessagingGCPPubSubMessageAckID returns an attribute KeyValue conforming to the
+// "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the
+// ack id for a given message.
+func MessagingGCPPubSubMessageAckID(val string) attribute.KeyValue {
+ return MessagingGCPPubSubMessageAckIDKey.String(val)
+}
+
+// MessagingGCPPubSubMessageDeliveryAttempt returns an attribute KeyValue
+// conforming to the "messaging.gcp_pubsub.message.delivery_attempt" semantic
+// conventions. It represents the delivery attempt for a given message.
+func MessagingGCPPubSubMessageDeliveryAttempt(val int) attribute.KeyValue {
+ return MessagingGCPPubSubMessageDeliveryAttemptKey.Int(val)
+}
+
+// MessagingGCPPubSubMessageOrderingKey returns an attribute KeyValue conforming
+// to the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It
+// represents the ordering key for a given message. If the attribute is not
+// present, the message does not have an ordering key.
+func MessagingGCPPubSubMessageOrderingKey(val string) attribute.KeyValue {
+ return MessagingGCPPubSubMessageOrderingKeyKey.String(val)
+}
+
+// MessagingKafkaMessageKey returns an attribute KeyValue conforming to the
+// "messaging.kafka.message.key" semantic conventions. It represents the message
+// keys in Kafka are used for grouping alike messages to ensure they're processed
+// on the same partition. They differ from `messaging.message.id` in that they're
+// not unique. If the key is `null`, the attribute MUST NOT be set.
+func MessagingKafkaMessageKey(val string) attribute.KeyValue {
+ return MessagingKafkaMessageKeyKey.String(val)
+}
+
+// MessagingKafkaMessageTombstone returns an attribute KeyValue conforming to the
+// "messaging.kafka.message.tombstone" semantic conventions. It represents a
+// boolean that is true if the message is a tombstone.
+func MessagingKafkaMessageTombstone(val bool) attribute.KeyValue {
+ return MessagingKafkaMessageTombstoneKey.Bool(val)
+}
+
+// MessagingKafkaOffset returns an attribute KeyValue conforming to the
+// "messaging.kafka.offset" semantic conventions. It represents the offset of a
+// record in the corresponding Kafka partition.
+func MessagingKafkaOffset(val int) attribute.KeyValue {
+ return MessagingKafkaOffsetKey.Int(val)
+}
+
+// MessagingMessageBodySize returns an attribute KeyValue conforming to the
+// "messaging.message.body.size" semantic conventions. It represents the size of
+// the message body in bytes.
+func MessagingMessageBodySize(val int) attribute.KeyValue {
+ return MessagingMessageBodySizeKey.Int(val)
+}
+
+// MessagingMessageConversationID returns an attribute KeyValue conforming to the
+// "messaging.message.conversation_id" semantic conventions. It represents the
+// conversation ID identifying the conversation to which the message belongs,
+// represented as a string. Sometimes called "Correlation ID".
+func MessagingMessageConversationID(val string) attribute.KeyValue {
+ return MessagingMessageConversationIDKey.String(val)
+}
+
+// MessagingMessageEnvelopeSize returns an attribute KeyValue conforming to the
+// "messaging.message.envelope.size" semantic conventions. It represents the size
+// of the message body and metadata in bytes.
+func MessagingMessageEnvelopeSize(val int) attribute.KeyValue {
+ return MessagingMessageEnvelopeSizeKey.Int(val)
+}
+
+// MessagingMessageID returns an attribute KeyValue conforming to the
+// "messaging.message.id" semantic conventions. It represents a value used by the
+// messaging system as an identifier for the message, represented as a string.
+func MessagingMessageID(val string) attribute.KeyValue {
+ return MessagingMessageIDKey.String(val)
+}
+
+// MessagingOperationName returns an attribute KeyValue conforming to the
+// "messaging.operation.name" semantic conventions. It represents the
+// system-specific name of the messaging operation.
+func MessagingOperationName(val string) attribute.KeyValue {
+ return MessagingOperationNameKey.String(val)
+}
+
+// MessagingRabbitMQDestinationRoutingKey returns an attribute KeyValue
+// conforming to the "messaging.rabbitmq.destination.routing_key" semantic
+// conventions. It represents the rabbitMQ message routing key.
+func MessagingRabbitMQDestinationRoutingKey(val string) attribute.KeyValue {
+ return MessagingRabbitMQDestinationRoutingKeyKey.String(val)
+}
+
+// MessagingRabbitMQMessageDeliveryTag returns an attribute KeyValue conforming
+// to the "messaging.rabbitmq.message.delivery_tag" semantic conventions. It
+// represents the rabbitMQ message delivery tag.
+func MessagingRabbitMQMessageDeliveryTag(val int) attribute.KeyValue {
+ return MessagingRabbitMQMessageDeliveryTagKey.Int(val)
+}
+
+// MessagingRocketMQMessageDelayTimeLevel returns an attribute KeyValue
+// conforming to the "messaging.rocketmq.message.delay_time_level" semantic
+// conventions. It represents the delay time level for delay message, which
+// determines the message delay time.
+func MessagingRocketMQMessageDelayTimeLevel(val int) attribute.KeyValue {
+ return MessagingRocketMQMessageDelayTimeLevelKey.Int(val)
+}
+
+// MessagingRocketMQMessageDeliveryTimestamp returns an attribute KeyValue
+// conforming to the "messaging.rocketmq.message.delivery_timestamp" semantic
+// conventions. It represents the timestamp in milliseconds that the delay
+// message is expected to be delivered to consumer.
+func MessagingRocketMQMessageDeliveryTimestamp(val int) attribute.KeyValue {
+ return MessagingRocketMQMessageDeliveryTimestampKey.Int(val)
+}
+
+// MessagingRocketMQMessageGroup returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.message.group" semantic conventions. It represents the it
+// is essential for FIFO message. Messages that belong to the same message group
+// are always processed one by one within the same consumer group.
+func MessagingRocketMQMessageGroup(val string) attribute.KeyValue {
+ return MessagingRocketMQMessageGroupKey.String(val)
+}
+
+// MessagingRocketMQMessageKeys returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.message.keys" semantic conventions. It represents the
+// key(s) of message, another way to mark message besides message id.
+func MessagingRocketMQMessageKeys(val ...string) attribute.KeyValue {
+ return MessagingRocketMQMessageKeysKey.StringSlice(val)
+}
+
+// MessagingRocketMQMessageTag returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.message.tag" semantic conventions. It represents the
+// secondary classifier of message besides topic.
+func MessagingRocketMQMessageTag(val string) attribute.KeyValue {
+ return MessagingRocketMQMessageTagKey.String(val)
+}
+
+// MessagingRocketMQNamespace returns an attribute KeyValue conforming to the
+// "messaging.rocketmq.namespace" semantic conventions. It represents the
+// namespace of RocketMQ resources, resources in different namespaces are
+// individual.
+func MessagingRocketMQNamespace(val string) attribute.KeyValue {
+ return MessagingRocketMQNamespaceKey.String(val)
+}
+
+// MessagingServiceBusMessageDeliveryCount returns an attribute KeyValue
+// conforming to the "messaging.servicebus.message.delivery_count" semantic
+// conventions. It represents the number of deliveries that have been attempted
+// for this message.
+func MessagingServiceBusMessageDeliveryCount(val int) attribute.KeyValue {
+ return MessagingServiceBusMessageDeliveryCountKey.Int(val)
+}
+
+// MessagingServiceBusMessageEnqueuedTime returns an attribute KeyValue
+// conforming to the "messaging.servicebus.message.enqueued_time" semantic
+// conventions. It represents the UTC epoch seconds at which the message has been
+// accepted and stored in the entity.
+func MessagingServiceBusMessageEnqueuedTime(val int) attribute.KeyValue {
+ return MessagingServiceBusMessageEnqueuedTimeKey.Int(val)
+}
+
+// Enum values for messaging.operation.type
+var (
+ // A message is created. "Create" spans always refer to a single message and are
+ // used to provide a unique creation context for messages in batch sending
+ // scenarios.
+ //
+ // Stability: development
+ MessagingOperationTypeCreate = MessagingOperationTypeKey.String("create")
+ // One or more messages are provided for sending to an intermediary. If a single
+ // message is sent, the context of the "Send" span can be used as the creation
+ // context and no "Create" span needs to be created.
+ //
+ // Stability: development
+ MessagingOperationTypeSend = MessagingOperationTypeKey.String("send")
+ // One or more messages are requested by a consumer. This operation refers to
+ // pull-based scenarios, where consumers explicitly call methods of messaging
+ // SDKs to receive messages.
+ //
+ // Stability: development
+ MessagingOperationTypeReceive = MessagingOperationTypeKey.String("receive")
+ // One or more messages are processed by a consumer.
+ //
+ // Stability: development
+ MessagingOperationTypeProcess = MessagingOperationTypeKey.String("process")
+ // One or more messages are settled.
+ //
+ // Stability: development
+ MessagingOperationTypeSettle = MessagingOperationTypeKey.String("settle")
+ // Deprecated: Replaced by `process`.
+ MessagingOperationTypeDeliver = MessagingOperationTypeKey.String("deliver")
+ // Deprecated: Replaced by `send`.
+ MessagingOperationTypePublish = MessagingOperationTypeKey.String("publish")
+)
+
+// Enum values for messaging.rocketmq.consumption_model
+var (
+ // Clustering consumption model
+ // Stability: development
+ MessagingRocketMQConsumptionModelClustering = MessagingRocketMQConsumptionModelKey.String("clustering")
+ // Broadcasting consumption model
+ // Stability: development
+ MessagingRocketMQConsumptionModelBroadcasting = MessagingRocketMQConsumptionModelKey.String("broadcasting")
+)
+
+// Enum values for messaging.rocketmq.message.type
+var (
+ // Normal message
+ // Stability: development
+ MessagingRocketMQMessageTypeNormal = MessagingRocketMQMessageTypeKey.String("normal")
+ // FIFO message
+ // Stability: development
+ MessagingRocketMQMessageTypeFifo = MessagingRocketMQMessageTypeKey.String("fifo")
+ // Delay message
+ // Stability: development
+ MessagingRocketMQMessageTypeDelay = MessagingRocketMQMessageTypeKey.String("delay")
+ // Transaction message
+ // Stability: development
+ MessagingRocketMQMessageTypeTransaction = MessagingRocketMQMessageTypeKey.String("transaction")
+)
+
+// Enum values for messaging.servicebus.disposition_status
+var (
+ // Message is completed
+ // Stability: development
+ MessagingServiceBusDispositionStatusComplete = MessagingServiceBusDispositionStatusKey.String("complete")
+ // Message is abandoned
+ // Stability: development
+ MessagingServiceBusDispositionStatusAbandon = MessagingServiceBusDispositionStatusKey.String("abandon")
+ // Message is sent to dead letter queue
+ // Stability: development
+ MessagingServiceBusDispositionStatusDeadLetter = MessagingServiceBusDispositionStatusKey.String("dead_letter")
+ // Message is deferred
+ // Stability: development
+ MessagingServiceBusDispositionStatusDefer = MessagingServiceBusDispositionStatusKey.String("defer")
+)
+
+// Enum values for messaging.system
+var (
+ // Apache ActiveMQ
+ // Stability: development
+ MessagingSystemActiveMQ = MessagingSystemKey.String("activemq")
+ // Amazon Simple Queue Service (SQS)
+ // Stability: development
+ MessagingSystemAWSSQS = MessagingSystemKey.String("aws_sqs")
+ // Azure Event Grid
+ // Stability: development
+ MessagingSystemEventGrid = MessagingSystemKey.String("eventgrid")
+ // Azure Event Hubs
+ // Stability: development
+ MessagingSystemEventHubs = MessagingSystemKey.String("eventhubs")
+ // Azure Service Bus
+ // Stability: development
+ MessagingSystemServiceBus = MessagingSystemKey.String("servicebus")
+ // Google Cloud Pub/Sub
+ // Stability: development
+ MessagingSystemGCPPubSub = MessagingSystemKey.String("gcp_pubsub")
+ // Java Message Service
+ // Stability: development
+ MessagingSystemJMS = MessagingSystemKey.String("jms")
+ // Apache Kafka
+ // Stability: development
+ MessagingSystemKafka = MessagingSystemKey.String("kafka")
+ // RabbitMQ
+ // Stability: development
+ MessagingSystemRabbitMQ = MessagingSystemKey.String("rabbitmq")
+ // Apache RocketMQ
+ // Stability: development
+ MessagingSystemRocketMQ = MessagingSystemKey.String("rocketmq")
+ // Apache Pulsar
+ // Stability: development
+ MessagingSystemPulsar = MessagingSystemKey.String("pulsar")
+)
+
+// Namespace: network
+const (
+ // NetworkCarrierICCKey is the attribute Key conforming to the
+ // "network.carrier.icc" semantic conventions. It represents the ISO 3166-1
+ // alpha-2 2-character country code associated with the mobile carrier network.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: DE
+ NetworkCarrierICCKey = attribute.Key("network.carrier.icc")
+
+ // NetworkCarrierMCCKey is the attribute Key conforming to the
+ // "network.carrier.mcc" semantic conventions. It represents the mobile carrier
+ // country code.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 310
+ NetworkCarrierMCCKey = attribute.Key("network.carrier.mcc")
+
+ // NetworkCarrierMNCKey is the attribute Key conforming to the
+ // "network.carrier.mnc" semantic conventions. It represents the mobile carrier
+ // network code.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 001
+ NetworkCarrierMNCKey = attribute.Key("network.carrier.mnc")
+
+ // NetworkCarrierNameKey is the attribute Key conforming to the
+ // "network.carrier.name" semantic conventions. It represents the name of the
+ // mobile carrier.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: sprint
+ NetworkCarrierNameKey = attribute.Key("network.carrier.name")
+
+ // NetworkConnectionStateKey is the attribute Key conforming to the
+ // "network.connection.state" semantic conventions. It represents the state of
+ // network connection.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "close_wait"
+ // Note: Connection states are defined as part of the [rfc9293]
+ //
+ // [rfc9293]: https://datatracker.ietf.org/doc/html/rfc9293#section-3.3.2
+ NetworkConnectionStateKey = attribute.Key("network.connection.state")
+
+ // NetworkConnectionSubtypeKey is the attribute Key conforming to the
+ // "network.connection.subtype" semantic conventions. It represents the this
+ // describes more details regarding the connection.type. It may be the type of
+ // cell technology connection, but it could be used for describing details about
+ // a wifi connection.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: LTE
+ NetworkConnectionSubtypeKey = attribute.Key("network.connection.subtype")
+
+ // NetworkConnectionTypeKey is the attribute Key conforming to the
+ // "network.connection.type" semantic conventions. It represents the internet
+ // connection type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: wifi
+ NetworkConnectionTypeKey = attribute.Key("network.connection.type")
+
+ // NetworkInterfaceNameKey is the attribute Key conforming to the
+ // "network.interface.name" semantic conventions. It represents the network
+ // interface name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "lo", "eth0"
+ NetworkInterfaceNameKey = attribute.Key("network.interface.name")
+
+ // NetworkIODirectionKey is the attribute Key conforming to the
+ // "network.io.direction" semantic conventions. It represents the network IO
+ // operation direction.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "transmit"
+ NetworkIODirectionKey = attribute.Key("network.io.direction")
+
+ // NetworkLocalAddressKey is the attribute Key conforming to the
+ // "network.local.address" semantic conventions. It represents the local address
+ // of the network connection - IP address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "10.1.2.80", "/tmp/my.sock"
+ NetworkLocalAddressKey = attribute.Key("network.local.address")
+
+ // NetworkLocalPortKey is the attribute Key conforming to the
+ // "network.local.port" semantic conventions. It represents the local port
+ // number of the network connection.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 65123
+ NetworkLocalPortKey = attribute.Key("network.local.port")
+
+ // NetworkPeerAddressKey is the attribute Key conforming to the
+ // "network.peer.address" semantic conventions. It represents the peer address
+ // of the network connection - IP address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "10.1.2.80", "/tmp/my.sock"
+ NetworkPeerAddressKey = attribute.Key("network.peer.address")
+
+ // NetworkPeerPortKey is the attribute Key conforming to the "network.peer.port"
+ // semantic conventions. It represents the peer port number of the network
+ // connection.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 65123
+ NetworkPeerPortKey = attribute.Key("network.peer.port")
+
+ // NetworkProtocolNameKey is the attribute Key conforming to the
+ // "network.protocol.name" semantic conventions. It represents the
+ // [OSI application layer] or non-OSI equivalent.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "amqp", "http", "mqtt"
+ // Note: The value SHOULD be normalized to lowercase.
+ //
+ // [OSI application layer]: https://wikipedia.org/wiki/Application_layer
+ NetworkProtocolNameKey = attribute.Key("network.protocol.name")
+
+ // NetworkProtocolVersionKey is the attribute Key conforming to the
+ // "network.protocol.version" semantic conventions. It represents the actual
+ // version of the protocol used for network communication.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "1.1", "2"
+ // Note: If protocol version is subject to negotiation (for example using [ALPN]
+ // ), this attribute SHOULD be set to the negotiated version. If the actual
+ // protocol version is not known, this attribute SHOULD NOT be set.
+ //
+ // [ALPN]: https://www.rfc-editor.org/rfc/rfc7301.html
+ NetworkProtocolVersionKey = attribute.Key("network.protocol.version")
+
+ // NetworkTransportKey is the attribute Key conforming to the
+ // "network.transport" semantic conventions. It represents the
+ // [OSI transport layer] or [inter-process communication method].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "tcp", "udp"
+ // Note: The value SHOULD be normalized to lowercase.
+ //
+ // Consider always setting the transport when setting a port number, since
+ // a port number is ambiguous without knowing the transport. For example
+ // different processes could be listening on TCP port 12345 and UDP port 12345.
+ //
+ // [OSI transport layer]: https://wikipedia.org/wiki/Transport_layer
+ // [inter-process communication method]: https://wikipedia.org/wiki/Inter-process_communication
+ NetworkTransportKey = attribute.Key("network.transport")
+
+ // NetworkTypeKey is the attribute Key conforming to the "network.type" semantic
+ // conventions. It represents the [OSI network layer] or non-OSI equivalent.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "ipv4", "ipv6"
+ // Note: The value SHOULD be normalized to lowercase.
+ //
+ // [OSI network layer]: https://wikipedia.org/wiki/Network_layer
+ NetworkTypeKey = attribute.Key("network.type")
+)
+
+// NetworkCarrierICC returns an attribute KeyValue conforming to the
+// "network.carrier.icc" semantic conventions. It represents the ISO 3166-1
+// alpha-2 2-character country code associated with the mobile carrier network.
+func NetworkCarrierICC(val string) attribute.KeyValue {
+ return NetworkCarrierICCKey.String(val)
+}
+
+// NetworkCarrierMCC returns an attribute KeyValue conforming to the
+// "network.carrier.mcc" semantic conventions. It represents the mobile carrier
+// country code.
+func NetworkCarrierMCC(val string) attribute.KeyValue {
+ return NetworkCarrierMCCKey.String(val)
+}
+
+// NetworkCarrierMNC returns an attribute KeyValue conforming to the
+// "network.carrier.mnc" semantic conventions. It represents the mobile carrier
+// network code.
+func NetworkCarrierMNC(val string) attribute.KeyValue {
+ return NetworkCarrierMNCKey.String(val)
+}
+
+// NetworkCarrierName returns an attribute KeyValue conforming to the
+// "network.carrier.name" semantic conventions. It represents the name of the
+// mobile carrier.
+func NetworkCarrierName(val string) attribute.KeyValue {
+ return NetworkCarrierNameKey.String(val)
+}
+
+// NetworkInterfaceName returns an attribute KeyValue conforming to the
+// "network.interface.name" semantic conventions. It represents the network
+// interface name.
+func NetworkInterfaceName(val string) attribute.KeyValue {
+ return NetworkInterfaceNameKey.String(val)
+}
+
+// NetworkLocalAddress returns an attribute KeyValue conforming to the
+// "network.local.address" semantic conventions. It represents the local address
+// of the network connection - IP address or Unix domain socket name.
+func NetworkLocalAddress(val string) attribute.KeyValue {
+ return NetworkLocalAddressKey.String(val)
+}
+
+// NetworkLocalPort returns an attribute KeyValue conforming to the
+// "network.local.port" semantic conventions. It represents the local port number
+// of the network connection.
+func NetworkLocalPort(val int) attribute.KeyValue {
+ return NetworkLocalPortKey.Int(val)
+}
+
+// NetworkPeerAddress returns an attribute KeyValue conforming to the
+// "network.peer.address" semantic conventions. It represents the peer address of
+// the network connection - IP address or Unix domain socket name.
+func NetworkPeerAddress(val string) attribute.KeyValue {
+ return NetworkPeerAddressKey.String(val)
+}
+
+// NetworkPeerPort returns an attribute KeyValue conforming to the
+// "network.peer.port" semantic conventions. It represents the peer port number
+// of the network connection.
+func NetworkPeerPort(val int) attribute.KeyValue {
+ return NetworkPeerPortKey.Int(val)
+}
+
+// NetworkProtocolName returns an attribute KeyValue conforming to the
+// "network.protocol.name" semantic conventions. It represents the
+// [OSI application layer] or non-OSI equivalent.
+//
+// [OSI application layer]: https://wikipedia.org/wiki/Application_layer
+func NetworkProtocolName(val string) attribute.KeyValue {
+ return NetworkProtocolNameKey.String(val)
+}
+
+// NetworkProtocolVersion returns an attribute KeyValue conforming to the
+// "network.protocol.version" semantic conventions. It represents the actual
+// version of the protocol used for network communication.
+func NetworkProtocolVersion(val string) attribute.KeyValue {
+ return NetworkProtocolVersionKey.String(val)
+}
+
+// Enum values for network.connection.state
+var (
+ // closed
+ // Stability: development
+ NetworkConnectionStateClosed = NetworkConnectionStateKey.String("closed")
+ // close_wait
+ // Stability: development
+ NetworkConnectionStateCloseWait = NetworkConnectionStateKey.String("close_wait")
+ // closing
+ // Stability: development
+ NetworkConnectionStateClosing = NetworkConnectionStateKey.String("closing")
+ // established
+ // Stability: development
+ NetworkConnectionStateEstablished = NetworkConnectionStateKey.String("established")
+ // fin_wait_1
+ // Stability: development
+ NetworkConnectionStateFinWait1 = NetworkConnectionStateKey.String("fin_wait_1")
+ // fin_wait_2
+ // Stability: development
+ NetworkConnectionStateFinWait2 = NetworkConnectionStateKey.String("fin_wait_2")
+ // last_ack
+ // Stability: development
+ NetworkConnectionStateLastAck = NetworkConnectionStateKey.String("last_ack")
+ // listen
+ // Stability: development
+ NetworkConnectionStateListen = NetworkConnectionStateKey.String("listen")
+ // syn_received
+ // Stability: development
+ NetworkConnectionStateSynReceived = NetworkConnectionStateKey.String("syn_received")
+ // syn_sent
+ // Stability: development
+ NetworkConnectionStateSynSent = NetworkConnectionStateKey.String("syn_sent")
+ // time_wait
+ // Stability: development
+ NetworkConnectionStateTimeWait = NetworkConnectionStateKey.String("time_wait")
+)
+
+// Enum values for network.connection.subtype
+var (
+ // GPRS
+ // Stability: development
+ NetworkConnectionSubtypeGprs = NetworkConnectionSubtypeKey.String("gprs")
+ // EDGE
+ // Stability: development
+ NetworkConnectionSubtypeEdge = NetworkConnectionSubtypeKey.String("edge")
+ // UMTS
+ // Stability: development
+ NetworkConnectionSubtypeUmts = NetworkConnectionSubtypeKey.String("umts")
+ // CDMA
+ // Stability: development
+ NetworkConnectionSubtypeCdma = NetworkConnectionSubtypeKey.String("cdma")
+ // EVDO Rel. 0
+ // Stability: development
+ NetworkConnectionSubtypeEvdo0 = NetworkConnectionSubtypeKey.String("evdo_0")
+ // EVDO Rev. A
+ // Stability: development
+ NetworkConnectionSubtypeEvdoA = NetworkConnectionSubtypeKey.String("evdo_a")
+ // CDMA2000 1XRTT
+ // Stability: development
+ NetworkConnectionSubtypeCdma20001xrtt = NetworkConnectionSubtypeKey.String("cdma2000_1xrtt")
+ // HSDPA
+ // Stability: development
+ NetworkConnectionSubtypeHsdpa = NetworkConnectionSubtypeKey.String("hsdpa")
+ // HSUPA
+ // Stability: development
+ NetworkConnectionSubtypeHsupa = NetworkConnectionSubtypeKey.String("hsupa")
+ // HSPA
+ // Stability: development
+ NetworkConnectionSubtypeHspa = NetworkConnectionSubtypeKey.String("hspa")
+ // IDEN
+ // Stability: development
+ NetworkConnectionSubtypeIden = NetworkConnectionSubtypeKey.String("iden")
+ // EVDO Rev. B
+ // Stability: development
+ NetworkConnectionSubtypeEvdoB = NetworkConnectionSubtypeKey.String("evdo_b")
+ // LTE
+ // Stability: development
+ NetworkConnectionSubtypeLte = NetworkConnectionSubtypeKey.String("lte")
+ // EHRPD
+ // Stability: development
+ NetworkConnectionSubtypeEhrpd = NetworkConnectionSubtypeKey.String("ehrpd")
+ // HSPAP
+ // Stability: development
+ NetworkConnectionSubtypeHspap = NetworkConnectionSubtypeKey.String("hspap")
+ // GSM
+ // Stability: development
+ NetworkConnectionSubtypeGsm = NetworkConnectionSubtypeKey.String("gsm")
+ // TD-SCDMA
+ // Stability: development
+ NetworkConnectionSubtypeTdScdma = NetworkConnectionSubtypeKey.String("td_scdma")
+ // IWLAN
+ // Stability: development
+ NetworkConnectionSubtypeIwlan = NetworkConnectionSubtypeKey.String("iwlan")
+ // 5G NR (New Radio)
+ // Stability: development
+ NetworkConnectionSubtypeNr = NetworkConnectionSubtypeKey.String("nr")
+ // 5G NRNSA (New Radio Non-Standalone)
+ // Stability: development
+ NetworkConnectionSubtypeNrnsa = NetworkConnectionSubtypeKey.String("nrnsa")
+ // LTE CA
+ // Stability: development
+ NetworkConnectionSubtypeLteCa = NetworkConnectionSubtypeKey.String("lte_ca")
+)
+
+// Enum values for network.connection.type
+var (
+ // wifi
+ // Stability: development
+ NetworkConnectionTypeWifi = NetworkConnectionTypeKey.String("wifi")
+ // wired
+ // Stability: development
+ NetworkConnectionTypeWired = NetworkConnectionTypeKey.String("wired")
+ // cell
+ // Stability: development
+ NetworkConnectionTypeCell = NetworkConnectionTypeKey.String("cell")
+ // unavailable
+ // Stability: development
+ NetworkConnectionTypeUnavailable = NetworkConnectionTypeKey.String("unavailable")
+ // unknown
+ // Stability: development
+ NetworkConnectionTypeUnknown = NetworkConnectionTypeKey.String("unknown")
+)
+
+// Enum values for network.io.direction
+var (
+ // transmit
+ // Stability: development
+ NetworkIODirectionTransmit = NetworkIODirectionKey.String("transmit")
+ // receive
+ // Stability: development
+ NetworkIODirectionReceive = NetworkIODirectionKey.String("receive")
+)
+
+// Enum values for network.transport
+var (
+ // TCP
+ // Stability: stable
+ NetworkTransportTCP = NetworkTransportKey.String("tcp")
+ // UDP
+ // Stability: stable
+ NetworkTransportUDP = NetworkTransportKey.String("udp")
+ // Named or anonymous pipe.
+ // Stability: stable
+ NetworkTransportPipe = NetworkTransportKey.String("pipe")
+ // Unix domain socket
+ // Stability: stable
+ NetworkTransportUnix = NetworkTransportKey.String("unix")
+ // QUIC
+ // Stability: stable
+ NetworkTransportQUIC = NetworkTransportKey.String("quic")
+)
+
+// Enum values for network.type
+var (
+ // IPv4
+ // Stability: stable
+ NetworkTypeIPv4 = NetworkTypeKey.String("ipv4")
+ // IPv6
+ // Stability: stable
+ NetworkTypeIPv6 = NetworkTypeKey.String("ipv6")
+)
+
+// Namespace: oci
+const (
+ // OCIManifestDigestKey is the attribute Key conforming to the
+ // "oci.manifest.digest" semantic conventions. It represents the digest of the
+ // OCI image manifest. For container images specifically is the digest by which
+ // the container image is known.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "sha256:e4ca62c0d62f3e886e684806dfe9d4e0cda60d54986898173c1083856cfda0f4"
+ // Note: Follows [OCI Image Manifest Specification], and specifically the
+ // [Digest property].
+ // An example can be found in [Example Image Manifest].
+ //
+ // [OCI Image Manifest Specification]: https://github.com/opencontainers/image-spec/blob/main/manifest.md
+ // [Digest property]: https://github.com/opencontainers/image-spec/blob/main/descriptor.md#digests
+ // [Example Image Manifest]: https://github.com/opencontainers/image-spec/blob/main/manifest.md#example-image-manifest
+ OCIManifestDigestKey = attribute.Key("oci.manifest.digest")
+)
+
+// OCIManifestDigest returns an attribute KeyValue conforming to the
+// "oci.manifest.digest" semantic conventions. It represents the digest of the
+// OCI image manifest. For container images specifically is the digest by which
+// the container image is known.
+func OCIManifestDigest(val string) attribute.KeyValue {
+ return OCIManifestDigestKey.String(val)
+}
+
+// Namespace: opentracing
+const (
+ // OpenTracingRefTypeKey is the attribute Key conforming to the
+ // "opentracing.ref_type" semantic conventions. It represents the parent-child
+ // Reference type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: The causal relationship between a child Span and a parent Span.
+ OpenTracingRefTypeKey = attribute.Key("opentracing.ref_type")
+)
+
+// Enum values for opentracing.ref_type
+var (
+ // The parent Span depends on the child Span in some capacity
+ // Stability: development
+ OpenTracingRefTypeChildOf = OpenTracingRefTypeKey.String("child_of")
+ // The parent Span doesn't depend in any way on the result of the child Span
+ // Stability: development
+ OpenTracingRefTypeFollowsFrom = OpenTracingRefTypeKey.String("follows_from")
+)
+
+// Namespace: os
+const (
+ // OSBuildIDKey is the attribute Key conforming to the "os.build_id" semantic
+ // conventions. It represents the unique identifier for a particular build or
+ // compilation of the operating system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TQ3C.230805.001.B2", "20E247", "22621"
+ OSBuildIDKey = attribute.Key("os.build_id")
+
+ // OSDescriptionKey is the attribute Key conforming to the "os.description"
+ // semantic conventions. It represents the human readable (not intended to be
+ // parsed) OS version information, like e.g. reported by `ver` or
+ // `lsb_release -a` commands.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Microsoft Windows [Version 10.0.18363.778]", "Ubuntu 18.04.1 LTS"
+ OSDescriptionKey = attribute.Key("os.description")
+
+ // OSNameKey is the attribute Key conforming to the "os.name" semantic
+ // conventions. It represents the human readable operating system name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "iOS", "Android", "Ubuntu"
+ OSNameKey = attribute.Key("os.name")
+
+ // OSTypeKey is the attribute Key conforming to the "os.type" semantic
+ // conventions. It represents the operating system type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ OSTypeKey = attribute.Key("os.type")
+
+ // OSVersionKey is the attribute Key conforming to the "os.version" semantic
+ // conventions. It represents the version string of the operating system as
+ // defined in [Version Attributes].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "14.2.1", "18.04.1"
+ //
+ // [Version Attributes]: /docs/resource/README.md#version-attributes
+ OSVersionKey = attribute.Key("os.version")
+)
+
+// OSBuildID returns an attribute KeyValue conforming to the "os.build_id"
+// semantic conventions. It represents the unique identifier for a particular
+// build or compilation of the operating system.
+func OSBuildID(val string) attribute.KeyValue {
+ return OSBuildIDKey.String(val)
+}
+
+// OSDescription returns an attribute KeyValue conforming to the "os.description"
+// semantic conventions. It represents the human readable (not intended to be
+// parsed) OS version information, like e.g. reported by `ver` or
+// `lsb_release -a` commands.
+func OSDescription(val string) attribute.KeyValue {
+ return OSDescriptionKey.String(val)
+}
+
+// OSName returns an attribute KeyValue conforming to the "os.name" semantic
+// conventions. It represents the human readable operating system name.
+func OSName(val string) attribute.KeyValue {
+ return OSNameKey.String(val)
+}
+
+// OSVersion returns an attribute KeyValue conforming to the "os.version"
+// semantic conventions. It represents the version string of the operating system
+// as defined in [Version Attributes].
+//
+// [Version Attributes]: /docs/resource/README.md#version-attributes
+func OSVersion(val string) attribute.KeyValue {
+ return OSVersionKey.String(val)
+}
+
+// Enum values for os.type
+var (
+ // Microsoft Windows
+ // Stability: development
+ OSTypeWindows = OSTypeKey.String("windows")
+ // Linux
+ // Stability: development
+ OSTypeLinux = OSTypeKey.String("linux")
+ // Apple Darwin
+ // Stability: development
+ OSTypeDarwin = OSTypeKey.String("darwin")
+ // FreeBSD
+ // Stability: development
+ OSTypeFreeBSD = OSTypeKey.String("freebsd")
+ // NetBSD
+ // Stability: development
+ OSTypeNetBSD = OSTypeKey.String("netbsd")
+ // OpenBSD
+ // Stability: development
+ OSTypeOpenBSD = OSTypeKey.String("openbsd")
+ // DragonFly BSD
+ // Stability: development
+ OSTypeDragonflyBSD = OSTypeKey.String("dragonflybsd")
+ // HP-UX (Hewlett Packard Unix)
+ // Stability: development
+ OSTypeHPUX = OSTypeKey.String("hpux")
+ // AIX (Advanced Interactive eXecutive)
+ // Stability: development
+ OSTypeAIX = OSTypeKey.String("aix")
+ // SunOS, Oracle Solaris
+ // Stability: development
+ OSTypeSolaris = OSTypeKey.String("solaris")
+ // IBM z/OS
+ // Stability: development
+ OSTypeZOS = OSTypeKey.String("z_os")
+)
+
+// Namespace: otel
+const (
+ // OTelComponentNameKey is the attribute Key conforming to the
+ // "otel.component.name" semantic conventions. It represents a name uniquely
+ // identifying the instance of the OpenTelemetry component within its containing
+ // SDK instance.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otlp_grpc_span_exporter/0", "custom-name"
+ // Note: Implementations SHOULD ensure a low cardinality for this attribute,
+ // even across application or SDK restarts.
+ // E.g. implementations MUST NOT use UUIDs as values for this attribute.
+ //
+ // Implementations MAY achieve these goals by following a
+ // `/` pattern, e.g.
+ // `batching_span_processor/0`.
+ // Hereby `otel.component.type` refers to the corresponding attribute value of
+ // the component.
+ //
+ // The value of `instance-counter` MAY be automatically assigned by the
+ // component and uniqueness within the enclosing SDK instance MUST be
+ // guaranteed.
+ // For example, `` MAY be implemented by using a monotonically
+ // increasing counter (starting with `0`), which is incremented every time an
+ // instance of the given component type is started.
+ //
+ // With this implementation, for example the first Batching Span Processor would
+ // have `batching_span_processor/0`
+ // as `otel.component.name`, the second one `batching_span_processor/1` and so
+ // on.
+ // These values will therefore be reused in the case of an application restart.
+ OTelComponentNameKey = attribute.Key("otel.component.name")
+
+ // OTelComponentTypeKey is the attribute Key conforming to the
+ // "otel.component.type" semantic conventions. It represents a name identifying
+ // the type of the OpenTelemetry component.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "batching_span_processor", "com.example.MySpanExporter"
+ // Note: If none of the standardized values apply, implementations SHOULD use
+ // the language-defined name of the type.
+ // E.g. for Java the fully qualified classname SHOULD be used in this case.
+ OTelComponentTypeKey = attribute.Key("otel.component.type")
+
+ // OTelScopeNameKey is the attribute Key conforming to the "otel.scope.name"
+ // semantic conventions. It represents the name of the instrumentation scope - (
+ // `InstrumentationScope.Name` in OTLP).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "io.opentelemetry.contrib.mongodb"
+ OTelScopeNameKey = attribute.Key("otel.scope.name")
+
+ // OTelScopeVersionKey is the attribute Key conforming to the
+ // "otel.scope.version" semantic conventions. It represents the version of the
+ // instrumentation scope - (`InstrumentationScope.Version` in OTLP).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "1.0.0"
+ OTelScopeVersionKey = attribute.Key("otel.scope.version")
+
+ // OTelSpanSamplingResultKey is the attribute Key conforming to the
+ // "otel.span.sampling_result" semantic conventions. It represents the result
+ // value of the sampler for this span.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ OTelSpanSamplingResultKey = attribute.Key("otel.span.sampling_result")
+
+ // OTelStatusCodeKey is the attribute Key conforming to the "otel.status_code"
+ // semantic conventions. It represents the name of the code, either "OK" or
+ // "ERROR". MUST NOT be set if the status code is UNSET.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples:
+ OTelStatusCodeKey = attribute.Key("otel.status_code")
+
+ // OTelStatusDescriptionKey is the attribute Key conforming to the
+ // "otel.status_description" semantic conventions. It represents the description
+ // of the Status if it has a value, otherwise not set.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "resource not found"
+ OTelStatusDescriptionKey = attribute.Key("otel.status_description")
+)
+
+// OTelComponentName returns an attribute KeyValue conforming to the
+// "otel.component.name" semantic conventions. It represents a name uniquely
+// identifying the instance of the OpenTelemetry component within its containing
+// SDK instance.
+func OTelComponentName(val string) attribute.KeyValue {
+ return OTelComponentNameKey.String(val)
+}
+
+// OTelScopeName returns an attribute KeyValue conforming to the
+// "otel.scope.name" semantic conventions. It represents the name of the
+// instrumentation scope - (`InstrumentationScope.Name` in OTLP).
+func OTelScopeName(val string) attribute.KeyValue {
+ return OTelScopeNameKey.String(val)
+}
+
+// OTelScopeVersion returns an attribute KeyValue conforming to the
+// "otel.scope.version" semantic conventions. It represents the version of the
+// instrumentation scope - (`InstrumentationScope.Version` in OTLP).
+func OTelScopeVersion(val string) attribute.KeyValue {
+ return OTelScopeVersionKey.String(val)
+}
+
+// OTelStatusDescription returns an attribute KeyValue conforming to the
+// "otel.status_description" semantic conventions. It represents the description
+// of the Status if it has a value, otherwise not set.
+func OTelStatusDescription(val string) attribute.KeyValue {
+ return OTelStatusDescriptionKey.String(val)
+}
+
+// Enum values for otel.component.type
+var (
+ // The builtin SDK batching span processor
+ //
+ // Stability: development
+ OTelComponentTypeBatchingSpanProcessor = OTelComponentTypeKey.String("batching_span_processor")
+ // The builtin SDK simple span processor
+ //
+ // Stability: development
+ OTelComponentTypeSimpleSpanProcessor = OTelComponentTypeKey.String("simple_span_processor")
+ // The builtin SDK batching log record processor
+ //
+ // Stability: development
+ OTelComponentTypeBatchingLogProcessor = OTelComponentTypeKey.String("batching_log_processor")
+ // The builtin SDK simple log record processor
+ //
+ // Stability: development
+ OTelComponentTypeSimpleLogProcessor = OTelComponentTypeKey.String("simple_log_processor")
+ // OTLP span exporter over gRPC with protobuf serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpGRPCSpanExporter = OTelComponentTypeKey.String("otlp_grpc_span_exporter")
+ // OTLP span exporter over HTTP with protobuf serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpHTTPSpanExporter = OTelComponentTypeKey.String("otlp_http_span_exporter")
+ // OTLP span exporter over HTTP with JSON serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpHTTPJSONSpanExporter = OTelComponentTypeKey.String("otlp_http_json_span_exporter")
+ // OTLP log record exporter over gRPC with protobuf serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpGRPCLogExporter = OTelComponentTypeKey.String("otlp_grpc_log_exporter")
+ // OTLP log record exporter over HTTP with protobuf serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpHTTPLogExporter = OTelComponentTypeKey.String("otlp_http_log_exporter")
+ // OTLP log record exporter over HTTP with JSON serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpHTTPJSONLogExporter = OTelComponentTypeKey.String("otlp_http_json_log_exporter")
+ // The builtin SDK periodically exporting metric reader
+ //
+ // Stability: development
+ OTelComponentTypePeriodicMetricReader = OTelComponentTypeKey.String("periodic_metric_reader")
+ // OTLP metric exporter over gRPC with protobuf serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpGRPCMetricExporter = OTelComponentTypeKey.String("otlp_grpc_metric_exporter")
+ // OTLP metric exporter over HTTP with protobuf serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpHTTPMetricExporter = OTelComponentTypeKey.String("otlp_http_metric_exporter")
+ // OTLP metric exporter over HTTP with JSON serialization
+ //
+ // Stability: development
+ OTelComponentTypeOtlpHTTPJSONMetricExporter = OTelComponentTypeKey.String("otlp_http_json_metric_exporter")
+)
+
+// Enum values for otel.span.sampling_result
+var (
+ // The span is not sampled and not recording
+ // Stability: development
+ OTelSpanSamplingResultDrop = OTelSpanSamplingResultKey.String("DROP")
+ // The span is not sampled, but recording
+ // Stability: development
+ OTelSpanSamplingResultRecordOnly = OTelSpanSamplingResultKey.String("RECORD_ONLY")
+ // The span is sampled and recording
+ // Stability: development
+ OTelSpanSamplingResultRecordAndSample = OTelSpanSamplingResultKey.String("RECORD_AND_SAMPLE")
+)
+
+// Enum values for otel.status_code
+var (
+ // The operation has been validated by an Application developer or Operator to
+ // have completed successfully.
+ // Stability: stable
+ OTelStatusCodeOk = OTelStatusCodeKey.String("OK")
+ // The operation contains an error.
+ // Stability: stable
+ OTelStatusCodeError = OTelStatusCodeKey.String("ERROR")
+)
+
+// Namespace: peer
+const (
+ // PeerServiceKey is the attribute Key conforming to the "peer.service" semantic
+ // conventions. It represents the [`service.name`] of the remote service. SHOULD
+ // be equal to the actual `service.name` resource attribute of the remote
+ // service if any.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: AuthTokenCache
+ //
+ // [`service.name`]: /docs/resource/README.md#service
+ PeerServiceKey = attribute.Key("peer.service")
+)
+
+// PeerService returns an attribute KeyValue conforming to the "peer.service"
+// semantic conventions. It represents the [`service.name`] of the remote
+// service. SHOULD be equal to the actual `service.name` resource attribute of
+// the remote service if any.
+//
+// [`service.name`]: /docs/resource/README.md#service
+func PeerService(val string) attribute.KeyValue {
+ return PeerServiceKey.String(val)
+}
+
+// Namespace: process
+const (
+ // ProcessArgsCountKey is the attribute Key conforming to the
+ // "process.args_count" semantic conventions. It represents the length of the
+ // process.command_args array.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 4
+ // Note: This field can be useful for querying or performing bucket analysis on
+ // how many arguments were provided to start a process. More arguments may be an
+ // indication of suspicious activity.
+ ProcessArgsCountKey = attribute.Key("process.args_count")
+
+ // ProcessCommandKey is the attribute Key conforming to the "process.command"
+ // semantic conventions. It represents the command used to launch the process
+ // (i.e. the command name). On Linux based systems, can be set to the zeroth
+ // string in `proc/[pid]/cmdline`. On Windows, can be set to the first parameter
+ // extracted from `GetCommandLineW`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cmd/otelcol"
+ ProcessCommandKey = attribute.Key("process.command")
+
+ // ProcessCommandArgsKey is the attribute Key conforming to the
+ // "process.command_args" semantic conventions. It represents the all the
+ // command arguments (including the command/executable itself) as received by
+ // the process. On Linux-based systems (and some other Unixoid systems
+ // supporting procfs), can be set according to the list of null-delimited
+ // strings extracted from `proc/[pid]/cmdline`. For libc-based executables, this
+ // would be the full argv vector passed to `main`. SHOULD NOT be collected by
+ // default unless there is sanitization that excludes sensitive data.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cmd/otecol", "--config=config.yaml"
+ ProcessCommandArgsKey = attribute.Key("process.command_args")
+
+ // ProcessCommandLineKey is the attribute Key conforming to the
+ // "process.command_line" semantic conventions. It represents the full command
+ // used to launch the process as a single string representing the full command.
+ // On Windows, can be set to the result of `GetCommandLineW`. Do not set this if
+ // you have to assemble it just for monitoring; use `process.command_args`
+ // instead. SHOULD NOT be collected by default unless there is sanitization that
+ // excludes sensitive data.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "C:\cmd\otecol --config="my directory\config.yaml""
+ ProcessCommandLineKey = attribute.Key("process.command_line")
+
+ // ProcessContextSwitchTypeKey is the attribute Key conforming to the
+ // "process.context_switch_type" semantic conventions. It represents the
+ // specifies whether the context switches for this data point were voluntary or
+ // involuntary.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ ProcessContextSwitchTypeKey = attribute.Key("process.context_switch_type")
+
+ // ProcessCreationTimeKey is the attribute Key conforming to the
+ // "process.creation.time" semantic conventions. It represents the date and time
+ // the process was created, in ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2023-11-21T09:25:34.853Z"
+ ProcessCreationTimeKey = attribute.Key("process.creation.time")
+
+ // ProcessExecutableBuildIDGNUKey is the attribute Key conforming to the
+ // "process.executable.build_id.gnu" semantic conventions. It represents the GNU
+ // build ID as found in the `.note.gnu.build-id` ELF section (hex string).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "c89b11207f6479603b0d49bf291c092c2b719293"
+ ProcessExecutableBuildIDGNUKey = attribute.Key("process.executable.build_id.gnu")
+
+ // ProcessExecutableBuildIDGoKey is the attribute Key conforming to the
+ // "process.executable.build_id.go" semantic conventions. It represents the Go
+ // build ID as retrieved by `go tool buildid `.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "foh3mEXu7BLZjsN9pOwG/kATcXlYVCDEFouRMQed_/WwRFB1hPo9LBkekthSPG/x8hMC8emW2cCjXD0_1aY"
+ ProcessExecutableBuildIDGoKey = attribute.Key("process.executable.build_id.go")
+
+ // ProcessExecutableBuildIDHtlhashKey is the attribute Key conforming to the
+ // "process.executable.build_id.htlhash" semantic conventions. It represents the
+ // profiling specific build ID for executables. See the OTel specification for
+ // Profiles for more information.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "600DCAFE4A110000F2BF38C493F5FB92"
+ ProcessExecutableBuildIDHtlhashKey = attribute.Key("process.executable.build_id.htlhash")
+
+ // ProcessExecutableNameKey is the attribute Key conforming to the
+ // "process.executable.name" semantic conventions. It represents the name of the
+ // process executable. On Linux based systems, this SHOULD be set to the base
+ // name of the target of `/proc/[pid]/exe`. On Windows, this SHOULD be set to
+ // the base name of `GetProcessImageFileNameW`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "otelcol"
+ ProcessExecutableNameKey = attribute.Key("process.executable.name")
+
+ // ProcessExecutablePathKey is the attribute Key conforming to the
+ // "process.executable.path" semantic conventions. It represents the full path
+ // to the process executable. On Linux based systems, can be set to the target
+ // of `proc/[pid]/exe`. On Windows, can be set to the result of
+ // `GetProcessImageFileNameW`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/usr/bin/cmd/otelcol"
+ ProcessExecutablePathKey = attribute.Key("process.executable.path")
+
+ // ProcessExitCodeKey is the attribute Key conforming to the "process.exit.code"
+ // semantic conventions. It represents the exit code of the process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 127
+ ProcessExitCodeKey = attribute.Key("process.exit.code")
+
+ // ProcessExitTimeKey is the attribute Key conforming to the "process.exit.time"
+ // semantic conventions. It represents the date and time the process exited, in
+ // ISO 8601 format.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2023-11-21T09:26:12.315Z"
+ ProcessExitTimeKey = attribute.Key("process.exit.time")
+
+ // ProcessGroupLeaderPIDKey is the attribute Key conforming to the
+ // "process.group_leader.pid" semantic conventions. It represents the PID of the
+ // process's group leader. This is also the process group ID (PGID) of the
+ // process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 23
+ ProcessGroupLeaderPIDKey = attribute.Key("process.group_leader.pid")
+
+ // ProcessInteractiveKey is the attribute Key conforming to the
+ // "process.interactive" semantic conventions. It represents the whether the
+ // process is connected to an interactive shell.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ ProcessInteractiveKey = attribute.Key("process.interactive")
+
+ // ProcessLinuxCgroupKey is the attribute Key conforming to the
+ // "process.linux.cgroup" semantic conventions. It represents the control group
+ // associated with the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1:name=systemd:/user.slice/user-1000.slice/session-3.scope",
+ // "0::/user.slice/user-1000.slice/user@1000.service/tmux-spawn-0267755b-4639-4a27-90ed-f19f88e53748.scope"
+ // Note: Control groups (cgroups) are a kernel feature used to organize and
+ // manage process resources. This attribute provides the path(s) to the
+ // cgroup(s) associated with the process, which should match the contents of the
+ // [/proc/[PID]/cgroup] file.
+ //
+ // [/proc/[PID]/cgroup]: https://man7.org/linux/man-pages/man7/cgroups.7.html
+ ProcessLinuxCgroupKey = attribute.Key("process.linux.cgroup")
+
+ // ProcessOwnerKey is the attribute Key conforming to the "process.owner"
+ // semantic conventions. It represents the username of the user that owns the
+ // process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "root"
+ ProcessOwnerKey = attribute.Key("process.owner")
+
+ // ProcessPagingFaultTypeKey is the attribute Key conforming to the
+ // "process.paging.fault_type" semantic conventions. It represents the type of
+ // page fault for this data point. Type `major` is for major/hard page faults,
+ // and `minor` is for minor/soft page faults.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ ProcessPagingFaultTypeKey = attribute.Key("process.paging.fault_type")
+
+ // ProcessParentPIDKey is the attribute Key conforming to the
+ // "process.parent_pid" semantic conventions. It represents the parent Process
+ // identifier (PPID).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 111
+ ProcessParentPIDKey = attribute.Key("process.parent_pid")
+
+ // ProcessPIDKey is the attribute Key conforming to the "process.pid" semantic
+ // conventions. It represents the process identifier (PID).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1234
+ ProcessPIDKey = attribute.Key("process.pid")
+
+ // ProcessRealUserIDKey is the attribute Key conforming to the
+ // "process.real_user.id" semantic conventions. It represents the real user ID
+ // (RUID) of the process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1000
+ ProcessRealUserIDKey = attribute.Key("process.real_user.id")
+
+ // ProcessRealUserNameKey is the attribute Key conforming to the
+ // "process.real_user.name" semantic conventions. It represents the username of
+ // the real user of the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "operator"
+ ProcessRealUserNameKey = attribute.Key("process.real_user.name")
+
+ // ProcessRuntimeDescriptionKey is the attribute Key conforming to the
+ // "process.runtime.description" semantic conventions. It represents an
+ // additional description about the runtime of the process, for example a
+ // specific vendor customization of the runtime environment.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: Eclipse OpenJ9 Eclipse OpenJ9 VM openj9-0.21.0
+ ProcessRuntimeDescriptionKey = attribute.Key("process.runtime.description")
+
+ // ProcessRuntimeNameKey is the attribute Key conforming to the
+ // "process.runtime.name" semantic conventions. It represents the name of the
+ // runtime of this process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "OpenJDK Runtime Environment"
+ ProcessRuntimeNameKey = attribute.Key("process.runtime.name")
+
+ // ProcessRuntimeVersionKey is the attribute Key conforming to the
+ // "process.runtime.version" semantic conventions. It represents the version of
+ // the runtime of this process, as returned by the runtime without modification.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 14.0.2
+ ProcessRuntimeVersionKey = attribute.Key("process.runtime.version")
+
+ // ProcessSavedUserIDKey is the attribute Key conforming to the
+ // "process.saved_user.id" semantic conventions. It represents the saved user ID
+ // (SUID) of the process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1002
+ ProcessSavedUserIDKey = attribute.Key("process.saved_user.id")
+
+ // ProcessSavedUserNameKey is the attribute Key conforming to the
+ // "process.saved_user.name" semantic conventions. It represents the username of
+ // the saved user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "operator"
+ ProcessSavedUserNameKey = attribute.Key("process.saved_user.name")
+
+ // ProcessSessionLeaderPIDKey is the attribute Key conforming to the
+ // "process.session_leader.pid" semantic conventions. It represents the PID of
+ // the process's session leader. This is also the session ID (SID) of the
+ // process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 14
+ ProcessSessionLeaderPIDKey = attribute.Key("process.session_leader.pid")
+
+ // ProcessTitleKey is the attribute Key conforming to the "process.title"
+ // semantic conventions. It represents the process title (proctitle).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cat /etc/hostname", "xfce4-session", "bash"
+ // Note: In many Unix-like systems, process title (proctitle), is the string
+ // that represents the name or command line of a running process, displayed by
+ // system monitoring tools like ps, top, and htop.
+ ProcessTitleKey = attribute.Key("process.title")
+
+ // ProcessUserIDKey is the attribute Key conforming to the "process.user.id"
+ // semantic conventions. It represents the effective user ID (EUID) of the
+ // process.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1001
+ ProcessUserIDKey = attribute.Key("process.user.id")
+
+ // ProcessUserNameKey is the attribute Key conforming to the "process.user.name"
+ // semantic conventions. It represents the username of the effective user of the
+ // process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "root"
+ ProcessUserNameKey = attribute.Key("process.user.name")
+
+ // ProcessVpidKey is the attribute Key conforming to the "process.vpid" semantic
+ // conventions. It represents the virtual process identifier.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 12
+ // Note: The process ID within a PID namespace. This is not necessarily unique
+ // across all processes on the host but it is unique within the process
+ // namespace that the process exists within.
+ ProcessVpidKey = attribute.Key("process.vpid")
+
+ // ProcessWorkingDirectoryKey is the attribute Key conforming to the
+ // "process.working_directory" semantic conventions. It represents the working
+ // directory of the process.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/root"
+ ProcessWorkingDirectoryKey = attribute.Key("process.working_directory")
+)
+
+// ProcessArgsCount returns an attribute KeyValue conforming to the
+// "process.args_count" semantic conventions. It represents the length of the
+// process.command_args array.
+func ProcessArgsCount(val int) attribute.KeyValue {
+ return ProcessArgsCountKey.Int(val)
+}
+
+// ProcessCommand returns an attribute KeyValue conforming to the
+// "process.command" semantic conventions. It represents the command used to
+// launch the process (i.e. the command name). On Linux based systems, can be set
+// to the zeroth string in `proc/[pid]/cmdline`. On Windows, can be set to the
+// first parameter extracted from `GetCommandLineW`.
+func ProcessCommand(val string) attribute.KeyValue {
+ return ProcessCommandKey.String(val)
+}
+
+// ProcessCommandArgs returns an attribute KeyValue conforming to the
+// "process.command_args" semantic conventions. It represents the all the command
+// arguments (including the command/executable itself) as received by the
+// process. On Linux-based systems (and some other Unixoid systems supporting
+// procfs), can be set according to the list of null-delimited strings extracted
+// from `proc/[pid]/cmdline`. For libc-based executables, this would be the full
+// argv vector passed to `main`. SHOULD NOT be collected by default unless there
+// is sanitization that excludes sensitive data.
+func ProcessCommandArgs(val ...string) attribute.KeyValue {
+ return ProcessCommandArgsKey.StringSlice(val)
+}
+
+// ProcessCommandLine returns an attribute KeyValue conforming to the
+// "process.command_line" semantic conventions. It represents the full command
+// used to launch the process as a single string representing the full command.
+// On Windows, can be set to the result of `GetCommandLineW`. Do not set this if
+// you have to assemble it just for monitoring; use `process.command_args`
+// instead. SHOULD NOT be collected by default unless there is sanitization that
+// excludes sensitive data.
+func ProcessCommandLine(val string) attribute.KeyValue {
+ return ProcessCommandLineKey.String(val)
+}
+
+// ProcessCreationTime returns an attribute KeyValue conforming to the
+// "process.creation.time" semantic conventions. It represents the date and time
+// the process was created, in ISO 8601 format.
+func ProcessCreationTime(val string) attribute.KeyValue {
+ return ProcessCreationTimeKey.String(val)
+}
+
+// ProcessExecutableBuildIDGNU returns an attribute KeyValue conforming to the
+// "process.executable.build_id.gnu" semantic conventions. It represents the GNU
+// build ID as found in the `.note.gnu.build-id` ELF section (hex string).
+func ProcessExecutableBuildIDGNU(val string) attribute.KeyValue {
+ return ProcessExecutableBuildIDGNUKey.String(val)
+}
+
+// ProcessExecutableBuildIDGo returns an attribute KeyValue conforming to the
+// "process.executable.build_id.go" semantic conventions. It represents the Go
+// build ID as retrieved by `go tool buildid `.
+func ProcessExecutableBuildIDGo(val string) attribute.KeyValue {
+ return ProcessExecutableBuildIDGoKey.String(val)
+}
+
+// ProcessExecutableBuildIDHtlhash returns an attribute KeyValue conforming to
+// the "process.executable.build_id.htlhash" semantic conventions. It represents
+// the profiling specific build ID for executables. See the OTel specification
+// for Profiles for more information.
+func ProcessExecutableBuildIDHtlhash(val string) attribute.KeyValue {
+ return ProcessExecutableBuildIDHtlhashKey.String(val)
+}
+
+// ProcessExecutableName returns an attribute KeyValue conforming to the
+// "process.executable.name" semantic conventions. It represents the name of the
+// process executable. On Linux based systems, this SHOULD be set to the base
+// name of the target of `/proc/[pid]/exe`. On Windows, this SHOULD be set to the
+// base name of `GetProcessImageFileNameW`.
+func ProcessExecutableName(val string) attribute.KeyValue {
+ return ProcessExecutableNameKey.String(val)
+}
+
+// ProcessExecutablePath returns an attribute KeyValue conforming to the
+// "process.executable.path" semantic conventions. It represents the full path to
+// the process executable. On Linux based systems, can be set to the target of
+// `proc/[pid]/exe`. On Windows, can be set to the result of
+// `GetProcessImageFileNameW`.
+func ProcessExecutablePath(val string) attribute.KeyValue {
+ return ProcessExecutablePathKey.String(val)
+}
+
+// ProcessExitCode returns an attribute KeyValue conforming to the
+// "process.exit.code" semantic conventions. It represents the exit code of the
+// process.
+func ProcessExitCode(val int) attribute.KeyValue {
+ return ProcessExitCodeKey.Int(val)
+}
+
+// ProcessExitTime returns an attribute KeyValue conforming to the
+// "process.exit.time" semantic conventions. It represents the date and time the
+// process exited, in ISO 8601 format.
+func ProcessExitTime(val string) attribute.KeyValue {
+ return ProcessExitTimeKey.String(val)
+}
+
+// ProcessGroupLeaderPID returns an attribute KeyValue conforming to the
+// "process.group_leader.pid" semantic conventions. It represents the PID of the
+// process's group leader. This is also the process group ID (PGID) of the
+// process.
+func ProcessGroupLeaderPID(val int) attribute.KeyValue {
+ return ProcessGroupLeaderPIDKey.Int(val)
+}
+
+// ProcessInteractive returns an attribute KeyValue conforming to the
+// "process.interactive" semantic conventions. It represents the whether the
+// process is connected to an interactive shell.
+func ProcessInteractive(val bool) attribute.KeyValue {
+ return ProcessInteractiveKey.Bool(val)
+}
+
+// ProcessLinuxCgroup returns an attribute KeyValue conforming to the
+// "process.linux.cgroup" semantic conventions. It represents the control group
+// associated with the process.
+func ProcessLinuxCgroup(val string) attribute.KeyValue {
+ return ProcessLinuxCgroupKey.String(val)
+}
+
+// ProcessOwner returns an attribute KeyValue conforming to the "process.owner"
+// semantic conventions. It represents the username of the user that owns the
+// process.
+func ProcessOwner(val string) attribute.KeyValue {
+ return ProcessOwnerKey.String(val)
+}
+
+// ProcessParentPID returns an attribute KeyValue conforming to the
+// "process.parent_pid" semantic conventions. It represents the parent Process
+// identifier (PPID).
+func ProcessParentPID(val int) attribute.KeyValue {
+ return ProcessParentPIDKey.Int(val)
+}
+
+// ProcessPID returns an attribute KeyValue conforming to the "process.pid"
+// semantic conventions. It represents the process identifier (PID).
+func ProcessPID(val int) attribute.KeyValue {
+ return ProcessPIDKey.Int(val)
+}
+
+// ProcessRealUserID returns an attribute KeyValue conforming to the
+// "process.real_user.id" semantic conventions. It represents the real user ID
+// (RUID) of the process.
+func ProcessRealUserID(val int) attribute.KeyValue {
+ return ProcessRealUserIDKey.Int(val)
+}
+
+// ProcessRealUserName returns an attribute KeyValue conforming to the
+// "process.real_user.name" semantic conventions. It represents the username of
+// the real user of the process.
+func ProcessRealUserName(val string) attribute.KeyValue {
+ return ProcessRealUserNameKey.String(val)
+}
+
+// ProcessRuntimeDescription returns an attribute KeyValue conforming to the
+// "process.runtime.description" semantic conventions. It represents an
+// additional description about the runtime of the process, for example a
+// specific vendor customization of the runtime environment.
+func ProcessRuntimeDescription(val string) attribute.KeyValue {
+ return ProcessRuntimeDescriptionKey.String(val)
+}
+
+// ProcessRuntimeName returns an attribute KeyValue conforming to the
+// "process.runtime.name" semantic conventions. It represents the name of the
+// runtime of this process.
+func ProcessRuntimeName(val string) attribute.KeyValue {
+ return ProcessRuntimeNameKey.String(val)
+}
+
+// ProcessRuntimeVersion returns an attribute KeyValue conforming to the
+// "process.runtime.version" semantic conventions. It represents the version of
+// the runtime of this process, as returned by the runtime without modification.
+func ProcessRuntimeVersion(val string) attribute.KeyValue {
+ return ProcessRuntimeVersionKey.String(val)
+}
+
+// ProcessSavedUserID returns an attribute KeyValue conforming to the
+// "process.saved_user.id" semantic conventions. It represents the saved user ID
+// (SUID) of the process.
+func ProcessSavedUserID(val int) attribute.KeyValue {
+ return ProcessSavedUserIDKey.Int(val)
+}
+
+// ProcessSavedUserName returns an attribute KeyValue conforming to the
+// "process.saved_user.name" semantic conventions. It represents the username of
+// the saved user.
+func ProcessSavedUserName(val string) attribute.KeyValue {
+ return ProcessSavedUserNameKey.String(val)
+}
+
+// ProcessSessionLeaderPID returns an attribute KeyValue conforming to the
+// "process.session_leader.pid" semantic conventions. It represents the PID of
+// the process's session leader. This is also the session ID (SID) of the
+// process.
+func ProcessSessionLeaderPID(val int) attribute.KeyValue {
+ return ProcessSessionLeaderPIDKey.Int(val)
+}
+
+// ProcessTitle returns an attribute KeyValue conforming to the "process.title"
+// semantic conventions. It represents the process title (proctitle).
+func ProcessTitle(val string) attribute.KeyValue {
+ return ProcessTitleKey.String(val)
+}
+
+// ProcessUserID returns an attribute KeyValue conforming to the
+// "process.user.id" semantic conventions. It represents the effective user ID
+// (EUID) of the process.
+func ProcessUserID(val int) attribute.KeyValue {
+ return ProcessUserIDKey.Int(val)
+}
+
+// ProcessUserName returns an attribute KeyValue conforming to the
+// "process.user.name" semantic conventions. It represents the username of the
+// effective user of the process.
+func ProcessUserName(val string) attribute.KeyValue {
+ return ProcessUserNameKey.String(val)
+}
+
+// ProcessVpid returns an attribute KeyValue conforming to the "process.vpid"
+// semantic conventions. It represents the virtual process identifier.
+func ProcessVpid(val int) attribute.KeyValue {
+ return ProcessVpidKey.Int(val)
+}
+
+// ProcessWorkingDirectory returns an attribute KeyValue conforming to the
+// "process.working_directory" semantic conventions. It represents the working
+// directory of the process.
+func ProcessWorkingDirectory(val string) attribute.KeyValue {
+ return ProcessWorkingDirectoryKey.String(val)
+}
+
+// Enum values for process.context_switch_type
+var (
+ // voluntary
+ // Stability: development
+ ProcessContextSwitchTypeVoluntary = ProcessContextSwitchTypeKey.String("voluntary")
+ // involuntary
+ // Stability: development
+ ProcessContextSwitchTypeInvoluntary = ProcessContextSwitchTypeKey.String("involuntary")
+)
+
+// Enum values for process.paging.fault_type
+var (
+ // major
+ // Stability: development
+ ProcessPagingFaultTypeMajor = ProcessPagingFaultTypeKey.String("major")
+ // minor
+ // Stability: development
+ ProcessPagingFaultTypeMinor = ProcessPagingFaultTypeKey.String("minor")
+)
+
+// Namespace: profile
+const (
+ // ProfileFrameTypeKey is the attribute Key conforming to the
+ // "profile.frame.type" semantic conventions. It represents the describes the
+ // interpreter or compiler of a single frame.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "cpython"
+ ProfileFrameTypeKey = attribute.Key("profile.frame.type")
+)
+
+// Enum values for profile.frame.type
+var (
+ // [.NET]
+ //
+ // Stability: development
+ //
+ // [.NET]: https://wikipedia.org/wiki/.NET
+ ProfileFrameTypeDotnet = ProfileFrameTypeKey.String("dotnet")
+ // [JVM]
+ //
+ // Stability: development
+ //
+ // [JVM]: https://wikipedia.org/wiki/Java_virtual_machine
+ ProfileFrameTypeJVM = ProfileFrameTypeKey.String("jvm")
+ // [Kernel]
+ //
+ // Stability: development
+ //
+ // [Kernel]: https://wikipedia.org/wiki/Kernel_(operating_system)
+ ProfileFrameTypeKernel = ProfileFrameTypeKey.String("kernel")
+ // Can be one of but not limited to [C], [C++], [Go] or [Rust]. If possible, a
+ // more precise value MUST be used.
+ //
+ // Stability: development
+ //
+ // [C]: https://wikipedia.org/wiki/C_(programming_language)
+ // [C++]: https://wikipedia.org/wiki/C%2B%2B
+ // [Go]: https://wikipedia.org/wiki/Go_(programming_language)
+ // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language)
+ ProfileFrameTypeNative = ProfileFrameTypeKey.String("native")
+ // [Perl]
+ //
+ // Stability: development
+ //
+ // [Perl]: https://wikipedia.org/wiki/Perl
+ ProfileFrameTypePerl = ProfileFrameTypeKey.String("perl")
+ // [PHP]
+ //
+ // Stability: development
+ //
+ // [PHP]: https://wikipedia.org/wiki/PHP
+ ProfileFrameTypePHP = ProfileFrameTypeKey.String("php")
+ // [Python]
+ //
+ // Stability: development
+ //
+ // [Python]: https://wikipedia.org/wiki/Python_(programming_language)
+ ProfileFrameTypeCpython = ProfileFrameTypeKey.String("cpython")
+ // [Ruby]
+ //
+ // Stability: development
+ //
+ // [Ruby]: https://wikipedia.org/wiki/Ruby_(programming_language)
+ ProfileFrameTypeRuby = ProfileFrameTypeKey.String("ruby")
+ // [V8JS]
+ //
+ // Stability: development
+ //
+ // [V8JS]: https://wikipedia.org/wiki/V8_(JavaScript_engine)
+ ProfileFrameTypeV8JS = ProfileFrameTypeKey.String("v8js")
+ // [Erlang]
+ //
+ // Stability: development
+ //
+ // [Erlang]: https://en.wikipedia.org/wiki/BEAM_(Erlang_virtual_machine)
+ ProfileFrameTypeBeam = ProfileFrameTypeKey.String("beam")
+ // [Go],
+ //
+ // Stability: development
+ //
+ // [Go]: https://wikipedia.org/wiki/Go_(programming_language)
+ ProfileFrameTypeGo = ProfileFrameTypeKey.String("go")
+ // [Rust]
+ //
+ // Stability: development
+ //
+ // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language)
+ ProfileFrameTypeRust = ProfileFrameTypeKey.String("rust")
+)
+
+// Namespace: rpc
+const (
+ // RPCConnectRPCErrorCodeKey is the attribute Key conforming to the
+ // "rpc.connect_rpc.error_code" semantic conventions. It represents the
+ // [error codes] of the Connect request. Error codes are always string values.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [error codes]: https://connectrpc.com//docs/protocol/#error-codes
+ RPCConnectRPCErrorCodeKey = attribute.Key("rpc.connect_rpc.error_code")
+
+ // RPCGRPCStatusCodeKey is the attribute Key conforming to the
+ // "rpc.grpc.status_code" semantic conventions. It represents the
+ // [numeric status code] of the gRPC request.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [numeric status code]: https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md
+ RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code")
+
+ // RPCJSONRPCErrorCodeKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code`
+ // property of response if it is an error response.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: -32700, 100
+ RPCJSONRPCErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code")
+
+ // RPCJSONRPCErrorMessageKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.error_message" semantic conventions. It represents the
+ // `error.message` property of response if it is an error response.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Parse error", "User already exists"
+ RPCJSONRPCErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message")
+
+ // RPCJSONRPCRequestIDKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id`
+ // property of request or response. Since protocol allows id to be int, string,
+ // `null` or missing (for notifications), value is expected to be cast to string
+ // for simplicity. Use empty string in case of `null` value. Omit entirely if
+ // this is a notification.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "10", "request-7", ""
+ RPCJSONRPCRequestIDKey = attribute.Key("rpc.jsonrpc.request_id")
+
+ // RPCJSONRPCVersionKey is the attribute Key conforming to the
+ // "rpc.jsonrpc.version" semantic conventions. It represents the protocol
+ // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0
+ // doesn't specify this, the value can be omitted.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2.0", "1.0"
+ RPCJSONRPCVersionKey = attribute.Key("rpc.jsonrpc.version")
+
+ // RPCMessageCompressedSizeKey is the attribute Key conforming to the
+ // "rpc.message.compressed_size" semantic conventions. It represents the
+ // compressed size of the message in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCMessageCompressedSizeKey = attribute.Key("rpc.message.compressed_size")
+
+ // RPCMessageIDKey is the attribute Key conforming to the "rpc.message.id"
+ // semantic conventions. It MUST be calculated as two different counters
+ // starting from `1` one for sent messages and one for received message..
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: This way we guarantee that the values will be consistent between
+ // different implementations.
+ RPCMessageIDKey = attribute.Key("rpc.message.id")
+
+ // RPCMessageTypeKey is the attribute Key conforming to the "rpc.message.type"
+ // semantic conventions. It represents the whether this is a received or sent
+ // message.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCMessageTypeKey = attribute.Key("rpc.message.type")
+
+ // RPCMessageUncompressedSizeKey is the attribute Key conforming to the
+ // "rpc.message.uncompressed_size" semantic conventions. It represents the
+ // uncompressed size of the message in bytes.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCMessageUncompressedSizeKey = attribute.Key("rpc.message.uncompressed_size")
+
+ // RPCMethodKey is the attribute Key conforming to the "rpc.method" semantic
+ // conventions. It represents the name of the (logical) method being called,
+ // must be equal to the $method part in the span name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: exampleMethod
+ // Note: This is the logical name of the method from the RPC interface
+ // perspective, which can be different from the name of any implementing
+ // method/function. The `code.function.name` attribute may be used to store the
+ // latter (e.g., method actually executing the call on the server side, RPC
+ // client stub method on the client side).
+ RPCMethodKey = attribute.Key("rpc.method")
+
+ // RPCServiceKey is the attribute Key conforming to the "rpc.service" semantic
+ // conventions. It represents the full (logical) name of the service being
+ // called, including its package name, if applicable.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: myservice.EchoService
+ // Note: This is the logical name of the service from the RPC interface
+ // perspective, which can be different from the name of any implementing class.
+ // The `code.namespace` attribute may be used to store the latter (despite the
+ // attribute name, it may include a class name; e.g., class with method actually
+ // executing the call on the server side, RPC client stub class on the client
+ // side).
+ RPCServiceKey = attribute.Key("rpc.service")
+
+ // RPCSystemKey is the attribute Key conforming to the "rpc.system" semantic
+ // conventions. It represents a string identifying the remoting system. See
+ // below for a list of well-known identifiers.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ RPCSystemKey = attribute.Key("rpc.system")
+)
+
+// RPCJSONRPCErrorCode returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code`
+// property of response if it is an error response.
+func RPCJSONRPCErrorCode(val int) attribute.KeyValue {
+ return RPCJSONRPCErrorCodeKey.Int(val)
+}
+
+// RPCJSONRPCErrorMessage returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.error_message" semantic conventions. It represents the
+// `error.message` property of response if it is an error response.
+func RPCJSONRPCErrorMessage(val string) attribute.KeyValue {
+ return RPCJSONRPCErrorMessageKey.String(val)
+}
+
+// RPCJSONRPCRequestID returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` property
+// of request or response. Since protocol allows id to be int, string, `null` or
+// missing (for notifications), value is expected to be cast to string for
+// simplicity. Use empty string in case of `null` value. Omit entirely if this is
+// a notification.
+func RPCJSONRPCRequestID(val string) attribute.KeyValue {
+ return RPCJSONRPCRequestIDKey.String(val)
+}
+
+// RPCJSONRPCVersion returns an attribute KeyValue conforming to the
+// "rpc.jsonrpc.version" semantic conventions. It represents the protocol version
+// as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 doesn't
+// specify this, the value can be omitted.
+func RPCJSONRPCVersion(val string) attribute.KeyValue {
+ return RPCJSONRPCVersionKey.String(val)
+}
+
+// RPCMessageCompressedSize returns an attribute KeyValue conforming to the
+// "rpc.message.compressed_size" semantic conventions. It represents the
+// compressed size of the message in bytes.
+func RPCMessageCompressedSize(val int) attribute.KeyValue {
+ return RPCMessageCompressedSizeKey.Int(val)
+}
+
+// RPCMessageID returns an attribute KeyValue conforming to the "rpc.message.id"
+// semantic conventions. It MUST be calculated as two different counters starting
+// from `1` one for sent messages and one for received message..
+func RPCMessageID(val int) attribute.KeyValue {
+ return RPCMessageIDKey.Int(val)
+}
+
+// RPCMessageUncompressedSize returns an attribute KeyValue conforming to the
+// "rpc.message.uncompressed_size" semantic conventions. It represents the
+// uncompressed size of the message in bytes.
+func RPCMessageUncompressedSize(val int) attribute.KeyValue {
+ return RPCMessageUncompressedSizeKey.Int(val)
+}
+
+// RPCMethod returns an attribute KeyValue conforming to the "rpc.method"
+// semantic conventions. It represents the name of the (logical) method being
+// called, must be equal to the $method part in the span name.
+func RPCMethod(val string) attribute.KeyValue {
+ return RPCMethodKey.String(val)
+}
+
+// RPCService returns an attribute KeyValue conforming to the "rpc.service"
+// semantic conventions. It represents the full (logical) name of the service
+// being called, including its package name, if applicable.
+func RPCService(val string) attribute.KeyValue {
+ return RPCServiceKey.String(val)
+}
+
+// Enum values for rpc.connect_rpc.error_code
+var (
+ // cancelled
+ // Stability: development
+ RPCConnectRPCErrorCodeCancelled = RPCConnectRPCErrorCodeKey.String("cancelled")
+ // unknown
+ // Stability: development
+ RPCConnectRPCErrorCodeUnknown = RPCConnectRPCErrorCodeKey.String("unknown")
+ // invalid_argument
+ // Stability: development
+ RPCConnectRPCErrorCodeInvalidArgument = RPCConnectRPCErrorCodeKey.String("invalid_argument")
+ // deadline_exceeded
+ // Stability: development
+ RPCConnectRPCErrorCodeDeadlineExceeded = RPCConnectRPCErrorCodeKey.String("deadline_exceeded")
+ // not_found
+ // Stability: development
+ RPCConnectRPCErrorCodeNotFound = RPCConnectRPCErrorCodeKey.String("not_found")
+ // already_exists
+ // Stability: development
+ RPCConnectRPCErrorCodeAlreadyExists = RPCConnectRPCErrorCodeKey.String("already_exists")
+ // permission_denied
+ // Stability: development
+ RPCConnectRPCErrorCodePermissionDenied = RPCConnectRPCErrorCodeKey.String("permission_denied")
+ // resource_exhausted
+ // Stability: development
+ RPCConnectRPCErrorCodeResourceExhausted = RPCConnectRPCErrorCodeKey.String("resource_exhausted")
+ // failed_precondition
+ // Stability: development
+ RPCConnectRPCErrorCodeFailedPrecondition = RPCConnectRPCErrorCodeKey.String("failed_precondition")
+ // aborted
+ // Stability: development
+ RPCConnectRPCErrorCodeAborted = RPCConnectRPCErrorCodeKey.String("aborted")
+ // out_of_range
+ // Stability: development
+ RPCConnectRPCErrorCodeOutOfRange = RPCConnectRPCErrorCodeKey.String("out_of_range")
+ // unimplemented
+ // Stability: development
+ RPCConnectRPCErrorCodeUnimplemented = RPCConnectRPCErrorCodeKey.String("unimplemented")
+ // internal
+ // Stability: development
+ RPCConnectRPCErrorCodeInternal = RPCConnectRPCErrorCodeKey.String("internal")
+ // unavailable
+ // Stability: development
+ RPCConnectRPCErrorCodeUnavailable = RPCConnectRPCErrorCodeKey.String("unavailable")
+ // data_loss
+ // Stability: development
+ RPCConnectRPCErrorCodeDataLoss = RPCConnectRPCErrorCodeKey.String("data_loss")
+ // unauthenticated
+ // Stability: development
+ RPCConnectRPCErrorCodeUnauthenticated = RPCConnectRPCErrorCodeKey.String("unauthenticated")
+)
+
+// Enum values for rpc.grpc.status_code
+var (
+ // OK
+ // Stability: development
+ RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0)
+ // CANCELLED
+ // Stability: development
+ RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1)
+ // UNKNOWN
+ // Stability: development
+ RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2)
+ // INVALID_ARGUMENT
+ // Stability: development
+ RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3)
+ // DEADLINE_EXCEEDED
+ // Stability: development
+ RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4)
+ // NOT_FOUND
+ // Stability: development
+ RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5)
+ // ALREADY_EXISTS
+ // Stability: development
+ RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6)
+ // PERMISSION_DENIED
+ // Stability: development
+ RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7)
+ // RESOURCE_EXHAUSTED
+ // Stability: development
+ RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8)
+ // FAILED_PRECONDITION
+ // Stability: development
+ RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9)
+ // ABORTED
+ // Stability: development
+ RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10)
+ // OUT_OF_RANGE
+ // Stability: development
+ RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11)
+ // UNIMPLEMENTED
+ // Stability: development
+ RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12)
+ // INTERNAL
+ // Stability: development
+ RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13)
+ // UNAVAILABLE
+ // Stability: development
+ RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14)
+ // DATA_LOSS
+ // Stability: development
+ RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15)
+ // UNAUTHENTICATED
+ // Stability: development
+ RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16)
+)
+
+// Enum values for rpc.message.type
+var (
+ // sent
+ // Stability: development
+ RPCMessageTypeSent = RPCMessageTypeKey.String("SENT")
+ // received
+ // Stability: development
+ RPCMessageTypeReceived = RPCMessageTypeKey.String("RECEIVED")
+)
+
+// Enum values for rpc.system
+var (
+ // gRPC
+ // Stability: development
+ RPCSystemGRPC = RPCSystemKey.String("grpc")
+ // Java RMI
+ // Stability: development
+ RPCSystemJavaRmi = RPCSystemKey.String("java_rmi")
+ // .NET WCF
+ // Stability: development
+ RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf")
+ // Apache Dubbo
+ // Stability: development
+ RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo")
+ // Connect RPC
+ // Stability: development
+ RPCSystemConnectRPC = RPCSystemKey.String("connect_rpc")
+)
+
+// Namespace: security_rule
+const (
+ // SecurityRuleCategoryKey is the attribute Key conforming to the
+ // "security_rule.category" semantic conventions. It represents a categorization
+ // value keyword used by the entity using the rule for detection of this event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Attempted Information Leak"
+ SecurityRuleCategoryKey = attribute.Key("security_rule.category")
+
+ // SecurityRuleDescriptionKey is the attribute Key conforming to the
+ // "security_rule.description" semantic conventions. It represents the
+ // description of the rule generating the event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Block requests to public DNS over HTTPS / TLS protocols"
+ SecurityRuleDescriptionKey = attribute.Key("security_rule.description")
+
+ // SecurityRuleLicenseKey is the attribute Key conforming to the
+ // "security_rule.license" semantic conventions. It represents the name of the
+ // license under which the rule used to generate this event is made available.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Apache 2.0"
+ SecurityRuleLicenseKey = attribute.Key("security_rule.license")
+
+ // SecurityRuleNameKey is the attribute Key conforming to the
+ // "security_rule.name" semantic conventions. It represents the name of the rule
+ // or signature generating the event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "BLOCK_DNS_over_TLS"
+ SecurityRuleNameKey = attribute.Key("security_rule.name")
+
+ // SecurityRuleReferenceKey is the attribute Key conforming to the
+ // "security_rule.reference" semantic conventions. It represents the reference
+ // URL to additional information about the rule used to generate this event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://en.wikipedia.org/wiki/DNS_over_TLS"
+ // Note: The URL can point to the vendor’s documentation about the rule. If
+ // that’s not available, it can also be a link to a more general page
+ // describing this type of alert.
+ SecurityRuleReferenceKey = attribute.Key("security_rule.reference")
+
+ // SecurityRuleRulesetNameKey is the attribute Key conforming to the
+ // "security_rule.ruleset.name" semantic conventions. It represents the name of
+ // the ruleset, policy, group, or parent category in which the rule used to
+ // generate this event is a member.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Standard_Protocol_Filters"
+ SecurityRuleRulesetNameKey = attribute.Key("security_rule.ruleset.name")
+
+ // SecurityRuleUUIDKey is the attribute Key conforming to the
+ // "security_rule.uuid" semantic conventions. It represents a rule ID that is
+ // unique within the scope of a set or group of agents, observers, or other
+ // entities using the rule for detection of this event.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "550e8400-e29b-41d4-a716-446655440000", "1100110011"
+ SecurityRuleUUIDKey = attribute.Key("security_rule.uuid")
+
+ // SecurityRuleVersionKey is the attribute Key conforming to the
+ // "security_rule.version" semantic conventions. It represents the version /
+ // revision of the rule being used for analysis.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1.0.0"
+ SecurityRuleVersionKey = attribute.Key("security_rule.version")
+)
+
+// SecurityRuleCategory returns an attribute KeyValue conforming to the
+// "security_rule.category" semantic conventions. It represents a categorization
+// value keyword used by the entity using the rule for detection of this event.
+func SecurityRuleCategory(val string) attribute.KeyValue {
+ return SecurityRuleCategoryKey.String(val)
+}
+
+// SecurityRuleDescription returns an attribute KeyValue conforming to the
+// "security_rule.description" semantic conventions. It represents the
+// description of the rule generating the event.
+func SecurityRuleDescription(val string) attribute.KeyValue {
+ return SecurityRuleDescriptionKey.String(val)
+}
+
+// SecurityRuleLicense returns an attribute KeyValue conforming to the
+// "security_rule.license" semantic conventions. It represents the name of the
+// license under which the rule used to generate this event is made available.
+func SecurityRuleLicense(val string) attribute.KeyValue {
+ return SecurityRuleLicenseKey.String(val)
+}
+
+// SecurityRuleName returns an attribute KeyValue conforming to the
+// "security_rule.name" semantic conventions. It represents the name of the rule
+// or signature generating the event.
+func SecurityRuleName(val string) attribute.KeyValue {
+ return SecurityRuleNameKey.String(val)
+}
+
+// SecurityRuleReference returns an attribute KeyValue conforming to the
+// "security_rule.reference" semantic conventions. It represents the reference
+// URL to additional information about the rule used to generate this event.
+func SecurityRuleReference(val string) attribute.KeyValue {
+ return SecurityRuleReferenceKey.String(val)
+}
+
+// SecurityRuleRulesetName returns an attribute KeyValue conforming to the
+// "security_rule.ruleset.name" semantic conventions. It represents the name of
+// the ruleset, policy, group, or parent category in which the rule used to
+// generate this event is a member.
+func SecurityRuleRulesetName(val string) attribute.KeyValue {
+ return SecurityRuleRulesetNameKey.String(val)
+}
+
+// SecurityRuleUUID returns an attribute KeyValue conforming to the
+// "security_rule.uuid" semantic conventions. It represents a rule ID that is
+// unique within the scope of a set or group of agents, observers, or other
+// entities using the rule for detection of this event.
+func SecurityRuleUUID(val string) attribute.KeyValue {
+ return SecurityRuleUUIDKey.String(val)
+}
+
+// SecurityRuleVersion returns an attribute KeyValue conforming to the
+// "security_rule.version" semantic conventions. It represents the version /
+// revision of the rule being used for analysis.
+func SecurityRuleVersion(val string) attribute.KeyValue {
+ return SecurityRuleVersionKey.String(val)
+}
+
+// Namespace: server
+const (
+ // ServerAddressKey is the attribute Key conforming to the "server.address"
+ // semantic conventions. It represents the server domain name if available
+ // without reverse DNS lookup; otherwise, IP address or Unix domain socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the client side, and when communicating through an
+ // intermediary, `server.address` SHOULD represent the server address behind any
+ // intermediaries, for example proxies, if it's available.
+ ServerAddressKey = attribute.Key("server.address")
+
+ // ServerPortKey is the attribute Key conforming to the "server.port" semantic
+ // conventions. It represents the server port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: 80, 8080, 443
+ // Note: When observed from the client side, and when communicating through an
+ // intermediary, `server.port` SHOULD represent the server port behind any
+ // intermediaries, for example proxies, if it's available.
+ ServerPortKey = attribute.Key("server.port")
+)
+
+// ServerAddress returns an attribute KeyValue conforming to the "server.address"
+// semantic conventions. It represents the server domain name if available
+// without reverse DNS lookup; otherwise, IP address or Unix domain socket name.
+func ServerAddress(val string) attribute.KeyValue {
+ return ServerAddressKey.String(val)
+}
+
+// ServerPort returns an attribute KeyValue conforming to the "server.port"
+// semantic conventions. It represents the server port number.
+func ServerPort(val int) attribute.KeyValue {
+ return ServerPortKey.Int(val)
+}
+
+// Namespace: service
+const (
+ // ServiceInstanceIDKey is the attribute Key conforming to the
+ // "service.instance.id" semantic conventions. It represents the string ID of
+ // the service instance.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "627cc493-f310-47de-96bd-71410b7dec09"
+ // Note: MUST be unique for each instance of the same
+ // `service.namespace,service.name` pair (in other words
+ // `service.namespace,service.name,service.instance.id` triplet MUST be globally
+ // unique). The ID helps to
+ // distinguish instances of the same service that exist at the same time (e.g.
+ // instances of a horizontally scaled
+ // service).
+ //
+ // Implementations, such as SDKs, are recommended to generate a random Version 1
+ // or Version 4 [RFC
+ // 4122] UUID, but are free to use an inherent unique ID as
+ // the source of
+ // this value if stability is desirable. In that case, the ID SHOULD be used as
+ // source of a UUID Version 5 and
+ // SHOULD use the following UUID as the namespace:
+ // `4d63009a-8d0f-11ee-aad7-4c796ed8e320`.
+ //
+ // UUIDs are typically recommended, as only an opaque value for the purposes of
+ // identifying a service instance is
+ // needed. Similar to what can be seen in the man page for the
+ // [`/etc/machine-id`] file, the underlying
+ // data, such as pod name and namespace should be treated as confidential, being
+ // the user's choice to expose it
+ // or not via another resource attribute.
+ //
+ // For applications running behind an application server (like unicorn), we do
+ // not recommend using one identifier
+ // for all processes participating in the application. Instead, it's recommended
+ // each division (e.g. a worker
+ // thread in unicorn) to have its own instance.id.
+ //
+ // It's not recommended for a Collector to set `service.instance.id` if it can't
+ // unambiguously determine the
+ // service instance that is generating that telemetry. For instance, creating an
+ // UUID based on `pod.name` will
+ // likely be wrong, as the Collector might not know from which container within
+ // that pod the telemetry originated.
+ // However, Collectors can set the `service.instance.id` if they can
+ // unambiguously determine the service instance
+ // for that telemetry. This is typically the case for scraping receivers, as
+ // they know the target address and
+ // port.
+ //
+ // [RFC
+ // 4122]: https://www.ietf.org/rfc/rfc4122.txt
+ // [`/etc/machine-id`]: https://www.freedesktop.org/software/systemd/man/latest/machine-id.html
+ ServiceInstanceIDKey = attribute.Key("service.instance.id")
+
+ // ServiceNameKey is the attribute Key conforming to the "service.name" semantic
+ // conventions. It represents the logical name of the service.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "shoppingcart"
+ // Note: MUST be the same for all instances of horizontally scaled services. If
+ // the value was not specified, SDKs MUST fallback to `unknown_service:`
+ // concatenated with [`process.executable.name`], e.g. `unknown_service:bash`.
+ // If `process.executable.name` is not available, the value MUST be set to
+ // `unknown_service`.
+ //
+ // [`process.executable.name`]: process.md
+ ServiceNameKey = attribute.Key("service.name")
+
+ // ServiceNamespaceKey is the attribute Key conforming to the
+ // "service.namespace" semantic conventions. It represents a namespace for
+ // `service.name`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Shop"
+ // Note: A string value having a meaning that helps to distinguish a group of
+ // services, for example the team name that owns a group of services.
+ // `service.name` is expected to be unique within the same namespace. If
+ // `service.namespace` is not specified in the Resource then `service.name` is
+ // expected to be unique for all services that have no explicit namespace
+ // defined (so the empty/unspecified namespace is simply one more valid
+ // namespace). Zero-length namespace string is assumed equal to unspecified
+ // namespace.
+ ServiceNamespaceKey = attribute.Key("service.namespace")
+
+ // ServiceVersionKey is the attribute Key conforming to the "service.version"
+ // semantic conventions. It represents the version string of the service API or
+ // implementation. The format is not defined by these conventions.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "2.0.0", "a01dbef8a"
+ ServiceVersionKey = attribute.Key("service.version")
+)
+
+// ServiceInstanceID returns an attribute KeyValue conforming to the
+// "service.instance.id" semantic conventions. It represents the string ID of the
+// service instance.
+func ServiceInstanceID(val string) attribute.KeyValue {
+ return ServiceInstanceIDKey.String(val)
+}
+
+// ServiceName returns an attribute KeyValue conforming to the "service.name"
+// semantic conventions. It represents the logical name of the service.
+func ServiceName(val string) attribute.KeyValue {
+ return ServiceNameKey.String(val)
+}
+
+// ServiceNamespace returns an attribute KeyValue conforming to the
+// "service.namespace" semantic conventions. It represents a namespace for
+// `service.name`.
+func ServiceNamespace(val string) attribute.KeyValue {
+ return ServiceNamespaceKey.String(val)
+}
+
+// ServiceVersion returns an attribute KeyValue conforming to the
+// "service.version" semantic conventions. It represents the version string of
+// the service API or implementation. The format is not defined by these
+// conventions.
+func ServiceVersion(val string) attribute.KeyValue {
+ return ServiceVersionKey.String(val)
+}
+
+// Namespace: session
+const (
+ // SessionIDKey is the attribute Key conforming to the "session.id" semantic
+ // conventions. It represents a unique id to identify a session.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 00112233-4455-6677-8899-aabbccddeeff
+ SessionIDKey = attribute.Key("session.id")
+
+ // SessionPreviousIDKey is the attribute Key conforming to the
+ // "session.previous_id" semantic conventions. It represents the previous
+ // `session.id` for this user, when known.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 00112233-4455-6677-8899-aabbccddeeff
+ SessionPreviousIDKey = attribute.Key("session.previous_id")
+)
+
+// SessionID returns an attribute KeyValue conforming to the "session.id"
+// semantic conventions. It represents a unique id to identify a session.
+func SessionID(val string) attribute.KeyValue {
+ return SessionIDKey.String(val)
+}
+
+// SessionPreviousID returns an attribute KeyValue conforming to the
+// "session.previous_id" semantic conventions. It represents the previous
+// `session.id` for this user, when known.
+func SessionPreviousID(val string) attribute.KeyValue {
+ return SessionPreviousIDKey.String(val)
+}
+
+// Namespace: signalr
+const (
+ // SignalRConnectionStatusKey is the attribute Key conforming to the
+ // "signalr.connection.status" semantic conventions. It represents the signalR
+ // HTTP connection closure status.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "app_shutdown", "timeout"
+ SignalRConnectionStatusKey = attribute.Key("signalr.connection.status")
+
+ // SignalRTransportKey is the attribute Key conforming to the
+ // "signalr.transport" semantic conventions. It represents the
+ // [SignalR transport type].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "web_sockets", "long_polling"
+ //
+ // [SignalR transport type]: https://github.com/dotnet/aspnetcore/blob/main/src/SignalR/docs/specs/TransportProtocols.md
+ SignalRTransportKey = attribute.Key("signalr.transport")
+)
+
+// Enum values for signalr.connection.status
+var (
+ // The connection was closed normally.
+ // Stability: stable
+ SignalRConnectionStatusNormalClosure = SignalRConnectionStatusKey.String("normal_closure")
+ // The connection was closed due to a timeout.
+ // Stability: stable
+ SignalRConnectionStatusTimeout = SignalRConnectionStatusKey.String("timeout")
+ // The connection was closed because the app is shutting down.
+ // Stability: stable
+ SignalRConnectionStatusAppShutdown = SignalRConnectionStatusKey.String("app_shutdown")
+)
+
+// Enum values for signalr.transport
+var (
+ // ServerSentEvents protocol
+ // Stability: stable
+ SignalRTransportServerSentEvents = SignalRTransportKey.String("server_sent_events")
+ // LongPolling protocol
+ // Stability: stable
+ SignalRTransportLongPolling = SignalRTransportKey.String("long_polling")
+ // WebSockets protocol
+ // Stability: stable
+ SignalRTransportWebSockets = SignalRTransportKey.String("web_sockets")
+)
+
+// Namespace: source
+const (
+ // SourceAddressKey is the attribute Key conforming to the "source.address"
+ // semantic conventions. It represents the source address - domain name if
+ // available without reverse DNS lookup; otherwise, IP address or Unix domain
+ // socket name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "source.example.com", "10.1.2.80", "/tmp/my.sock"
+ // Note: When observed from the destination side, and when communicating through
+ // an intermediary, `source.address` SHOULD represent the source address behind
+ // any intermediaries, for example proxies, if it's available.
+ SourceAddressKey = attribute.Key("source.address")
+
+ // SourcePortKey is the attribute Key conforming to the "source.port" semantic
+ // conventions. It represents the source port number.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 3389, 2888
+ SourcePortKey = attribute.Key("source.port")
+)
+
+// SourceAddress returns an attribute KeyValue conforming to the "source.address"
+// semantic conventions. It represents the source address - domain name if
+// available without reverse DNS lookup; otherwise, IP address or Unix domain
+// socket name.
+func SourceAddress(val string) attribute.KeyValue {
+ return SourceAddressKey.String(val)
+}
+
+// SourcePort returns an attribute KeyValue conforming to the "source.port"
+// semantic conventions. It represents the source port number.
+func SourcePort(val int) attribute.KeyValue {
+ return SourcePortKey.Int(val)
+}
+
+// Namespace: system
+const (
+ // SystemCPULogicalNumberKey is the attribute Key conforming to the
+ // "system.cpu.logical_number" semantic conventions. It represents the
+ // deprecated, use `cpu.logical_number` instead.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 1
+ SystemCPULogicalNumberKey = attribute.Key("system.cpu.logical_number")
+
+ // SystemDeviceKey is the attribute Key conforming to the "system.device"
+ // semantic conventions. It represents the device identifier.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "(identifier)"
+ SystemDeviceKey = attribute.Key("system.device")
+
+ // SystemFilesystemModeKey is the attribute Key conforming to the
+ // "system.filesystem.mode" semantic conventions. It represents the filesystem
+ // mode.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "rw, ro"
+ SystemFilesystemModeKey = attribute.Key("system.filesystem.mode")
+
+ // SystemFilesystemMountpointKey is the attribute Key conforming to the
+ // "system.filesystem.mountpoint" semantic conventions. It represents the
+ // filesystem mount path.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/mnt/data"
+ SystemFilesystemMountpointKey = attribute.Key("system.filesystem.mountpoint")
+
+ // SystemFilesystemStateKey is the attribute Key conforming to the
+ // "system.filesystem.state" semantic conventions. It represents the filesystem
+ // state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "used"
+ SystemFilesystemStateKey = attribute.Key("system.filesystem.state")
+
+ // SystemFilesystemTypeKey is the attribute Key conforming to the
+ // "system.filesystem.type" semantic conventions. It represents the filesystem
+ // type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ext4"
+ SystemFilesystemTypeKey = attribute.Key("system.filesystem.type")
+
+ // SystemMemoryStateKey is the attribute Key conforming to the
+ // "system.memory.state" semantic conventions. It represents the memory state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "free", "cached"
+ SystemMemoryStateKey = attribute.Key("system.memory.state")
+
+ // SystemPagingDirectionKey is the attribute Key conforming to the
+ // "system.paging.direction" semantic conventions. It represents the paging
+ // access direction.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "in"
+ SystemPagingDirectionKey = attribute.Key("system.paging.direction")
+
+ // SystemPagingStateKey is the attribute Key conforming to the
+ // "system.paging.state" semantic conventions. It represents the memory paging
+ // state.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "free"
+ SystemPagingStateKey = attribute.Key("system.paging.state")
+
+ // SystemPagingTypeKey is the attribute Key conforming to the
+ // "system.paging.type" semantic conventions. It represents the memory paging
+ // type.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "minor"
+ SystemPagingTypeKey = attribute.Key("system.paging.type")
+
+ // SystemProcessStatusKey is the attribute Key conforming to the
+ // "system.process.status" semantic conventions. It represents the process
+ // state, e.g., [Linux Process State Codes].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "running"
+ //
+ // [Linux Process State Codes]: https://man7.org/linux/man-pages/man1/ps.1.html#PROCESS_STATE_CODES
+ SystemProcessStatusKey = attribute.Key("system.process.status")
+)
+
+// SystemCPULogicalNumber returns an attribute KeyValue conforming to the
+// "system.cpu.logical_number" semantic conventions. It represents the
+// deprecated, use `cpu.logical_number` instead.
+func SystemCPULogicalNumber(val int) attribute.KeyValue {
+ return SystemCPULogicalNumberKey.Int(val)
+}
+
+// SystemDevice returns an attribute KeyValue conforming to the "system.device"
+// semantic conventions. It represents the device identifier.
+func SystemDevice(val string) attribute.KeyValue {
+ return SystemDeviceKey.String(val)
+}
+
+// SystemFilesystemMode returns an attribute KeyValue conforming to the
+// "system.filesystem.mode" semantic conventions. It represents the filesystem
+// mode.
+func SystemFilesystemMode(val string) attribute.KeyValue {
+ return SystemFilesystemModeKey.String(val)
+}
+
+// SystemFilesystemMountpoint returns an attribute KeyValue conforming to the
+// "system.filesystem.mountpoint" semantic conventions. It represents the
+// filesystem mount path.
+func SystemFilesystemMountpoint(val string) attribute.KeyValue {
+ return SystemFilesystemMountpointKey.String(val)
+}
+
+// Enum values for system.filesystem.state
+var (
+ // used
+ // Stability: development
+ SystemFilesystemStateUsed = SystemFilesystemStateKey.String("used")
+ // free
+ // Stability: development
+ SystemFilesystemStateFree = SystemFilesystemStateKey.String("free")
+ // reserved
+ // Stability: development
+ SystemFilesystemStateReserved = SystemFilesystemStateKey.String("reserved")
+)
+
+// Enum values for system.filesystem.type
+var (
+ // fat32
+ // Stability: development
+ SystemFilesystemTypeFat32 = SystemFilesystemTypeKey.String("fat32")
+ // exfat
+ // Stability: development
+ SystemFilesystemTypeExfat = SystemFilesystemTypeKey.String("exfat")
+ // ntfs
+ // Stability: development
+ SystemFilesystemTypeNtfs = SystemFilesystemTypeKey.String("ntfs")
+ // refs
+ // Stability: development
+ SystemFilesystemTypeRefs = SystemFilesystemTypeKey.String("refs")
+ // hfsplus
+ // Stability: development
+ SystemFilesystemTypeHfsplus = SystemFilesystemTypeKey.String("hfsplus")
+ // ext4
+ // Stability: development
+ SystemFilesystemTypeExt4 = SystemFilesystemTypeKey.String("ext4")
+)
+
+// Enum values for system.memory.state
+var (
+ // used
+ // Stability: development
+ SystemMemoryStateUsed = SystemMemoryStateKey.String("used")
+ // free
+ // Stability: development
+ SystemMemoryStateFree = SystemMemoryStateKey.String("free")
+ // Deprecated: Removed, report shared memory usage with
+ // `metric.system.memory.shared` metric.
+ SystemMemoryStateShared = SystemMemoryStateKey.String("shared")
+ // buffers
+ // Stability: development
+ SystemMemoryStateBuffers = SystemMemoryStateKey.String("buffers")
+ // cached
+ // Stability: development
+ SystemMemoryStateCached = SystemMemoryStateKey.String("cached")
+)
+
+// Enum values for system.paging.direction
+var (
+ // in
+ // Stability: development
+ SystemPagingDirectionIn = SystemPagingDirectionKey.String("in")
+ // out
+ // Stability: development
+ SystemPagingDirectionOut = SystemPagingDirectionKey.String("out")
+)
+
+// Enum values for system.paging.state
+var (
+ // used
+ // Stability: development
+ SystemPagingStateUsed = SystemPagingStateKey.String("used")
+ // free
+ // Stability: development
+ SystemPagingStateFree = SystemPagingStateKey.String("free")
+)
+
+// Enum values for system.paging.type
+var (
+ // major
+ // Stability: development
+ SystemPagingTypeMajor = SystemPagingTypeKey.String("major")
+ // minor
+ // Stability: development
+ SystemPagingTypeMinor = SystemPagingTypeKey.String("minor")
+)
+
+// Enum values for system.process.status
+var (
+ // running
+ // Stability: development
+ SystemProcessStatusRunning = SystemProcessStatusKey.String("running")
+ // sleeping
+ // Stability: development
+ SystemProcessStatusSleeping = SystemProcessStatusKey.String("sleeping")
+ // stopped
+ // Stability: development
+ SystemProcessStatusStopped = SystemProcessStatusKey.String("stopped")
+ // defunct
+ // Stability: development
+ SystemProcessStatusDefunct = SystemProcessStatusKey.String("defunct")
+)
+
+// Namespace: telemetry
+const (
+ // TelemetryDistroNameKey is the attribute Key conforming to the
+ // "telemetry.distro.name" semantic conventions. It represents the name of the
+ // auto instrumentation agent or distribution, if used.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "parts-unlimited-java"
+ // Note: Official auto instrumentation agents and distributions SHOULD set the
+ // `telemetry.distro.name` attribute to
+ // a string starting with `opentelemetry-`, e.g.
+ // `opentelemetry-java-instrumentation`.
+ TelemetryDistroNameKey = attribute.Key("telemetry.distro.name")
+
+ // TelemetryDistroVersionKey is the attribute Key conforming to the
+ // "telemetry.distro.version" semantic conventions. It represents the version
+ // string of the auto instrumentation agent or distribution, if used.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1.2.3"
+ TelemetryDistroVersionKey = attribute.Key("telemetry.distro.version")
+
+ // TelemetrySDKLanguageKey is the attribute Key conforming to the
+ // "telemetry.sdk.language" semantic conventions. It represents the language of
+ // the telemetry SDK.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples:
+ TelemetrySDKLanguageKey = attribute.Key("telemetry.sdk.language")
+
+ // TelemetrySDKNameKey is the attribute Key conforming to the
+ // "telemetry.sdk.name" semantic conventions. It represents the name of the
+ // telemetry SDK as defined above.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "opentelemetry"
+ // Note: The OpenTelemetry SDK MUST set the `telemetry.sdk.name` attribute to
+ // `opentelemetry`.
+ // If another SDK, like a fork or a vendor-provided implementation, is used,
+ // this SDK MUST set the
+ // `telemetry.sdk.name` attribute to the fully-qualified class or module name of
+ // this SDK's main entry point
+ // or another suitable identifier depending on the language.
+ // The identifier `opentelemetry` is reserved and MUST NOT be used in this case.
+ // All custom identifiers SHOULD be stable across different versions of an
+ // implementation.
+ TelemetrySDKNameKey = attribute.Key("telemetry.sdk.name")
+
+ // TelemetrySDKVersionKey is the attribute Key conforming to the
+ // "telemetry.sdk.version" semantic conventions. It represents the version
+ // string of the telemetry SDK.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "1.2.3"
+ TelemetrySDKVersionKey = attribute.Key("telemetry.sdk.version")
+)
+
+// TelemetryDistroName returns an attribute KeyValue conforming to the
+// "telemetry.distro.name" semantic conventions. It represents the name of the
+// auto instrumentation agent or distribution, if used.
+func TelemetryDistroName(val string) attribute.KeyValue {
+ return TelemetryDistroNameKey.String(val)
+}
+
+// TelemetryDistroVersion returns an attribute KeyValue conforming to the
+// "telemetry.distro.version" semantic conventions. It represents the version
+// string of the auto instrumentation agent or distribution, if used.
+func TelemetryDistroVersion(val string) attribute.KeyValue {
+ return TelemetryDistroVersionKey.String(val)
+}
+
+// TelemetrySDKName returns an attribute KeyValue conforming to the
+// "telemetry.sdk.name" semantic conventions. It represents the name of the
+// telemetry SDK as defined above.
+func TelemetrySDKName(val string) attribute.KeyValue {
+ return TelemetrySDKNameKey.String(val)
+}
+
+// TelemetrySDKVersion returns an attribute KeyValue conforming to the
+// "telemetry.sdk.version" semantic conventions. It represents the version string
+// of the telemetry SDK.
+func TelemetrySDKVersion(val string) attribute.KeyValue {
+ return TelemetrySDKVersionKey.String(val)
+}
+
+// Enum values for telemetry.sdk.language
+var (
+ // cpp
+ // Stability: stable
+ TelemetrySDKLanguageCPP = TelemetrySDKLanguageKey.String("cpp")
+ // dotnet
+ // Stability: stable
+ TelemetrySDKLanguageDotnet = TelemetrySDKLanguageKey.String("dotnet")
+ // erlang
+ // Stability: stable
+ TelemetrySDKLanguageErlang = TelemetrySDKLanguageKey.String("erlang")
+ // go
+ // Stability: stable
+ TelemetrySDKLanguageGo = TelemetrySDKLanguageKey.String("go")
+ // java
+ // Stability: stable
+ TelemetrySDKLanguageJava = TelemetrySDKLanguageKey.String("java")
+ // nodejs
+ // Stability: stable
+ TelemetrySDKLanguageNodejs = TelemetrySDKLanguageKey.String("nodejs")
+ // php
+ // Stability: stable
+ TelemetrySDKLanguagePHP = TelemetrySDKLanguageKey.String("php")
+ // python
+ // Stability: stable
+ TelemetrySDKLanguagePython = TelemetrySDKLanguageKey.String("python")
+ // ruby
+ // Stability: stable
+ TelemetrySDKLanguageRuby = TelemetrySDKLanguageKey.String("ruby")
+ // rust
+ // Stability: stable
+ TelemetrySDKLanguageRust = TelemetrySDKLanguageKey.String("rust")
+ // swift
+ // Stability: stable
+ TelemetrySDKLanguageSwift = TelemetrySDKLanguageKey.String("swift")
+ // webjs
+ // Stability: stable
+ TelemetrySDKLanguageWebJS = TelemetrySDKLanguageKey.String("webjs")
+)
+
+// Namespace: test
+const (
+ // TestCaseNameKey is the attribute Key conforming to the "test.case.name"
+ // semantic conventions. It represents the fully qualified human readable name
+ // of the [test case].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "org.example.TestCase1.test1", "example/tests/TestCase1.test1",
+ // "ExampleTestCase1_test1"
+ //
+ // [test case]: https://wikipedia.org/wiki/Test_case
+ TestCaseNameKey = attribute.Key("test.case.name")
+
+ // TestCaseResultStatusKey is the attribute Key conforming to the
+ // "test.case.result.status" semantic conventions. It represents the status of
+ // the actual test case result from test execution.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "pass", "fail"
+ TestCaseResultStatusKey = attribute.Key("test.case.result.status")
+
+ // TestSuiteNameKey is the attribute Key conforming to the "test.suite.name"
+ // semantic conventions. It represents the human readable name of a [test suite]
+ // .
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TestSuite1"
+ //
+ // [test suite]: https://wikipedia.org/wiki/Test_suite
+ TestSuiteNameKey = attribute.Key("test.suite.name")
+
+ // TestSuiteRunStatusKey is the attribute Key conforming to the
+ // "test.suite.run.status" semantic conventions. It represents the status of the
+ // test suite run.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "success", "failure", "skipped", "aborted", "timed_out",
+ // "in_progress"
+ TestSuiteRunStatusKey = attribute.Key("test.suite.run.status")
+)
+
+// TestCaseName returns an attribute KeyValue conforming to the "test.case.name"
+// semantic conventions. It represents the fully qualified human readable name of
+// the [test case].
+//
+// [test case]: https://wikipedia.org/wiki/Test_case
+func TestCaseName(val string) attribute.KeyValue {
+ return TestCaseNameKey.String(val)
+}
+
+// TestSuiteName returns an attribute KeyValue conforming to the
+// "test.suite.name" semantic conventions. It represents the human readable name
+// of a [test suite].
+//
+// [test suite]: https://wikipedia.org/wiki/Test_suite
+func TestSuiteName(val string) attribute.KeyValue {
+ return TestSuiteNameKey.String(val)
+}
+
+// Enum values for test.case.result.status
+var (
+ // pass
+ // Stability: development
+ TestCaseResultStatusPass = TestCaseResultStatusKey.String("pass")
+ // fail
+ // Stability: development
+ TestCaseResultStatusFail = TestCaseResultStatusKey.String("fail")
+)
+
+// Enum values for test.suite.run.status
+var (
+ // success
+ // Stability: development
+ TestSuiteRunStatusSuccess = TestSuiteRunStatusKey.String("success")
+ // failure
+ // Stability: development
+ TestSuiteRunStatusFailure = TestSuiteRunStatusKey.String("failure")
+ // skipped
+ // Stability: development
+ TestSuiteRunStatusSkipped = TestSuiteRunStatusKey.String("skipped")
+ // aborted
+ // Stability: development
+ TestSuiteRunStatusAborted = TestSuiteRunStatusKey.String("aborted")
+ // timed_out
+ // Stability: development
+ TestSuiteRunStatusTimedOut = TestSuiteRunStatusKey.String("timed_out")
+ // in_progress
+ // Stability: development
+ TestSuiteRunStatusInProgress = TestSuiteRunStatusKey.String("in_progress")
+)
+
+// Namespace: thread
+const (
+ // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic
+ // conventions. It represents the current "managed" thread ID (as opposed to OS
+ // thread ID).
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ ThreadIDKey = attribute.Key("thread.id")
+
+ // ThreadNameKey is the attribute Key conforming to the "thread.name" semantic
+ // conventions. It represents the current thread name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: main
+ ThreadNameKey = attribute.Key("thread.name")
+)
+
+// ThreadID returns an attribute KeyValue conforming to the "thread.id" semantic
+// conventions. It represents the current "managed" thread ID (as opposed to OS
+// thread ID).
+func ThreadID(val int) attribute.KeyValue {
+ return ThreadIDKey.Int(val)
+}
+
+// ThreadName returns an attribute KeyValue conforming to the "thread.name"
+// semantic conventions. It represents the current thread name.
+func ThreadName(val string) attribute.KeyValue {
+ return ThreadNameKey.String(val)
+}
+
+// Namespace: tls
+const (
+ // TLSCipherKey is the attribute Key conforming to the "tls.cipher" semantic
+ // conventions. It represents the string indicating the [cipher] used during the
+ // current connection.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TLS_RSA_WITH_3DES_EDE_CBC_SHA",
+ // "TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256"
+ // Note: The values allowed for `tls.cipher` MUST be one of the `Descriptions`
+ // of the [registered TLS Cipher Suits].
+ //
+ // [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5
+ // [registered TLS Cipher Suits]: https://www.iana.org/assignments/tls-parameters/tls-parameters.xhtml#table-tls-parameters-4
+ TLSCipherKey = attribute.Key("tls.cipher")
+
+ // TLSClientCertificateKey is the attribute Key conforming to the
+ // "tls.client.certificate" semantic conventions. It represents the PEM-encoded
+ // stand-alone certificate offered by the client. This is usually
+ // mutually-exclusive of `client.certificate_chain` since this value also exists
+ // in that list.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII..."
+ TLSClientCertificateKey = attribute.Key("tls.client.certificate")
+
+ // TLSClientCertificateChainKey is the attribute Key conforming to the
+ // "tls.client.certificate_chain" semantic conventions. It represents the array
+ // of PEM-encoded certificates that make up the certificate chain offered by the
+ // client. This is usually mutually-exclusive of `client.certificate` since that
+ // value should be the first certificate in the chain.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII...", "MI..."
+ TLSClientCertificateChainKey = attribute.Key("tls.client.certificate_chain")
+
+ // TLSClientHashMd5Key is the attribute Key conforming to the
+ // "tls.client.hash.md5" semantic conventions. It represents the certificate
+ // fingerprint using the MD5 digest of DER-encoded version of certificate
+ // offered by the client. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC"
+ TLSClientHashMd5Key = attribute.Key("tls.client.hash.md5")
+
+ // TLSClientHashSha1Key is the attribute Key conforming to the
+ // "tls.client.hash.sha1" semantic conventions. It represents the certificate
+ // fingerprint using the SHA1 digest of DER-encoded version of certificate
+ // offered by the client. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A"
+ TLSClientHashSha1Key = attribute.Key("tls.client.hash.sha1")
+
+ // TLSClientHashSha256Key is the attribute Key conforming to the
+ // "tls.client.hash.sha256" semantic conventions. It represents the certificate
+ // fingerprint using the SHA256 digest of DER-encoded version of certificate
+ // offered by the client. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0"
+ TLSClientHashSha256Key = attribute.Key("tls.client.hash.sha256")
+
+ // TLSClientIssuerKey is the attribute Key conforming to the "tls.client.issuer"
+ // semantic conventions. It represents the distinguished name of [subject] of
+ // the issuer of the x.509 certificate presented by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com"
+ //
+ // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+ TLSClientIssuerKey = attribute.Key("tls.client.issuer")
+
+ // TLSClientJa3Key is the attribute Key conforming to the "tls.client.ja3"
+ // semantic conventions. It represents a hash that identifies clients based on
+ // how they perform an SSL/TLS handshake.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "d4e5b18d6b55c71272893221c96ba240"
+ TLSClientJa3Key = attribute.Key("tls.client.ja3")
+
+ // TLSClientNotAfterKey is the attribute Key conforming to the
+ // "tls.client.not_after" semantic conventions. It represents the date/Time
+ // indicating when client certificate is no longer considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T00:00:00.000Z"
+ TLSClientNotAfterKey = attribute.Key("tls.client.not_after")
+
+ // TLSClientNotBeforeKey is the attribute Key conforming to the
+ // "tls.client.not_before" semantic conventions. It represents the date/Time
+ // indicating when client certificate is first considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1970-01-01T00:00:00.000Z"
+ TLSClientNotBeforeKey = attribute.Key("tls.client.not_before")
+
+ // TLSClientSubjectKey is the attribute Key conforming to the
+ // "tls.client.subject" semantic conventions. It represents the distinguished
+ // name of subject of the x.509 certificate presented by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=myclient, OU=Documentation Team, DC=example, DC=com"
+ TLSClientSubjectKey = attribute.Key("tls.client.subject")
+
+ // TLSClientSupportedCiphersKey is the attribute Key conforming to the
+ // "tls.client.supported_ciphers" semantic conventions. It represents the array
+ // of ciphers offered by the client during the client hello.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384",
+ // "TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384"
+ TLSClientSupportedCiphersKey = attribute.Key("tls.client.supported_ciphers")
+
+ // TLSCurveKey is the attribute Key conforming to the "tls.curve" semantic
+ // conventions. It represents the string indicating the curve used for the given
+ // cipher, when applicable.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "secp256r1"
+ TLSCurveKey = attribute.Key("tls.curve")
+
+ // TLSEstablishedKey is the attribute Key conforming to the "tls.established"
+ // semantic conventions. It represents the boolean flag indicating if the TLS
+ // negotiation was successful and transitioned to an encrypted tunnel.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: true
+ TLSEstablishedKey = attribute.Key("tls.established")
+
+ // TLSNextProtocolKey is the attribute Key conforming to the "tls.next_protocol"
+ // semantic conventions. It represents the string indicating the protocol being
+ // tunneled. Per the values in the [IANA registry], this string should be lower
+ // case.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "http/1.1"
+ //
+ // [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids
+ TLSNextProtocolKey = attribute.Key("tls.next_protocol")
+
+ // TLSProtocolNameKey is the attribute Key conforming to the "tls.protocol.name"
+ // semantic conventions. It represents the normalized lowercase protocol name
+ // parsed from original string of the negotiated [SSL/TLS protocol version].
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ //
+ // [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values
+ TLSProtocolNameKey = attribute.Key("tls.protocol.name")
+
+ // TLSProtocolVersionKey is the attribute Key conforming to the
+ // "tls.protocol.version" semantic conventions. It represents the numeric part
+ // of the version parsed from the original string of the negotiated
+ // [SSL/TLS protocol version].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1.2", "3"
+ //
+ // [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values
+ TLSProtocolVersionKey = attribute.Key("tls.protocol.version")
+
+ // TLSResumedKey is the attribute Key conforming to the "tls.resumed" semantic
+ // conventions. It represents the boolean flag indicating if this TLS connection
+ // was resumed from an existing TLS negotiation.
+ //
+ // Type: boolean
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: true
+ TLSResumedKey = attribute.Key("tls.resumed")
+
+ // TLSServerCertificateKey is the attribute Key conforming to the
+ // "tls.server.certificate" semantic conventions. It represents the PEM-encoded
+ // stand-alone certificate offered by the server. This is usually
+ // mutually-exclusive of `server.certificate_chain` since this value also exists
+ // in that list.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII..."
+ TLSServerCertificateKey = attribute.Key("tls.server.certificate")
+
+ // TLSServerCertificateChainKey is the attribute Key conforming to the
+ // "tls.server.certificate_chain" semantic conventions. It represents the array
+ // of PEM-encoded certificates that make up the certificate chain offered by the
+ // server. This is usually mutually-exclusive of `server.certificate` since that
+ // value should be the first certificate in the chain.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "MII...", "MI..."
+ TLSServerCertificateChainKey = attribute.Key("tls.server.certificate_chain")
+
+ // TLSServerHashMd5Key is the attribute Key conforming to the
+ // "tls.server.hash.md5" semantic conventions. It represents the certificate
+ // fingerprint using the MD5 digest of DER-encoded version of certificate
+ // offered by the server. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC"
+ TLSServerHashMd5Key = attribute.Key("tls.server.hash.md5")
+
+ // TLSServerHashSha1Key is the attribute Key conforming to the
+ // "tls.server.hash.sha1" semantic conventions. It represents the certificate
+ // fingerprint using the SHA1 digest of DER-encoded version of certificate
+ // offered by the server. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A"
+ TLSServerHashSha1Key = attribute.Key("tls.server.hash.sha1")
+
+ // TLSServerHashSha256Key is the attribute Key conforming to the
+ // "tls.server.hash.sha256" semantic conventions. It represents the certificate
+ // fingerprint using the SHA256 digest of DER-encoded version of certificate
+ // offered by the server. For consistency with other hash values, this value
+ // should be formatted as an uppercase hash.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0"
+ TLSServerHashSha256Key = attribute.Key("tls.server.hash.sha256")
+
+ // TLSServerIssuerKey is the attribute Key conforming to the "tls.server.issuer"
+ // semantic conventions. It represents the distinguished name of [subject] of
+ // the issuer of the x.509 certificate presented by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com"
+ //
+ // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+ TLSServerIssuerKey = attribute.Key("tls.server.issuer")
+
+ // TLSServerJa3sKey is the attribute Key conforming to the "tls.server.ja3s"
+ // semantic conventions. It represents a hash that identifies servers based on
+ // how they perform an SSL/TLS handshake.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "d4e5b18d6b55c71272893221c96ba240"
+ TLSServerJa3sKey = attribute.Key("tls.server.ja3s")
+
+ // TLSServerNotAfterKey is the attribute Key conforming to the
+ // "tls.server.not_after" semantic conventions. It represents the date/Time
+ // indicating when server certificate is no longer considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "2021-01-01T00:00:00.000Z"
+ TLSServerNotAfterKey = attribute.Key("tls.server.not_after")
+
+ // TLSServerNotBeforeKey is the attribute Key conforming to the
+ // "tls.server.not_before" semantic conventions. It represents the date/Time
+ // indicating when server certificate is first considered valid.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "1970-01-01T00:00:00.000Z"
+ TLSServerNotBeforeKey = attribute.Key("tls.server.not_before")
+
+ // TLSServerSubjectKey is the attribute Key conforming to the
+ // "tls.server.subject" semantic conventions. It represents the distinguished
+ // name of subject of the x.509 certificate presented by the server.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "CN=myserver, OU=Documentation Team, DC=example, DC=com"
+ TLSServerSubjectKey = attribute.Key("tls.server.subject")
+)
+
+// TLSCipher returns an attribute KeyValue conforming to the "tls.cipher"
+// semantic conventions. It represents the string indicating the [cipher] used
+// during the current connection.
+//
+// [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5
+func TLSCipher(val string) attribute.KeyValue {
+ return TLSCipherKey.String(val)
+}
+
+// TLSClientCertificate returns an attribute KeyValue conforming to the
+// "tls.client.certificate" semantic conventions. It represents the PEM-encoded
+// stand-alone certificate offered by the client. This is usually
+// mutually-exclusive of `client.certificate_chain` since this value also exists
+// in that list.
+func TLSClientCertificate(val string) attribute.KeyValue {
+ return TLSClientCertificateKey.String(val)
+}
+
+// TLSClientCertificateChain returns an attribute KeyValue conforming to the
+// "tls.client.certificate_chain" semantic conventions. It represents the array
+// of PEM-encoded certificates that make up the certificate chain offered by the
+// client. This is usually mutually-exclusive of `client.certificate` since that
+// value should be the first certificate in the chain.
+func TLSClientCertificateChain(val ...string) attribute.KeyValue {
+ return TLSClientCertificateChainKey.StringSlice(val)
+}
+
+// TLSClientHashMd5 returns an attribute KeyValue conforming to the
+// "tls.client.hash.md5" semantic conventions. It represents the certificate
+// fingerprint using the MD5 digest of DER-encoded version of certificate offered
+// by the client. For consistency with other hash values, this value should be
+// formatted as an uppercase hash.
+func TLSClientHashMd5(val string) attribute.KeyValue {
+ return TLSClientHashMd5Key.String(val)
+}
+
+// TLSClientHashSha1 returns an attribute KeyValue conforming to the
+// "tls.client.hash.sha1" semantic conventions. It represents the certificate
+// fingerprint using the SHA1 digest of DER-encoded version of certificate
+// offered by the client. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSClientHashSha1(val string) attribute.KeyValue {
+ return TLSClientHashSha1Key.String(val)
+}
+
+// TLSClientHashSha256 returns an attribute KeyValue conforming to the
+// "tls.client.hash.sha256" semantic conventions. It represents the certificate
+// fingerprint using the SHA256 digest of DER-encoded version of certificate
+// offered by the client. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSClientHashSha256(val string) attribute.KeyValue {
+ return TLSClientHashSha256Key.String(val)
+}
+
+// TLSClientIssuer returns an attribute KeyValue conforming to the
+// "tls.client.issuer" semantic conventions. It represents the distinguished name
+// of [subject] of the issuer of the x.509 certificate presented by the client.
+//
+// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+func TLSClientIssuer(val string) attribute.KeyValue {
+ return TLSClientIssuerKey.String(val)
+}
+
+// TLSClientJa3 returns an attribute KeyValue conforming to the "tls.client.ja3"
+// semantic conventions. It represents a hash that identifies clients based on
+// how they perform an SSL/TLS handshake.
+func TLSClientJa3(val string) attribute.KeyValue {
+ return TLSClientJa3Key.String(val)
+}
+
+// TLSClientNotAfter returns an attribute KeyValue conforming to the
+// "tls.client.not_after" semantic conventions. It represents the date/Time
+// indicating when client certificate is no longer considered valid.
+func TLSClientNotAfter(val string) attribute.KeyValue {
+ return TLSClientNotAfterKey.String(val)
+}
+
+// TLSClientNotBefore returns an attribute KeyValue conforming to the
+// "tls.client.not_before" semantic conventions. It represents the date/Time
+// indicating when client certificate is first considered valid.
+func TLSClientNotBefore(val string) attribute.KeyValue {
+ return TLSClientNotBeforeKey.String(val)
+}
+
+// TLSClientSubject returns an attribute KeyValue conforming to the
+// "tls.client.subject" semantic conventions. It represents the distinguished
+// name of subject of the x.509 certificate presented by the client.
+func TLSClientSubject(val string) attribute.KeyValue {
+ return TLSClientSubjectKey.String(val)
+}
+
+// TLSClientSupportedCiphers returns an attribute KeyValue conforming to the
+// "tls.client.supported_ciphers" semantic conventions. It represents the array
+// of ciphers offered by the client during the client hello.
+func TLSClientSupportedCiphers(val ...string) attribute.KeyValue {
+ return TLSClientSupportedCiphersKey.StringSlice(val)
+}
+
+// TLSCurve returns an attribute KeyValue conforming to the "tls.curve" semantic
+// conventions. It represents the string indicating the curve used for the given
+// cipher, when applicable.
+func TLSCurve(val string) attribute.KeyValue {
+ return TLSCurveKey.String(val)
+}
+
+// TLSEstablished returns an attribute KeyValue conforming to the
+// "tls.established" semantic conventions. It represents the boolean flag
+// indicating if the TLS negotiation was successful and transitioned to an
+// encrypted tunnel.
+func TLSEstablished(val bool) attribute.KeyValue {
+ return TLSEstablishedKey.Bool(val)
+}
+
+// TLSNextProtocol returns an attribute KeyValue conforming to the
+// "tls.next_protocol" semantic conventions. It represents the string indicating
+// the protocol being tunneled. Per the values in the [IANA registry], this
+// string should be lower case.
+//
+// [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids
+func TLSNextProtocol(val string) attribute.KeyValue {
+ return TLSNextProtocolKey.String(val)
+}
+
+// TLSProtocolVersion returns an attribute KeyValue conforming to the
+// "tls.protocol.version" semantic conventions. It represents the numeric part of
+// the version parsed from the original string of the negotiated
+// [SSL/TLS protocol version].
+//
+// [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values
+func TLSProtocolVersion(val string) attribute.KeyValue {
+ return TLSProtocolVersionKey.String(val)
+}
+
+// TLSResumed returns an attribute KeyValue conforming to the "tls.resumed"
+// semantic conventions. It represents the boolean flag indicating if this TLS
+// connection was resumed from an existing TLS negotiation.
+func TLSResumed(val bool) attribute.KeyValue {
+ return TLSResumedKey.Bool(val)
+}
+
+// TLSServerCertificate returns an attribute KeyValue conforming to the
+// "tls.server.certificate" semantic conventions. It represents the PEM-encoded
+// stand-alone certificate offered by the server. This is usually
+// mutually-exclusive of `server.certificate_chain` since this value also exists
+// in that list.
+func TLSServerCertificate(val string) attribute.KeyValue {
+ return TLSServerCertificateKey.String(val)
+}
+
+// TLSServerCertificateChain returns an attribute KeyValue conforming to the
+// "tls.server.certificate_chain" semantic conventions. It represents the array
+// of PEM-encoded certificates that make up the certificate chain offered by the
+// server. This is usually mutually-exclusive of `server.certificate` since that
+// value should be the first certificate in the chain.
+func TLSServerCertificateChain(val ...string) attribute.KeyValue {
+ return TLSServerCertificateChainKey.StringSlice(val)
+}
+
+// TLSServerHashMd5 returns an attribute KeyValue conforming to the
+// "tls.server.hash.md5" semantic conventions. It represents the certificate
+// fingerprint using the MD5 digest of DER-encoded version of certificate offered
+// by the server. For consistency with other hash values, this value should be
+// formatted as an uppercase hash.
+func TLSServerHashMd5(val string) attribute.KeyValue {
+ return TLSServerHashMd5Key.String(val)
+}
+
+// TLSServerHashSha1 returns an attribute KeyValue conforming to the
+// "tls.server.hash.sha1" semantic conventions. It represents the certificate
+// fingerprint using the SHA1 digest of DER-encoded version of certificate
+// offered by the server. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSServerHashSha1(val string) attribute.KeyValue {
+ return TLSServerHashSha1Key.String(val)
+}
+
+// TLSServerHashSha256 returns an attribute KeyValue conforming to the
+// "tls.server.hash.sha256" semantic conventions. It represents the certificate
+// fingerprint using the SHA256 digest of DER-encoded version of certificate
+// offered by the server. For consistency with other hash values, this value
+// should be formatted as an uppercase hash.
+func TLSServerHashSha256(val string) attribute.KeyValue {
+ return TLSServerHashSha256Key.String(val)
+}
+
+// TLSServerIssuer returns an attribute KeyValue conforming to the
+// "tls.server.issuer" semantic conventions. It represents the distinguished name
+// of [subject] of the issuer of the x.509 certificate presented by the client.
+//
+// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6
+func TLSServerIssuer(val string) attribute.KeyValue {
+ return TLSServerIssuerKey.String(val)
+}
+
+// TLSServerJa3s returns an attribute KeyValue conforming to the
+// "tls.server.ja3s" semantic conventions. It represents a hash that identifies
+// servers based on how they perform an SSL/TLS handshake.
+func TLSServerJa3s(val string) attribute.KeyValue {
+ return TLSServerJa3sKey.String(val)
+}
+
+// TLSServerNotAfter returns an attribute KeyValue conforming to the
+// "tls.server.not_after" semantic conventions. It represents the date/Time
+// indicating when server certificate is no longer considered valid.
+func TLSServerNotAfter(val string) attribute.KeyValue {
+ return TLSServerNotAfterKey.String(val)
+}
+
+// TLSServerNotBefore returns an attribute KeyValue conforming to the
+// "tls.server.not_before" semantic conventions. It represents the date/Time
+// indicating when server certificate is first considered valid.
+func TLSServerNotBefore(val string) attribute.KeyValue {
+ return TLSServerNotBeforeKey.String(val)
+}
+
+// TLSServerSubject returns an attribute KeyValue conforming to the
+// "tls.server.subject" semantic conventions. It represents the distinguished
+// name of subject of the x.509 certificate presented by the server.
+func TLSServerSubject(val string) attribute.KeyValue {
+ return TLSServerSubjectKey.String(val)
+}
+
+// Enum values for tls.protocol.name
+var (
+ // ssl
+ // Stability: development
+ TLSProtocolNameSsl = TLSProtocolNameKey.String("ssl")
+ // tls
+ // Stability: development
+ TLSProtocolNameTLS = TLSProtocolNameKey.String("tls")
+)
+
+// Namespace: url
+const (
+ // URLDomainKey is the attribute Key conforming to the "url.domain" semantic
+ // conventions. It represents the domain extracted from the `url.full`, such as
+ // "opentelemetry.io".
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "www.foo.bar", "opentelemetry.io", "3.12.167.2",
+ // "[1080:0:0:0:8:800:200C:417A]"
+ // Note: In some cases a URL may refer to an IP and/or port directly, without a
+ // domain name. In this case, the IP address would go to the domain field. If
+ // the URL contains a [literal IPv6 address] enclosed by `[` and `]`, the `[`
+ // and `]` characters should also be captured in the domain field.
+ //
+ // [literal IPv6 address]: https://www.rfc-editor.org/rfc/rfc2732#section-2
+ URLDomainKey = attribute.Key("url.domain")
+
+ // URLExtensionKey is the attribute Key conforming to the "url.extension"
+ // semantic conventions. It represents the file extension extracted from the
+ // `url.full`, excluding the leading dot.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "png", "gz"
+ // Note: The file extension is only set if it exists, as not every url has a
+ // file extension. When the file name has multiple extensions `example.tar.gz`,
+ // only the last one should be captured `gz`, not `tar.gz`.
+ URLExtensionKey = attribute.Key("url.extension")
+
+ // URLFragmentKey is the attribute Key conforming to the "url.fragment" semantic
+ // conventions. It represents the [URI fragment] component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "SemConv"
+ //
+ // [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5
+ URLFragmentKey = attribute.Key("url.fragment")
+
+ // URLFullKey is the attribute Key conforming to the "url.full" semantic
+ // conventions. It represents the absolute URL describing a network resource
+ // according to [RFC3986].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", "//localhost"
+ // Note: For network calls, URL usually has
+ // `scheme://host[:port][path][?query][#fragment]` format, where the fragment
+ // is not transmitted over HTTP, but if it is known, it SHOULD be included
+ // nevertheless.
+ //
+ // `url.full` MUST NOT contain credentials passed via URL in form of
+ // `https://username:password@www.example.com/`.
+ // In such case username and password SHOULD be redacted and attribute's value
+ // SHOULD be `https://REDACTED:REDACTED@www.example.com/`.
+ //
+ // `url.full` SHOULD capture the absolute URL when it is available (or can be
+ // reconstructed).
+ //
+ // Sensitive content provided in `url.full` SHOULD be scrubbed when
+ // instrumentations can identify it.
+ //
+ //
+ // Query string values for the following keys SHOULD be redacted by default and
+ // replaced by the
+ // value `REDACTED`:
+ //
+ // - [`AWSAccessKeyId`]
+ // - [`Signature`]
+ // - [`sig`]
+ // - [`X-Goog-Signature`]
+ //
+ // This list is subject to change over time.
+ //
+ // When a query string value is redacted, the query string key SHOULD still be
+ // preserved, e.g.
+ // `https://www.example.com/path?color=blue&sig=REDACTED`.
+ //
+ // [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986
+ // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token
+ // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls
+ URLFullKey = attribute.Key("url.full")
+
+ // URLOriginalKey is the attribute Key conforming to the "url.original" semantic
+ // conventions. It represents the unmodified original URL as seen in the event
+ // source.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv",
+ // "search?q=OpenTelemetry"
+ // Note: In network monitoring, the observed URL may be a full URL, whereas in
+ // access logs, the URL is often just represented as a path. This field is meant
+ // to represent the URL as it was observed, complete or not.
+ // `url.original` might contain credentials passed via URL in form of
+ // `https://username:password@www.example.com/`. In such case password and
+ // username SHOULD NOT be redacted and attribute's value SHOULD remain the same.
+ URLOriginalKey = attribute.Key("url.original")
+
+ // URLPathKey is the attribute Key conforming to the "url.path" semantic
+ // conventions. It represents the [URI path] component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "/search"
+ // Note: Sensitive content provided in `url.path` SHOULD be scrubbed when
+ // instrumentations can identify it.
+ //
+ // [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3
+ URLPathKey = attribute.Key("url.path")
+
+ // URLPortKey is the attribute Key conforming to the "url.port" semantic
+ // conventions. It represents the port extracted from the `url.full`.
+ //
+ // Type: int
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: 443
+ URLPortKey = attribute.Key("url.port")
+
+ // URLQueryKey is the attribute Key conforming to the "url.query" semantic
+ // conventions. It represents the [URI query] component.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "q=OpenTelemetry"
+ // Note: Sensitive content provided in `url.query` SHOULD be scrubbed when
+ // instrumentations can identify it.
+ //
+ //
+ // Query string values for the following keys SHOULD be redacted by default and
+ // replaced by the value `REDACTED`:
+ //
+ // - [`AWSAccessKeyId`]
+ // - [`Signature`]
+ // - [`sig`]
+ // - [`X-Goog-Signature`]
+ //
+ // This list is subject to change over time.
+ //
+ // When a query string value is redacted, the query string key SHOULD still be
+ // preserved, e.g.
+ // `q=OpenTelemetry&sig=REDACTED`.
+ //
+ // [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4
+ // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth
+ // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token
+ // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls
+ URLQueryKey = attribute.Key("url.query")
+
+ // URLRegisteredDomainKey is the attribute Key conforming to the
+ // "url.registered_domain" semantic conventions. It represents the highest
+ // registered url domain, stripped of the subdomain.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "example.com", "foo.co.uk"
+ // Note: This value can be determined precisely with the [public suffix list].
+ // For example, the registered domain for `foo.example.com` is `example.com`.
+ // Trying to approximate this by simply taking the last two labels will not work
+ // well for TLDs such as `co.uk`.
+ //
+ // [public suffix list]: https://publicsuffix.org/
+ URLRegisteredDomainKey = attribute.Key("url.registered_domain")
+
+ // URLSchemeKey is the attribute Key conforming to the "url.scheme" semantic
+ // conventions. It represents the [URI scheme] component identifying the used
+ // protocol.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "https", "ftp", "telnet"
+ //
+ // [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1
+ URLSchemeKey = attribute.Key("url.scheme")
+
+ // URLSubdomainKey is the attribute Key conforming to the "url.subdomain"
+ // semantic conventions. It represents the subdomain portion of a fully
+ // qualified domain name includes all of the names except the host name under
+ // the registered_domain. In a partially qualified domain, or if the
+ // qualification level of the full name cannot be determined, subdomain contains
+ // all of the names below the registered domain.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "east", "sub2.sub1"
+ // Note: The subdomain portion of `www.east.mydomain.co.uk` is `east`. If the
+ // domain has multiple levels of subdomain, such as `sub2.sub1.example.com`, the
+ // subdomain field should contain `sub2.sub1`, with no trailing period.
+ URLSubdomainKey = attribute.Key("url.subdomain")
+
+ // URLTemplateKey is the attribute Key conforming to the "url.template" semantic
+ // conventions. It represents the low-cardinality template of an
+ // [absolute path reference].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "/users/{id}", "/users/:id", "/users?id={id}"
+ //
+ // [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2
+ URLTemplateKey = attribute.Key("url.template")
+
+ // URLTopLevelDomainKey is the attribute Key conforming to the
+ // "url.top_level_domain" semantic conventions. It represents the effective top
+ // level domain (eTLD), also known as the domain suffix, is the last part of the
+ // domain name. For example, the top level domain for example.com is `com`.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "com", "co.uk"
+ // Note: This value can be determined precisely with the [public suffix list].
+ //
+ // [public suffix list]: https://publicsuffix.org/
+ URLTopLevelDomainKey = attribute.Key("url.top_level_domain")
+)
+
+// URLDomain returns an attribute KeyValue conforming to the "url.domain"
+// semantic conventions. It represents the domain extracted from the `url.full`,
+// such as "opentelemetry.io".
+func URLDomain(val string) attribute.KeyValue {
+ return URLDomainKey.String(val)
+}
+
+// URLExtension returns an attribute KeyValue conforming to the "url.extension"
+// semantic conventions. It represents the file extension extracted from the
+// `url.full`, excluding the leading dot.
+func URLExtension(val string) attribute.KeyValue {
+ return URLExtensionKey.String(val)
+}
+
+// URLFragment returns an attribute KeyValue conforming to the "url.fragment"
+// semantic conventions. It represents the [URI fragment] component.
+//
+// [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5
+func URLFragment(val string) attribute.KeyValue {
+ return URLFragmentKey.String(val)
+}
+
+// URLFull returns an attribute KeyValue conforming to the "url.full" semantic
+// conventions. It represents the absolute URL describing a network resource
+// according to [RFC3986].
+//
+// [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986
+func URLFull(val string) attribute.KeyValue {
+ return URLFullKey.String(val)
+}
+
+// URLOriginal returns an attribute KeyValue conforming to the "url.original"
+// semantic conventions. It represents the unmodified original URL as seen in the
+// event source.
+func URLOriginal(val string) attribute.KeyValue {
+ return URLOriginalKey.String(val)
+}
+
+// URLPath returns an attribute KeyValue conforming to the "url.path" semantic
+// conventions. It represents the [URI path] component.
+//
+// [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3
+func URLPath(val string) attribute.KeyValue {
+ return URLPathKey.String(val)
+}
+
+// URLPort returns an attribute KeyValue conforming to the "url.port" semantic
+// conventions. It represents the port extracted from the `url.full`.
+func URLPort(val int) attribute.KeyValue {
+ return URLPortKey.Int(val)
+}
+
+// URLQuery returns an attribute KeyValue conforming to the "url.query" semantic
+// conventions. It represents the [URI query] component.
+//
+// [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4
+func URLQuery(val string) attribute.KeyValue {
+ return URLQueryKey.String(val)
+}
+
+// URLRegisteredDomain returns an attribute KeyValue conforming to the
+// "url.registered_domain" semantic conventions. It represents the highest
+// registered url domain, stripped of the subdomain.
+func URLRegisteredDomain(val string) attribute.KeyValue {
+ return URLRegisteredDomainKey.String(val)
+}
+
+// URLScheme returns an attribute KeyValue conforming to the "url.scheme"
+// semantic conventions. It represents the [URI scheme] component identifying the
+// used protocol.
+//
+// [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1
+func URLScheme(val string) attribute.KeyValue {
+ return URLSchemeKey.String(val)
+}
+
+// URLSubdomain returns an attribute KeyValue conforming to the "url.subdomain"
+// semantic conventions. It represents the subdomain portion of a fully qualified
+// domain name includes all of the names except the host name under the
+// registered_domain. In a partially qualified domain, or if the qualification
+// level of the full name cannot be determined, subdomain contains all of the
+// names below the registered domain.
+func URLSubdomain(val string) attribute.KeyValue {
+ return URLSubdomainKey.String(val)
+}
+
+// URLTemplate returns an attribute KeyValue conforming to the "url.template"
+// semantic conventions. It represents the low-cardinality template of an
+// [absolute path reference].
+//
+// [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2
+func URLTemplate(val string) attribute.KeyValue {
+ return URLTemplateKey.String(val)
+}
+
+// URLTopLevelDomain returns an attribute KeyValue conforming to the
+// "url.top_level_domain" semantic conventions. It represents the effective top
+// level domain (eTLD), also known as the domain suffix, is the last part of the
+// domain name. For example, the top level domain for example.com is `com`.
+func URLTopLevelDomain(val string) attribute.KeyValue {
+ return URLTopLevelDomainKey.String(val)
+}
+
+// Namespace: user
+const (
+ // UserEmailKey is the attribute Key conforming to the "user.email" semantic
+ // conventions. It represents the user email address.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "a.einstein@example.com"
+ UserEmailKey = attribute.Key("user.email")
+
+ // UserFullNameKey is the attribute Key conforming to the "user.full_name"
+ // semantic conventions. It represents the user's full name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Albert Einstein"
+ UserFullNameKey = attribute.Key("user.full_name")
+
+ // UserHashKey is the attribute Key conforming to the "user.hash" semantic
+ // conventions. It represents the unique user hash to correlate information for
+ // a user in anonymized form.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "364fc68eaf4c8acec74a4e52d7d1feaa"
+ // Note: Useful if `user.id` or `user.name` contain confidential information and
+ // cannot be used.
+ UserHashKey = attribute.Key("user.hash")
+
+ // UserIDKey is the attribute Key conforming to the "user.id" semantic
+ // conventions. It represents the unique identifier of the user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "S-1-5-21-202424912787-2692429404-2351956786-1000"
+ UserIDKey = attribute.Key("user.id")
+
+ // UserNameKey is the attribute Key conforming to the "user.name" semantic
+ // conventions. It represents the short name or login/username of the user.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "a.einstein"
+ UserNameKey = attribute.Key("user.name")
+
+ // UserRolesKey is the attribute Key conforming to the "user.roles" semantic
+ // conventions. It represents the array of user roles at the time of the event.
+ //
+ // Type: string[]
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "admin", "reporting_user"
+ UserRolesKey = attribute.Key("user.roles")
+)
+
+// UserEmail returns an attribute KeyValue conforming to the "user.email"
+// semantic conventions. It represents the user email address.
+func UserEmail(val string) attribute.KeyValue {
+ return UserEmailKey.String(val)
+}
+
+// UserFullName returns an attribute KeyValue conforming to the "user.full_name"
+// semantic conventions. It represents the user's full name.
+func UserFullName(val string) attribute.KeyValue {
+ return UserFullNameKey.String(val)
+}
+
+// UserHash returns an attribute KeyValue conforming to the "user.hash" semantic
+// conventions. It represents the unique user hash to correlate information for a
+// user in anonymized form.
+func UserHash(val string) attribute.KeyValue {
+ return UserHashKey.String(val)
+}
+
+// UserID returns an attribute KeyValue conforming to the "user.id" semantic
+// conventions. It represents the unique identifier of the user.
+func UserID(val string) attribute.KeyValue {
+ return UserIDKey.String(val)
+}
+
+// UserName returns an attribute KeyValue conforming to the "user.name" semantic
+// conventions. It represents the short name or login/username of the user.
+func UserName(val string) attribute.KeyValue {
+ return UserNameKey.String(val)
+}
+
+// UserRoles returns an attribute KeyValue conforming to the "user.roles"
+// semantic conventions. It represents the array of user roles at the time of the
+// event.
+func UserRoles(val ...string) attribute.KeyValue {
+ return UserRolesKey.StringSlice(val)
+}
+
+// Namespace: user_agent
+const (
+ // UserAgentNameKey is the attribute Key conforming to the "user_agent.name"
+ // semantic conventions. It represents the name of the user-agent extracted from
+ // original. Usually refers to the browser's name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Safari", "YourApp"
+ // Note: [Example] of extracting browser's name from original string. In the
+ // case of using a user-agent for non-browser products, such as microservices
+ // with multiple names/versions inside the `user_agent.original`, the most
+ // significant name SHOULD be selected. In such a scenario it should align with
+ // `user_agent.version`
+ //
+ // [Example]: https://www.whatsmyua.info
+ UserAgentNameKey = attribute.Key("user_agent.name")
+
+ // UserAgentOriginalKey is the attribute Key conforming to the
+ // "user_agent.original" semantic conventions. It represents the value of the
+ // [HTTP User-Agent] header sent by the client.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Stable
+ //
+ // Examples: "CERN-LineMode/2.15 libwww/2.17b3", "Mozilla/5.0 (iPhone; CPU
+ // iPhone OS 14_7_1 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko)
+ // Version/14.1.2 Mobile/15E148 Safari/604.1", "YourApp/1.0.0
+ // grpc-java-okhttp/1.27.2"
+ //
+ // [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent
+ UserAgentOriginalKey = attribute.Key("user_agent.original")
+
+ // UserAgentOSNameKey is the attribute Key conforming to the
+ // "user_agent.os.name" semantic conventions. It represents the human readable
+ // operating system name.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "iOS", "Android", "Ubuntu"
+ // Note: For mapping user agent strings to OS names, libraries such as
+ // [ua-parser] can be utilized.
+ //
+ // [ua-parser]: https://github.com/ua-parser
+ UserAgentOSNameKey = attribute.Key("user_agent.os.name")
+
+ // UserAgentOSVersionKey is the attribute Key conforming to the
+ // "user_agent.os.version" semantic conventions. It represents the version
+ // string of the operating system as defined in [Version Attributes].
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "14.2.1", "18.04.1"
+ // Note: For mapping user agent strings to OS versions, libraries such as
+ // [ua-parser] can be utilized.
+ //
+ // [Version Attributes]: /docs/resource/README.md#version-attributes
+ // [ua-parser]: https://github.com/ua-parser
+ UserAgentOSVersionKey = attribute.Key("user_agent.os.version")
+
+ // UserAgentSyntheticTypeKey is the attribute Key conforming to the
+ // "user_agent.synthetic.type" semantic conventions. It represents the specifies
+ // the category of synthetic traffic, such as tests or bots.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // Note: This attribute MAY be derived from the contents of the
+ // `user_agent.original` attribute. Components that populate the attribute are
+ // responsible for determining what they consider to be synthetic bot or test
+ // traffic. This attribute can either be set for self-identification purposes,
+ // or on telemetry detected to be generated as a result of a synthetic request.
+ // This attribute is useful for distinguishing between genuine client traffic
+ // and synthetic traffic generated by bots or tests.
+ UserAgentSyntheticTypeKey = attribute.Key("user_agent.synthetic.type")
+
+ // UserAgentVersionKey is the attribute Key conforming to the
+ // "user_agent.version" semantic conventions. It represents the version of the
+ // user-agent extracted from original. Usually refers to the browser's version.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "14.1.2", "1.0.0"
+ // Note: [Example] of extracting browser's version from original string. In the
+ // case of using a user-agent for non-browser products, such as microservices
+ // with multiple names/versions inside the `user_agent.original`, the most
+ // significant version SHOULD be selected. In such a scenario it should align
+ // with `user_agent.name`
+ //
+ // [Example]: https://www.whatsmyua.info
+ UserAgentVersionKey = attribute.Key("user_agent.version")
+)
+
+// UserAgentName returns an attribute KeyValue conforming to the
+// "user_agent.name" semantic conventions. It represents the name of the
+// user-agent extracted from original. Usually refers to the browser's name.
+func UserAgentName(val string) attribute.KeyValue {
+ return UserAgentNameKey.String(val)
+}
+
+// UserAgentOriginal returns an attribute KeyValue conforming to the
+// "user_agent.original" semantic conventions. It represents the value of the
+// [HTTP User-Agent] header sent by the client.
+//
+// [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent
+func UserAgentOriginal(val string) attribute.KeyValue {
+ return UserAgentOriginalKey.String(val)
+}
+
+// UserAgentOSName returns an attribute KeyValue conforming to the
+// "user_agent.os.name" semantic conventions. It represents the human readable
+// operating system name.
+func UserAgentOSName(val string) attribute.KeyValue {
+ return UserAgentOSNameKey.String(val)
+}
+
+// UserAgentOSVersion returns an attribute KeyValue conforming to the
+// "user_agent.os.version" semantic conventions. It represents the version string
+// of the operating system as defined in [Version Attributes].
+//
+// [Version Attributes]: /docs/resource/README.md#version-attributes
+func UserAgentOSVersion(val string) attribute.KeyValue {
+ return UserAgentOSVersionKey.String(val)
+}
+
+// UserAgentVersion returns an attribute KeyValue conforming to the
+// "user_agent.version" semantic conventions. It represents the version of the
+// user-agent extracted from original. Usually refers to the browser's version.
+func UserAgentVersion(val string) attribute.KeyValue {
+ return UserAgentVersionKey.String(val)
+}
+
+// Enum values for user_agent.synthetic.type
+var (
+ // Bot source.
+ // Stability: development
+ UserAgentSyntheticTypeBot = UserAgentSyntheticTypeKey.String("bot")
+ // Synthetic test source.
+ // Stability: development
+ UserAgentSyntheticTypeTest = UserAgentSyntheticTypeKey.String("test")
+)
+
+// Namespace: vcs
+const (
+ // VCSChangeIDKey is the attribute Key conforming to the "vcs.change.id"
+ // semantic conventions. It represents the ID of the change (pull request/merge
+ // request/changelist) if applicable. This is usually a unique (within
+ // repository) identifier generated by the VCS system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "123"
+ VCSChangeIDKey = attribute.Key("vcs.change.id")
+
+ // VCSChangeStateKey is the attribute Key conforming to the "vcs.change.state"
+ // semantic conventions. It represents the state of the change (pull
+ // request/merge request/changelist).
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "open", "closed", "merged"
+ VCSChangeStateKey = attribute.Key("vcs.change.state")
+
+ // VCSChangeTitleKey is the attribute Key conforming to the "vcs.change.title"
+ // semantic conventions. It represents the human readable title of the change
+ // (pull request/merge request/changelist). This title is often a brief summary
+ // of the change and may get merged in to a ref as the commit summary.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "Fixes broken thing", "feat: add my new feature", "[chore] update
+ // dependency"
+ VCSChangeTitleKey = attribute.Key("vcs.change.title")
+
+ // VCSLineChangeTypeKey is the attribute Key conforming to the
+ // "vcs.line_change.type" semantic conventions. It represents the type of line
+ // change being measured on a branch or change.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "added", "removed"
+ VCSLineChangeTypeKey = attribute.Key("vcs.line_change.type")
+
+ // VCSOwnerNameKey is the attribute Key conforming to the "vcs.owner.name"
+ // semantic conventions. It represents the group owner within the version
+ // control system.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-org", "myteam", "business-unit"
+ VCSOwnerNameKey = attribute.Key("vcs.owner.name")
+
+ // VCSProviderNameKey is the attribute Key conforming to the "vcs.provider.name"
+ // semantic conventions. It represents the name of the version control system
+ // provider.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "github", "gitlab", "gitea", "bitbucket"
+ VCSProviderNameKey = attribute.Key("vcs.provider.name")
+
+ // VCSRefBaseNameKey is the attribute Key conforming to the "vcs.ref.base.name"
+ // semantic conventions. It represents the name of the [reference] such as
+ // **branch** or **tag** in the repository.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-feature-branch", "tag-1-test"
+ // Note: `base` refers to the starting point of a change. For example, `main`
+ // would be the base reference of type branch if you've created a new
+ // reference of type branch from it and created new commits.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefBaseNameKey = attribute.Key("vcs.ref.base.name")
+
+ // VCSRefBaseRevisionKey is the attribute Key conforming to the
+ // "vcs.ref.base.revision" semantic conventions. It represents the revision,
+ // literally [revised version], The revision most often refers to a commit
+ // object in Git, or a revision number in SVN.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc",
+ // "main", "123", "HEAD"
+ // Note: `base` refers to the starting point of a change. For example, `main`
+ // would be the base reference of type branch if you've created a new
+ // reference of type branch from it and created new commits. The
+ // revision can be a full [hash value (see
+ // glossary)],
+ // of the recorded change to a ref within a repository pointing to a
+ // commit [commit] object. It does
+ // not necessarily have to be a hash; it can simply define a [revision
+ // number]
+ // which is an integer that is monotonically increasing. In cases where
+ // it is identical to the `ref.base.name`, it SHOULD still be included.
+ // It is up to the implementer to decide which value to set as the
+ // revision based on the VCS system and situational context.
+ //
+ // [revised version]: https://www.merriam-webster.com/dictionary/revision
+ // [hash value (see
+ // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ // [commit]: https://git-scm.com/docs/git-commit
+ // [revision
+ // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html
+ VCSRefBaseRevisionKey = attribute.Key("vcs.ref.base.revision")
+
+ // VCSRefBaseTypeKey is the attribute Key conforming to the "vcs.ref.base.type"
+ // semantic conventions. It represents the type of the [reference] in the
+ // repository.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "branch", "tag"
+ // Note: `base` refers to the starting point of a change. For example, `main`
+ // would be the base reference of type branch if you've created a new
+ // reference of type branch from it and created new commits.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefBaseTypeKey = attribute.Key("vcs.ref.base.type")
+
+ // VCSRefHeadNameKey is the attribute Key conforming to the "vcs.ref.head.name"
+ // semantic conventions. It represents the name of the [reference] such as
+ // **branch** or **tag** in the repository.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "my-feature-branch", "tag-1-test"
+ // Note: `head` refers to where you are right now; the current reference at a
+ // given time.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefHeadNameKey = attribute.Key("vcs.ref.head.name")
+
+ // VCSRefHeadRevisionKey is the attribute Key conforming to the
+ // "vcs.ref.head.revision" semantic conventions. It represents the revision,
+ // literally [revised version], The revision most often refers to a commit
+ // object in Git, or a revision number in SVN.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc",
+ // "main", "123", "HEAD"
+ // Note: `head` refers to where you are right now; the current reference at a
+ // given time.The revision can be a full [hash value (see
+ // glossary)],
+ // of the recorded change to a ref within a repository pointing to a
+ // commit [commit] object. It does
+ // not necessarily have to be a hash; it can simply define a [revision
+ // number]
+ // which is an integer that is monotonically increasing. In cases where
+ // it is identical to the `ref.head.name`, it SHOULD still be included.
+ // It is up to the implementer to decide which value to set as the
+ // revision based on the VCS system and situational context.
+ //
+ // [revised version]: https://www.merriam-webster.com/dictionary/revision
+ // [hash value (see
+ // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf
+ // [commit]: https://git-scm.com/docs/git-commit
+ // [revision
+ // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html
+ VCSRefHeadRevisionKey = attribute.Key("vcs.ref.head.revision")
+
+ // VCSRefHeadTypeKey is the attribute Key conforming to the "vcs.ref.head.type"
+ // semantic conventions. It represents the type of the [reference] in the
+ // repository.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "branch", "tag"
+ // Note: `head` refers to where you are right now; the current reference at a
+ // given time.
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefHeadTypeKey = attribute.Key("vcs.ref.head.type")
+
+ // VCSRefTypeKey is the attribute Key conforming to the "vcs.ref.type" semantic
+ // conventions. It represents the type of the [reference] in the repository.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "branch", "tag"
+ //
+ // [reference]: https://git-scm.com/docs/gitglossary#def_ref
+ VCSRefTypeKey = attribute.Key("vcs.ref.type")
+
+ // VCSRepositoryNameKey is the attribute Key conforming to the
+ // "vcs.repository.name" semantic conventions. It represents the human readable
+ // name of the repository. It SHOULD NOT include any additional identifier like
+ // Group/SubGroup in GitLab or organization in GitHub.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "semantic-conventions", "my-cool-repo"
+ // Note: Due to it only being the name, it can clash with forks of the same
+ // repository if collecting telemetry across multiple orgs or groups in
+ // the same backends.
+ VCSRepositoryNameKey = attribute.Key("vcs.repository.name")
+
+ // VCSRepositoryURLFullKey is the attribute Key conforming to the
+ // "vcs.repository.url.full" semantic conventions. It represents the
+ // [canonical URL] of the repository providing the complete HTTP(S) address in
+ // order to locate and identify the repository through a browser.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples:
+ // "https://github.com/opentelemetry/open-telemetry-collector-contrib",
+ // "https://gitlab.com/my-org/my-project/my-projects-project/repo"
+ // Note: In Git Version Control Systems, the canonical URL SHOULD NOT include
+ // the `.git` extension.
+ //
+ // [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical.
+ VCSRepositoryURLFullKey = attribute.Key("vcs.repository.url.full")
+
+ // VCSRevisionDeltaDirectionKey is the attribute Key conforming to the
+ // "vcs.revision_delta.direction" semantic conventions. It represents the type
+ // of revision comparison.
+ //
+ // Type: Enum
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "ahead", "behind"
+ VCSRevisionDeltaDirectionKey = attribute.Key("vcs.revision_delta.direction")
+)
+
+// VCSChangeID returns an attribute KeyValue conforming to the "vcs.change.id"
+// semantic conventions. It represents the ID of the change (pull request/merge
+// request/changelist) if applicable. This is usually a unique (within
+// repository) identifier generated by the VCS system.
+func VCSChangeID(val string) attribute.KeyValue {
+ return VCSChangeIDKey.String(val)
+}
+
+// VCSChangeTitle returns an attribute KeyValue conforming to the
+// "vcs.change.title" semantic conventions. It represents the human readable
+// title of the change (pull request/merge request/changelist). This title is
+// often a brief summary of the change and may get merged in to a ref as the
+// commit summary.
+func VCSChangeTitle(val string) attribute.KeyValue {
+ return VCSChangeTitleKey.String(val)
+}
+
+// VCSOwnerName returns an attribute KeyValue conforming to the "vcs.owner.name"
+// semantic conventions. It represents the group owner within the version control
+// system.
+func VCSOwnerName(val string) attribute.KeyValue {
+ return VCSOwnerNameKey.String(val)
+}
+
+// VCSRefBaseName returns an attribute KeyValue conforming to the
+// "vcs.ref.base.name" semantic conventions. It represents the name of the
+// [reference] such as **branch** or **tag** in the repository.
+//
+// [reference]: https://git-scm.com/docs/gitglossary#def_ref
+func VCSRefBaseName(val string) attribute.KeyValue {
+ return VCSRefBaseNameKey.String(val)
+}
+
+// VCSRefBaseRevision returns an attribute KeyValue conforming to the
+// "vcs.ref.base.revision" semantic conventions. It represents the revision,
+// literally [revised version], The revision most often refers to a commit object
+// in Git, or a revision number in SVN.
+//
+// [revised version]: https://www.merriam-webster.com/dictionary/revision
+func VCSRefBaseRevision(val string) attribute.KeyValue {
+ return VCSRefBaseRevisionKey.String(val)
+}
+
+// VCSRefHeadName returns an attribute KeyValue conforming to the
+// "vcs.ref.head.name" semantic conventions. It represents the name of the
+// [reference] such as **branch** or **tag** in the repository.
+//
+// [reference]: https://git-scm.com/docs/gitglossary#def_ref
+func VCSRefHeadName(val string) attribute.KeyValue {
+ return VCSRefHeadNameKey.String(val)
+}
+
+// VCSRefHeadRevision returns an attribute KeyValue conforming to the
+// "vcs.ref.head.revision" semantic conventions. It represents the revision,
+// literally [revised version], The revision most often refers to a commit object
+// in Git, or a revision number in SVN.
+//
+// [revised version]: https://www.merriam-webster.com/dictionary/revision
+func VCSRefHeadRevision(val string) attribute.KeyValue {
+ return VCSRefHeadRevisionKey.String(val)
+}
+
+// VCSRepositoryName returns an attribute KeyValue conforming to the
+// "vcs.repository.name" semantic conventions. It represents the human readable
+// name of the repository. It SHOULD NOT include any additional identifier like
+// Group/SubGroup in GitLab or organization in GitHub.
+func VCSRepositoryName(val string) attribute.KeyValue {
+ return VCSRepositoryNameKey.String(val)
+}
+
+// VCSRepositoryURLFull returns an attribute KeyValue conforming to the
+// "vcs.repository.url.full" semantic conventions. It represents the
+// [canonical URL] of the repository providing the complete HTTP(S) address in
+// order to locate and identify the repository through a browser.
+//
+// [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical.
+func VCSRepositoryURLFull(val string) attribute.KeyValue {
+ return VCSRepositoryURLFullKey.String(val)
+}
+
+// Enum values for vcs.change.state
+var (
+ // Open means the change is currently active and under review. It hasn't been
+ // merged into the target branch yet, and it's still possible to make changes or
+ // add comments.
+ // Stability: development
+ VCSChangeStateOpen = VCSChangeStateKey.String("open")
+ // WIP (work-in-progress, draft) means the change is still in progress and not
+ // yet ready for a full review. It might still undergo significant changes.
+ // Stability: development
+ VCSChangeStateWip = VCSChangeStateKey.String("wip")
+ // Closed means the merge request has been closed without merging. This can
+ // happen for various reasons, such as the changes being deemed unnecessary, the
+ // issue being resolved in another way, or the author deciding to withdraw the
+ // request.
+ // Stability: development
+ VCSChangeStateClosed = VCSChangeStateKey.String("closed")
+ // Merged indicates that the change has been successfully integrated into the
+ // target codebase.
+ // Stability: development
+ VCSChangeStateMerged = VCSChangeStateKey.String("merged")
+)
+
+// Enum values for vcs.line_change.type
+var (
+ // How many lines were added.
+ // Stability: development
+ VCSLineChangeTypeAdded = VCSLineChangeTypeKey.String("added")
+ // How many lines were removed.
+ // Stability: development
+ VCSLineChangeTypeRemoved = VCSLineChangeTypeKey.String("removed")
+)
+
+// Enum values for vcs.provider.name
+var (
+ // [GitHub]
+ // Stability: development
+ //
+ // [GitHub]: https://github.com
+ VCSProviderNameGithub = VCSProviderNameKey.String("github")
+ // [GitLab]
+ // Stability: development
+ //
+ // [GitLab]: https://gitlab.com
+ VCSProviderNameGitlab = VCSProviderNameKey.String("gitlab")
+ // Deprecated: Replaced by `gitea`.
+ VCSProviderNameGittea = VCSProviderNameKey.String("gittea")
+ // [Gitea]
+ // Stability: development
+ //
+ // [Gitea]: https://gitea.io
+ VCSProviderNameGitea = VCSProviderNameKey.String("gitea")
+ // [Bitbucket]
+ // Stability: development
+ //
+ // [Bitbucket]: https://bitbucket.org
+ VCSProviderNameBitbucket = VCSProviderNameKey.String("bitbucket")
+)
+
+// Enum values for vcs.ref.base.type
+var (
+ // [branch]
+ // Stability: development
+ //
+ // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch
+ VCSRefBaseTypeBranch = VCSRefBaseTypeKey.String("branch")
+ // [tag]
+ // Stability: development
+ //
+ // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag
+ VCSRefBaseTypeTag = VCSRefBaseTypeKey.String("tag")
+)
+
+// Enum values for vcs.ref.head.type
+var (
+ // [branch]
+ // Stability: development
+ //
+ // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch
+ VCSRefHeadTypeBranch = VCSRefHeadTypeKey.String("branch")
+ // [tag]
+ // Stability: development
+ //
+ // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag
+ VCSRefHeadTypeTag = VCSRefHeadTypeKey.String("tag")
+)
+
+// Enum values for vcs.ref.type
+var (
+ // [branch]
+ // Stability: development
+ //
+ // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch
+ VCSRefTypeBranch = VCSRefTypeKey.String("branch")
+ // [tag]
+ // Stability: development
+ //
+ // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag
+ VCSRefTypeTag = VCSRefTypeKey.String("tag")
+)
+
+// Enum values for vcs.revision_delta.direction
+var (
+ // How many revisions the change is behind the target ref.
+ // Stability: development
+ VCSRevisionDeltaDirectionBehind = VCSRevisionDeltaDirectionKey.String("behind")
+ // How many revisions the change is ahead of the target ref.
+ // Stability: development
+ VCSRevisionDeltaDirectionAhead = VCSRevisionDeltaDirectionKey.String("ahead")
+)
+
+// Namespace: webengine
+const (
+ // WebEngineDescriptionKey is the attribute Key conforming to the
+ // "webengine.description" semantic conventions. It represents the additional
+ // description of the web engine (e.g. detailed version and edition
+ // information).
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "WildFly Full 21.0.0.Final (WildFly Core 13.0.1.Final) -
+ // 2.2.2.Final"
+ WebEngineDescriptionKey = attribute.Key("webengine.description")
+
+ // WebEngineNameKey is the attribute Key conforming to the "webengine.name"
+ // semantic conventions. It represents the name of the web engine.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "WildFly"
+ WebEngineNameKey = attribute.Key("webengine.name")
+
+ // WebEngineVersionKey is the attribute Key conforming to the
+ // "webengine.version" semantic conventions. It represents the version of the
+ // web engine.
+ //
+ // Type: string
+ // RequirementLevel: Recommended
+ // Stability: Development
+ //
+ // Examples: "21.0.0"
+ WebEngineVersionKey = attribute.Key("webengine.version")
+)
+
+// WebEngineDescription returns an attribute KeyValue conforming to the
+// "webengine.description" semantic conventions. It represents the additional
+// description of the web engine (e.g. detailed version and edition information).
+func WebEngineDescription(val string) attribute.KeyValue {
+ return WebEngineDescriptionKey.String(val)
+}
+
+// WebEngineName returns an attribute KeyValue conforming to the "webengine.name"
+// semantic conventions. It represents the name of the web engine.
+func WebEngineName(val string) attribute.KeyValue {
+ return WebEngineNameKey.String(val)
+}
+
+// WebEngineVersion returns an attribute KeyValue conforming to the
+// "webengine.version" semantic conventions. It represents the version of the web
+// engine.
+func WebEngineVersion(val string) attribute.KeyValue {
+ return WebEngineVersionKey.String(val)
+}
\ No newline at end of file
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go
new file mode 100644
index 000000000..2c5c7ebd0
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go
@@ -0,0 +1,9 @@
+// Copyright The OpenTelemetry Authors
+// SPDX-License-Identifier: Apache-2.0
+
+// Package semconv implements OpenTelemetry semantic conventions.
+//
+// OpenTelemetry semantic conventions are agreed standardized naming
+// patterns for OpenTelemetry things. This package represents the v1.34.0
+// version of the OpenTelemetry semantic conventions.
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0"
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go
new file mode 100644
index 000000000..88a998f1e
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go
@@ -0,0 +1,9 @@
+// Copyright The OpenTelemetry Authors
+// SPDX-License-Identifier: Apache-2.0
+
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0"
+
+const (
+ // ExceptionEventName is the name of the Span event representing an exception.
+ ExceptionEventName = "exception"
+)
diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go
new file mode 100644
index 000000000..3c23d4592
--- /dev/null
+++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go
@@ -0,0 +1,9 @@
+// Copyright The OpenTelemetry Authors
+// SPDX-License-Identifier: Apache-2.0
+
+package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0"
+
+// SchemaURL is the schema URL that matches the version of the semantic conventions
+// that this package defines. Semconv packages starting from v1.4.0 must declare
+// non-empty schema URL in the form https://opentelemetry.io/schemas/
+const SchemaURL = "https://opentelemetry.io/schemas/1.34.0"
diff --git a/vendor/go.opentelemetry.io/otel/trace/auto.go b/vendor/go.opentelemetry.io/otel/trace/auto.go
index d90af8f67..f3aa39813 100644
--- a/vendor/go.opentelemetry.io/otel/trace/auto.go
+++ b/vendor/go.opentelemetry.io/otel/trace/auto.go
@@ -20,7 +20,7 @@ import (
"go.opentelemetry.io/otel/attribute"
"go.opentelemetry.io/otel/codes"
- semconv "go.opentelemetry.io/otel/semconv/v1.26.0"
+ semconv "go.opentelemetry.io/otel/semconv/v1.34.0"
"go.opentelemetry.io/otel/trace/embedded"
"go.opentelemetry.io/otel/trace/internal/telemetry"
)
diff --git a/vendor/go.opentelemetry.io/otel/version.go b/vendor/go.opentelemetry.io/otel/version.go
index ac3c0b15d..7afe92b59 100644
--- a/vendor/go.opentelemetry.io/otel/version.go
+++ b/vendor/go.opentelemetry.io/otel/version.go
@@ -5,5 +5,5 @@ package otel // import "go.opentelemetry.io/otel"
// Version is the current release version of OpenTelemetry in use.
func Version() string {
- return "1.36.0"
+ return "1.37.0"
}
diff --git a/vendor/go.opentelemetry.io/otel/versions.yaml b/vendor/go.opentelemetry.io/otel/versions.yaml
index 79f82f3d0..9d4742a17 100644
--- a/vendor/go.opentelemetry.io/otel/versions.yaml
+++ b/vendor/go.opentelemetry.io/otel/versions.yaml
@@ -3,13 +3,12 @@
module-sets:
stable-v1:
- version: v1.36.0
+ version: v1.37.0
modules:
- go.opentelemetry.io/otel
- go.opentelemetry.io/otel/bridge/opencensus
- go.opentelemetry.io/otel/bridge/opencensus/test
- go.opentelemetry.io/otel/bridge/opentracing
- - go.opentelemetry.io/otel/bridge/opentracing/test
- go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc
- go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp
- go.opentelemetry.io/otel/exporters/otlp/otlptrace
@@ -23,14 +22,16 @@ module-sets:
- go.opentelemetry.io/otel/sdk/metric
- go.opentelemetry.io/otel/trace
experimental-metrics:
- version: v0.58.0
+ version: v0.59.0
modules:
- go.opentelemetry.io/otel/exporters/prometheus
experimental-logs:
- version: v0.12.0
+ version: v0.13.0
modules:
- go.opentelemetry.io/otel/log
+ - go.opentelemetry.io/otel/log/logtest
- go.opentelemetry.io/otel/sdk/log
+ - go.opentelemetry.io/otel/sdk/log/logtest
- go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc
- go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp
- go.opentelemetry.io/otel/exporters/stdout/stdoutlog
@@ -40,6 +41,4 @@ module-sets:
- go.opentelemetry.io/otel/schema
excluded-modules:
- go.opentelemetry.io/otel/internal/tools
- - go.opentelemetry.io/otel/log/logtest
- - go.opentelemetry.io/otel/sdk/log/logtest
- go.opentelemetry.io/otel/trace/internal/telemetry/test
diff --git a/vendor/golang.org/x/time/rate/rate.go b/vendor/golang.org/x/time/rate/rate.go
index 794b2e32b..563270c15 100644
--- a/vendor/golang.org/x/time/rate/rate.go
+++ b/vendor/golang.org/x/time/rate/rate.go
@@ -195,7 +195,7 @@ func (r *Reservation) CancelAt(t time.Time) {
// update state
r.lim.last = t
r.lim.tokens = tokens
- if r.timeToAct == r.lim.lastEvent {
+ if r.timeToAct.Equal(r.lim.lastEvent) {
prevEvent := r.timeToAct.Add(r.limit.durationFromTokens(float64(-r.tokens)))
if !prevEvent.Before(t) {
r.lim.lastEvent = prevEvent
diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go
index 8b462f3df..0b789e2c5 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go
index db7806cb9..f84048172 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go
index 08505ba3f..5d583b866 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go
index a462e7d01..53e9dd1e9 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go
index c93b4f524..d30fcee4c 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go
index a1c543a94..175974a86 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go
index 2b54db304..b8c4aa71f 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go b/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go
index 498020e33..a69c1d473 100644
--- a/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go
index bd46edbe7..85a9387f7 100644
--- a/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go
index 3cd9a5bb8..e017ef071 100644
--- a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
@@ -703,6 +703,65 @@ type QuotaFailure_Violation struct {
// For example: "Service disabled" or "Daily Limit for read operations
// exceeded".
Description string `protobuf:"bytes,2,opt,name=description,proto3" json:"description,omitempty"`
+ // The API Service from which the `QuotaFailure.Violation` orginates. In
+ // some cases, Quota issues originate from an API Service other than the one
+ // that was called. In other words, a dependency of the called API Service
+ // could be the cause of the `QuotaFailure`, and this field would have the
+ // dependency API service name.
+ //
+ // For example, if the called API is Kubernetes Engine API
+ // (container.googleapis.com), and a quota violation occurs in the
+ // Kubernetes Engine API itself, this field would be
+ // "container.googleapis.com". On the other hand, if the quota violation
+ // occurs when the Kubernetes Engine API creates VMs in the Compute Engine
+ // API (compute.googleapis.com), this field would be
+ // "compute.googleapis.com".
+ ApiService string `protobuf:"bytes,3,opt,name=api_service,json=apiService,proto3" json:"api_service,omitempty"`
+ // The metric of the violated quota. A quota metric is a named counter to
+ // measure usage, such as API requests or CPUs. When an activity occurs in a
+ // service, such as Virtual Machine allocation, one or more quota metrics
+ // may be affected.
+ //
+ // For example, "compute.googleapis.com/cpus_per_vm_family",
+ // "storage.googleapis.com/internet_egress_bandwidth".
+ QuotaMetric string `protobuf:"bytes,4,opt,name=quota_metric,json=quotaMetric,proto3" json:"quota_metric,omitempty"`
+ // The id of the violated quota. Also know as "limit name", this is the
+ // unique identifier of a quota in the context of an API service.
+ //
+ // For example, "CPUS-PER-VM-FAMILY-per-project-region".
+ QuotaId string `protobuf:"bytes,5,opt,name=quota_id,json=quotaId,proto3" json:"quota_id,omitempty"`
+ // The dimensions of the violated quota. Every non-global quota is enforced
+ // on a set of dimensions. While quota metric defines what to count, the
+ // dimensions specify for what aspects the counter should be increased.
+ //
+ // For example, the quota "CPUs per region per VM family" enforces a limit
+ // on the metric "compute.googleapis.com/cpus_per_vm_family" on dimensions
+ // "region" and "vm_family". And if the violation occurred in region
+ // "us-central1" and for VM family "n1", the quota_dimensions would be,
+ //
+ // {
+ // "region": "us-central1",
+ // "vm_family": "n1",
+ // }
+ //
+ // When a quota is enforced globally, the quota_dimensions would always be
+ // empty.
+ QuotaDimensions map[string]string `protobuf:"bytes,6,rep,name=quota_dimensions,json=quotaDimensions,proto3" json:"quota_dimensions,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"`
+ // The enforced quota value at the time of the `QuotaFailure`.
+ //
+ // For example, if the enforced quota value at the time of the
+ // `QuotaFailure` on the number of CPUs is "10", then the value of this
+ // field would reflect this quantity.
+ QuotaValue int64 `protobuf:"varint,7,opt,name=quota_value,json=quotaValue,proto3" json:"quota_value,omitempty"`
+ // The new quota value being rolled out at the time of the violation. At the
+ // completion of the rollout, this value will be enforced in place of
+ // quota_value. If no rollout is in progress at the time of the violation,
+ // this field is not set.
+ //
+ // For example, if at the time of the violation a rollout is in progress
+ // changing the number of CPUs quota from 10 to 20, 20 would be the value of
+ // this field.
+ FutureQuotaValue *int64 `protobuf:"varint,8,opt,name=future_quota_value,json=futureQuotaValue,proto3,oneof" json:"future_quota_value,omitempty"`
}
func (x *QuotaFailure_Violation) Reset() {
@@ -751,6 +810,48 @@ func (x *QuotaFailure_Violation) GetDescription() string {
return ""
}
+func (x *QuotaFailure_Violation) GetApiService() string {
+ if x != nil {
+ return x.ApiService
+ }
+ return ""
+}
+
+func (x *QuotaFailure_Violation) GetQuotaMetric() string {
+ if x != nil {
+ return x.QuotaMetric
+ }
+ return ""
+}
+
+func (x *QuotaFailure_Violation) GetQuotaId() string {
+ if x != nil {
+ return x.QuotaId
+ }
+ return ""
+}
+
+func (x *QuotaFailure_Violation) GetQuotaDimensions() map[string]string {
+ if x != nil {
+ return x.QuotaDimensions
+ }
+ return nil
+}
+
+func (x *QuotaFailure_Violation) GetQuotaValue() int64 {
+ if x != nil {
+ return x.QuotaValue
+ }
+ return 0
+}
+
+func (x *QuotaFailure_Violation) GetFutureQuotaValue() int64 {
+ if x != nil && x.FutureQuotaValue != nil {
+ return *x.FutureQuotaValue
+ }
+ return 0
+}
+
// A message type used to describe a single precondition failure.
type PreconditionFailure_Violation struct {
state protoimpl.MessageState
@@ -775,7 +876,7 @@ type PreconditionFailure_Violation struct {
func (x *PreconditionFailure_Violation) Reset() {
*x = PreconditionFailure_Violation{}
if protoimpl.UnsafeEnabled {
- mi := &file_google_rpc_error_details_proto_msgTypes[12]
+ mi := &file_google_rpc_error_details_proto_msgTypes[13]
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
ms.StoreMessageInfo(mi)
}
@@ -788,7 +889,7 @@ func (x *PreconditionFailure_Violation) String() string {
func (*PreconditionFailure_Violation) ProtoMessage() {}
func (x *PreconditionFailure_Violation) ProtoReflect() protoreflect.Message {
- mi := &file_google_rpc_error_details_proto_msgTypes[12]
+ mi := &file_google_rpc_error_details_proto_msgTypes[13]
if protoimpl.UnsafeEnabled && x != nil {
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
if ms.LoadMessageInfo() == nil {
@@ -886,7 +987,7 @@ type BadRequest_FieldViolation struct {
func (x *BadRequest_FieldViolation) Reset() {
*x = BadRequest_FieldViolation{}
if protoimpl.UnsafeEnabled {
- mi := &file_google_rpc_error_details_proto_msgTypes[13]
+ mi := &file_google_rpc_error_details_proto_msgTypes[14]
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
ms.StoreMessageInfo(mi)
}
@@ -899,7 +1000,7 @@ func (x *BadRequest_FieldViolation) String() string {
func (*BadRequest_FieldViolation) ProtoMessage() {}
func (x *BadRequest_FieldViolation) ProtoReflect() protoreflect.Message {
- mi := &file_google_rpc_error_details_proto_msgTypes[13]
+ mi := &file_google_rpc_error_details_proto_msgTypes[14]
if protoimpl.UnsafeEnabled && x != nil {
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
if ms.LoadMessageInfo() == nil {
@@ -958,7 +1059,7 @@ type Help_Link struct {
func (x *Help_Link) Reset() {
*x = Help_Link{}
if protoimpl.UnsafeEnabled {
- mi := &file_google_rpc_error_details_proto_msgTypes[14]
+ mi := &file_google_rpc_error_details_proto_msgTypes[15]
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
ms.StoreMessageInfo(mi)
}
@@ -971,7 +1072,7 @@ func (x *Help_Link) String() string {
func (*Help_Link) ProtoMessage() {}
func (x *Help_Link) ProtoReflect() protoreflect.Message {
- mi := &file_google_rpc_error_details_proto_msgTypes[14]
+ mi := &file_google_rpc_error_details_proto_msgTypes[15]
if protoimpl.UnsafeEnabled && x != nil {
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
if ms.LoadMessageInfo() == nil {
@@ -1029,79 +1130,102 @@ var file_google_rpc_error_details_proto_rawDesc = []byte{
0x0a, 0x0d, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x18,
0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x45, 0x6e, 0x74, 0x72,
0x69, 0x65, 0x73, 0x12, 0x16, 0x0a, 0x06, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x18, 0x02, 0x20,
- 0x01, 0x28, 0x09, 0x52, 0x06, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x22, 0x9b, 0x01, 0x0a, 0x0c,
+ 0x01, 0x28, 0x09, 0x52, 0x06, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x22, 0x8e, 0x04, 0x0a, 0x0c,
0x51, 0x75, 0x6f, 0x74, 0x61, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x12, 0x42, 0x0a, 0x0a,
0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b,
0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x51, 0x75,
0x6f, 0x74, 0x61, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69, 0x6f, 0x6c, 0x61,
0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73,
- 0x1a, 0x47, 0x0a, 0x09, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, 0x0a,
- 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07,
- 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xbd, 0x01, 0x0a, 0x13, 0x50, 0x72,
- 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72,
- 0x65, 0x12, 0x49, 0x0a, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18,
- 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72,
- 0x70, 0x63, 0x2e, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x46,
- 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
- 0x52, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x5b, 0x0a, 0x09,
- 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70,
- 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x18, 0x0a,
- 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07,
- 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72,
- 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x02, 0x0a, 0x0a, 0x42, 0x61,
- 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x10, 0x66, 0x69, 0x65, 0x6c,
- 0x64, 0x5f, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03,
- 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e,
- 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64,
- 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x66, 0x69, 0x65, 0x6c, 0x64,
- 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xab, 0x01, 0x0a, 0x0e, 0x46,
- 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a,
- 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x66, 0x69,
- 0x65, 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69,
- 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69,
- 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x18,
- 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x12, 0x49, 0x0a,
- 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61,
- 0x67, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
- 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d,
- 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65,
- 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0x4f, 0x0a, 0x0b, 0x52, 0x65, 0x71, 0x75,
- 0x65, 0x73, 0x74, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x71, 0x75, 0x65,
- 0x73, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x72, 0x65, 0x71,
- 0x75, 0x65, 0x73, 0x74, 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e,
- 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x73, 0x65,
- 0x72, 0x76, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a, 0x0c, 0x52, 0x65,
- 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65,
- 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28,
- 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12,
- 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65,
- 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65,
- 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x03, 0x20,
- 0x01, 0x28, 0x09, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65,
- 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52,
- 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6f, 0x0a, 0x04,
- 0x48, 0x65, 0x6c, 0x70, 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x01, 0x20,
- 0x03, 0x28, 0x0b, 0x32, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63,
- 0x2e, 0x48, 0x65, 0x6c, 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b,
- 0x73, 0x1a, 0x3a, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73,
- 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b,
- 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x75,
- 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x22, 0x44, 0x0a,
- 0x10, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67,
- 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28,
- 0x09, 0x52, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73,
- 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73,
- 0x61, 0x67, 0x65, 0x42, 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
- 0x65, 0x2e, 0x72, 0x70, 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44, 0x65, 0x74, 0x61,
- 0x69, 0x6c, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67,
- 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65,
- 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69,
- 0x73, 0x2f, 0x72, 0x70, 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73,
- 0x3b, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02, 0x03, 0x52, 0x50,
- 0x43, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33,
+ 0x1a, 0xb9, 0x03, 0x0a, 0x09, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18,
+ 0x0a, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52,
+ 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63,
+ 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64,
+ 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x70,
+ 0x69, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52,
+ 0x0a, 0x61, 0x70, 0x69, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x71,
+ 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x18, 0x04, 0x20, 0x01, 0x28,
+ 0x09, 0x52, 0x0b, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x19,
+ 0x0a, 0x08, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x69, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09,
+ 0x52, 0x07, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x49, 0x64, 0x12, 0x62, 0x0a, 0x10, 0x71, 0x75, 0x6f,
+ 0x74, 0x61, 0x5f, 0x64, 0x69, 0x6d, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20,
+ 0x03, 0x28, 0x0b, 0x32, 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63,
+ 0x2e, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69,
+ 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x44, 0x69, 0x6d,
+ 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x71, 0x75,
+ 0x6f, 0x74, 0x61, 0x44, 0x69, 0x6d, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a,
+ 0x0b, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01,
+ 0x28, 0x03, 0x52, 0x0a, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x31,
+ 0x0a, 0x12, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x5f, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x76,
+ 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x10, 0x66, 0x75,
+ 0x74, 0x75, 0x72, 0x65, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x88, 0x01,
+ 0x01, 0x1a, 0x42, 0x0a, 0x14, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x44, 0x69, 0x6d, 0x65, 0x6e, 0x73,
+ 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79,
+ 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76,
+ 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75,
+ 0x65, 0x3a, 0x02, 0x38, 0x01, 0x42, 0x15, 0x0a, 0x13, 0x5f, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65,
+ 0x5f, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0xbd, 0x01, 0x0a,
+ 0x13, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x46, 0x61, 0x69,
+ 0x6c, 0x75, 0x72, 0x65, 0x12, 0x49, 0x0a, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f,
+ 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
+ 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69,
+ 0x6f, 0x6e, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74,
+ 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a,
+ 0x5b, 0x0a, 0x09, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04,
+ 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65,
+ 0x12, 0x18, 0x0a, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28,
+ 0x09, 0x52, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65,
+ 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52,
+ 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x02, 0x0a,
+ 0x0a, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x10, 0x66,
+ 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18,
+ 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72,
+ 0x70, 0x63, 0x2e, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x46, 0x69,
+ 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x66, 0x69,
+ 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xab, 0x01,
+ 0x0a, 0x0e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
+ 0x12, 0x14, 0x0a, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52,
+ 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69,
+ 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73,
+ 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x72, 0x65, 0x61, 0x73,
+ 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e,
+ 0x12, 0x49, 0x0a, 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x5f, 0x6d, 0x65,
+ 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f,
+ 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a,
+ 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c,
+ 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0x4f, 0x0a, 0x0b, 0x52,
+ 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65,
+ 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09,
+ 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72,
+ 0x76, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52,
+ 0x0b, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a,
+ 0x0c, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a,
+ 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01,
+ 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79,
+ 0x70, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e,
+ 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75,
+ 0x72, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72,
+ 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a,
+ 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01,
+ 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22,
+ 0x6f, 0x0a, 0x04, 0x48, 0x65, 0x6c, 0x70, 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73,
+ 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e,
+ 0x72, 0x70, 0x63, 0x2e, 0x48, 0x65, 0x6c, 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c,
+ 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3a, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b,
+ 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28,
+ 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10,
+ 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c,
+ 0x22, 0x44, 0x0a, 0x10, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73,
+ 0x73, 0x61, 0x67, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01,
+ 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07,
+ 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d,
+ 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x42, 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f,
+ 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44,
+ 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67,
+ 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67,
+ 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65,
+ 0x61, 0x70, 0x69, 0x73, 0x2f, 0x72, 0x70, 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61,
+ 0x69, 0x6c, 0x73, 0x3b, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02,
+ 0x03, 0x52, 0x50, 0x43, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33,
}
var (
@@ -1116,7 +1240,7 @@ func file_google_rpc_error_details_proto_rawDescGZIP() []byte {
return file_google_rpc_error_details_proto_rawDescData
}
-var file_google_rpc_error_details_proto_msgTypes = make([]protoimpl.MessageInfo, 15)
+var file_google_rpc_error_details_proto_msgTypes = make([]protoimpl.MessageInfo, 16)
var file_google_rpc_error_details_proto_goTypes = []interface{}{
(*ErrorInfo)(nil), // 0: google.rpc.ErrorInfo
(*RetryInfo)(nil), // 1: google.rpc.RetryInfo
@@ -1130,24 +1254,26 @@ var file_google_rpc_error_details_proto_goTypes = []interface{}{
(*LocalizedMessage)(nil), // 9: google.rpc.LocalizedMessage
nil, // 10: google.rpc.ErrorInfo.MetadataEntry
(*QuotaFailure_Violation)(nil), // 11: google.rpc.QuotaFailure.Violation
- (*PreconditionFailure_Violation)(nil), // 12: google.rpc.PreconditionFailure.Violation
- (*BadRequest_FieldViolation)(nil), // 13: google.rpc.BadRequest.FieldViolation
- (*Help_Link)(nil), // 14: google.rpc.Help.Link
- (*durationpb.Duration)(nil), // 15: google.protobuf.Duration
+ nil, // 12: google.rpc.QuotaFailure.Violation.QuotaDimensionsEntry
+ (*PreconditionFailure_Violation)(nil), // 13: google.rpc.PreconditionFailure.Violation
+ (*BadRequest_FieldViolation)(nil), // 14: google.rpc.BadRequest.FieldViolation
+ (*Help_Link)(nil), // 15: google.rpc.Help.Link
+ (*durationpb.Duration)(nil), // 16: google.protobuf.Duration
}
var file_google_rpc_error_details_proto_depIdxs = []int32{
10, // 0: google.rpc.ErrorInfo.metadata:type_name -> google.rpc.ErrorInfo.MetadataEntry
- 15, // 1: google.rpc.RetryInfo.retry_delay:type_name -> google.protobuf.Duration
+ 16, // 1: google.rpc.RetryInfo.retry_delay:type_name -> google.protobuf.Duration
11, // 2: google.rpc.QuotaFailure.violations:type_name -> google.rpc.QuotaFailure.Violation
- 12, // 3: google.rpc.PreconditionFailure.violations:type_name -> google.rpc.PreconditionFailure.Violation
- 13, // 4: google.rpc.BadRequest.field_violations:type_name -> google.rpc.BadRequest.FieldViolation
- 14, // 5: google.rpc.Help.links:type_name -> google.rpc.Help.Link
- 9, // 6: google.rpc.BadRequest.FieldViolation.localized_message:type_name -> google.rpc.LocalizedMessage
- 7, // [7:7] is the sub-list for method output_type
- 7, // [7:7] is the sub-list for method input_type
- 7, // [7:7] is the sub-list for extension type_name
- 7, // [7:7] is the sub-list for extension extendee
- 0, // [0:7] is the sub-list for field type_name
+ 13, // 3: google.rpc.PreconditionFailure.violations:type_name -> google.rpc.PreconditionFailure.Violation
+ 14, // 4: google.rpc.BadRequest.field_violations:type_name -> google.rpc.BadRequest.FieldViolation
+ 15, // 5: google.rpc.Help.links:type_name -> google.rpc.Help.Link
+ 12, // 6: google.rpc.QuotaFailure.Violation.quota_dimensions:type_name -> google.rpc.QuotaFailure.Violation.QuotaDimensionsEntry
+ 9, // 7: google.rpc.BadRequest.FieldViolation.localized_message:type_name -> google.rpc.LocalizedMessage
+ 8, // [8:8] is the sub-list for method output_type
+ 8, // [8:8] is the sub-list for method input_type
+ 8, // [8:8] is the sub-list for extension type_name
+ 8, // [8:8] is the sub-list for extension extendee
+ 0, // [0:8] is the sub-list for field type_name
}
func init() { file_google_rpc_error_details_proto_init() }
@@ -1288,7 +1414,7 @@ func file_google_rpc_error_details_proto_init() {
return nil
}
}
- file_google_rpc_error_details_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} {
+ file_google_rpc_error_details_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} {
switch v := v.(*PreconditionFailure_Violation); i {
case 0:
return &v.state
@@ -1300,7 +1426,7 @@ func file_google_rpc_error_details_proto_init() {
return nil
}
}
- file_google_rpc_error_details_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} {
+ file_google_rpc_error_details_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} {
switch v := v.(*BadRequest_FieldViolation); i {
case 0:
return &v.state
@@ -1312,7 +1438,7 @@ func file_google_rpc_error_details_proto_init() {
return nil
}
}
- file_google_rpc_error_details_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} {
+ file_google_rpc_error_details_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} {
switch v := v.(*Help_Link); i {
case 0:
return &v.state
@@ -1325,13 +1451,14 @@ func file_google_rpc_error_details_proto_init() {
}
}
}
+ file_google_rpc_error_details_proto_msgTypes[11].OneofWrappers = []interface{}{}
type x struct{}
out := protoimpl.TypeBuilder{
File: protoimpl.DescBuilder{
GoPackagePath: reflect.TypeOf(x{}).PkgPath(),
RawDescriptor: file_google_rpc_error_details_proto_rawDesc,
NumEnums: 0,
- NumMessages: 15,
+ NumMessages: 16,
NumExtensions: 0,
NumServices: 0,
},
diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go
index 6ad1b1c1d..06a3f7106 100644
--- a/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go
+++ b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go
@@ -1,4 +1,4 @@
-// Copyright 2024 Google LLC
+// Copyright 2025 Google LLC
//
// Licensed under the Apache License, Version 2.0 (the "License");
// you may not use this file except in compliance with the License.
diff --git a/vendor/google.golang.org/grpc/CONTRIBUTING.md b/vendor/google.golang.org/grpc/CONTRIBUTING.md
index d9bfa6e1e..2079de7b0 100644
--- a/vendor/google.golang.org/grpc/CONTRIBUTING.md
+++ b/vendor/google.golang.org/grpc/CONTRIBUTING.md
@@ -1,73 +1,159 @@
# How to contribute
-We definitely welcome your patches and contributions to gRPC! Please read the gRPC
-organization's [governance rules](https://github.com/grpc/grpc-community/blob/master/governance.md)
-and [contribution guidelines](https://github.com/grpc/grpc-community/blob/master/CONTRIBUTING.md) before proceeding.
+We welcome your patches and contributions to gRPC! Please read the gRPC
+organization's [governance
+rules](https://github.com/grpc/grpc-community/blob/master/governance.md) before
+proceeding.
If you are new to GitHub, please start by reading [Pull Request howto](https://help.github.com/articles/about-pull-requests/)
## Legal requirements
In order to protect both you and ourselves, you will need to sign the
-[Contributor License Agreement](https://identity.linuxfoundation.org/projects/cncf).
+[Contributor License
+Agreement](https://identity.linuxfoundation.org/projects/cncf). When you create
+your first PR, a link will be added as a comment that contains the steps needed
+to complete this process.
+
+## Getting Started
+
+A great way to start is by searching through our open issues. [Unassigned issues
+labeled as "help
+wanted"](https://github.com/grpc/grpc-go/issues?q=sort%3Aupdated-desc%20is%3Aissue%20is%3Aopen%20label%3A%22Status%3A%20Help%20Wanted%22%20no%3Aassignee)
+are especially nice for first-time contributors, as they should be well-defined
+problems that already have agreed-upon solutions.
+
+## Code Style
+
+We follow [Google's published Go style
+guide](https://google.github.io/styleguide/go/). Note that there are three
+primary documents that make up this style guide; please follow them as closely
+as possible. If a reviewer recommends something that contradicts those
+guidelines, there may be valid reasons to do so, but it should be rare.
## Guidelines for Pull Requests
-How to get your contributions merged smoothly and quickly.
+
+Please read the following carefully to ensure your contributions can be merged
+smoothly and quickly.
+
+### PR Contents
- Create **small PRs** that are narrowly focused on **addressing a single
- concern**. We often times receive PRs that are trying to fix several things at
- a time, but only one fix is considered acceptable, nothing gets merged and
- both author's & review's time is wasted. Create more PRs to address different
- concerns and everyone will be happy.
+ concern**. We often receive PRs that attempt to fix several things at the same
+ time, and if one part of the PR has a problem, that will hold up the entire
+ PR.
+
+- If your change does not address an **open issue** with an **agreed
+ resolution**, consider opening an issue and discussing it first. If you are
+ suggesting a behavioral or API change, consider starting with a [gRFC
+ proposal](https://github.com/grpc/proposal). Many new features that are not
+ bug fixes will require cross-language agreement.
+
+- If you want to fix **formatting or style**, consider whether your changes are
+ an obvious improvement or might be considered a personal preference. If a
+ style change is based on preference, it likely will not be accepted. If it
+ corrects widely agreed-upon anti-patterns, then please do create a PR and
+ explain the benefits of the change.
+
+- For correcting **misspellings**, please be aware that we use some terms that
+ are sometimes flagged by spell checkers. As an example, "if an only if" is
+ often written as "iff". Please do not make spelling correction changes unless
+ you are certain they are misspellings.
+
+- **All tests need to be passing** before your change can be merged. We
+ recommend you run tests locally before creating your PR to catch breakages
+ early on:
-- If you are searching for features to work on, issues labeled [Status: Help
- Wanted](https://github.com/grpc/grpc-go/issues?q=is%3Aissue+is%3Aopen+sort%3Aupdated-desc+label%3A%22Status%3A+Help+Wanted%22)
- is a great place to start. These issues are well-documented and usually can be
- resolved with a single pull request.
+ - `./scripts/vet.sh` to catch vet errors.
+ - `go test -cpu 1,4 -timeout 7m ./...` to run the tests.
+ - `go test -race -cpu 1,4 -timeout 7m ./...` to run tests in race mode.
-- If you are adding a new file, make sure it has the copyright message template
- at the top as a comment. You can copy over the message from an existing file
- and update the year.
+ Note that we have a multi-module repo, so `go test` commands may need to be
+ run from the root of each module in order to cause all tests to run.
+
+ *Alternatively*, you may find it easier to push your changes to your fork on
+ GitHub, which will trigger a GitHub Actions run that you can use to verify
+ everything is passing.
+
+- Note that there are two GitHub actions checks that need not be green:
+
+ 1. We test the freshness of the generated proto code we maintain via the
+ `vet-proto` check. If the source proto files are updated, but our repo is
+ not updated, an optional checker will fail. This will be fixed by our team
+ in a separate PR and will not prevent the merge of your PR.
+
+ 2. We run a checker that will fail if there is any change in dependencies of
+ an exported package via the `dependencies` check. If new dependencies are
+ added that are not appropriate, we may not accept your PR (see below).
+
+- If you are adding a **new file**, make sure it has the **copyright message**
+ template at the top as a comment. You can copy the message from an existing
+ file and update the year.
- The grpc package should only depend on standard Go packages and a small number
- of exceptions. If your contribution introduces new dependencies which are NOT
- in the [list](https://godoc.org/google.golang.org/grpc?imports), you need a
- discussion with gRPC-Go authors and consultants.
+ of exceptions. **If your contribution introduces new dependencies**, you will
+ need a discussion with gRPC-Go maintainers.
-- For speculative changes, consider opening an issue and discussing it first. If
- you are suggesting a behavioral or API change, consider starting with a [gRFC
- proposal](https://github.com/grpc/proposal).
+### PR Descriptions
-- Provide a good **PR description** as a record of **what** change is being made
- and **why** it was made. Link to a GitHub issue if it exists.
+- **PR titles** should start with the name of the component being addressed, or
+ the type of change. Examples: transport, client, server, round_robin, xds,
+ cleanup, deps.
-- If you want to fix formatting or style, consider whether your changes are an
- obvious improvement or might be considered a personal preference. If a style
- change is based on preference, it likely will not be accepted. If it corrects
- widely agreed-upon anti-patterns, then please do create a PR and explain the
- benefits of the change.
+- Read and follow the **guidelines for PR titles and descriptions** here:
+ https://google.github.io/eng-practices/review/developer/cl-descriptions.html
-- Unless your PR is trivial, you should expect there will be reviewer comments
- that you'll need to address before merging. We'll mark it as `Status: Requires
- Reporter Clarification` if we expect you to respond to these comments in a
- timely manner. If the PR remains inactive for 6 days, it will be marked as
- `stale` and automatically close 7 days after that if we don't hear back from
- you.
+ *particularly* the sections "First Line" and "Body is Informative".
-- Maintain **clean commit history** and use **meaningful commit messages**. PRs
- with messy commit history are difficult to review and won't be merged. Use
- `rebase -i upstream/master` to curate your commit history and/or to bring in
- latest changes from master (but avoid rebasing in the middle of a code
- review).
+ Note: your PR description will be used as the git commit message in a
+ squash-and-merge if your PR is approved. We may make changes to this as
+ necessary.
-- Keep your PR up to date with upstream/master (if there are merge conflicts, we
- can't really merge your change).
+- **Does this PR relate to an open issue?** On the first line, please use the
+ tag `Fixes #` to ensure the issue is closed when the PR is merged. Or
+ use `Updates #` if the PR is related to an open issue, but does not fix
+ it. Consider filing an issue if one does not already exist.
-- **All tests need to be passing** before your change can be merged. We
- recommend you **run tests locally** before creating your PR to catch breakages
- early on.
- - `./scripts/vet.sh` to catch vet errors
- - `go test -cpu 1,4 -timeout 7m ./...` to run the tests
- - `go test -race -cpu 1,4 -timeout 7m ./...` to run tests in race mode
+- PR descriptions *must* conclude with **release notes** as follows:
+
+ ```
+ RELEASE NOTES:
+ * :
+ ```
+
+ This need not match the PR title.
+
+ The summary must:
+
+ * be something that gRPC users will understand.
+
+ * clearly explain the feature being added, the issue being fixed, or the
+ behavior being changed, etc. If fixing a bug, be clear about how the bug
+ can be triggered by an end-user.
+
+ * begin with a capital letter and use complete sentences.
-- Exceptions to the rules can be made if there's a compelling reason for doing so.
+ * be as short as possible to describe the change being made.
+
+ If a PR is *not* end-user visible -- e.g. a cleanup, testing change, or
+ GitHub-related, use `RELEASE NOTES: n/a`.
+
+### PR Process
+
+- Please **self-review** your code changes before sending your PR. This will
+ prevent simple, obvious errors from causing delays.
+
+- Maintain a **clean commit history** and use **meaningful commit messages**.
+ PRs with messy commit histories are difficult to review and won't be merged.
+ Before sending your PR, ensure your changes are based on top of the latest
+ `upstream/master` commits, and avoid rebasing in the middle of a code review.
+ You should **never use `git push -f`** unless absolutely necessary during a
+ review, as it can interfere with GitHub's tracking of comments.
+
+- Unless your PR is trivial, you should **expect reviewer comments** that you
+ will need to address before merging. We'll label the PR as `Status: Requires
+ Reporter Clarification` if we expect you to respond to these comments in a
+ timely manner. If the PR remains inactive for 6 days, it will be marked as
+ `stale`, and we will automatically close it after 7 days if we don't hear back
+ from you. Please feel free to ping issues or bugs if you do not get a response
+ within a week.
diff --git a/vendor/google.golang.org/grpc/MAINTAINERS.md b/vendor/google.golang.org/grpc/MAINTAINERS.md
index 5d4096d46..df35bb9a8 100644
--- a/vendor/google.golang.org/grpc/MAINTAINERS.md
+++ b/vendor/google.golang.org/grpc/MAINTAINERS.md
@@ -9,21 +9,19 @@ for general contribution guidelines.
## Maintainers (in alphabetical order)
-- [aranjans](https://github.com/aranjans), Google LLC
- [arjan-bal](https://github.com/arjan-bal), Google LLC
- [arvindbr8](https://github.com/arvindbr8), Google LLC
- [atollena](https://github.com/atollena), Datadog, Inc.
- [dfawley](https://github.com/dfawley), Google LLC
- [easwars](https://github.com/easwars), Google LLC
-- [erm-g](https://github.com/erm-g), Google LLC
- [gtcooke94](https://github.com/gtcooke94), Google LLC
-- [purnesh42h](https://github.com/purnesh42h), Google LLC
-- [zasweq](https://github.com/zasweq), Google LLC
## Emeritus Maintainers (in alphabetical order)
- [adelez](https://github.com/adelez)
+- [aranjans](https://github.com/aranjans)
- [canguler](https://github.com/canguler)
- [cesarghali](https://github.com/cesarghali)
+- [erm-g](https://github.com/erm-g)
- [iamqizhao](https://github.com/iamqizhao)
- [jeanbza](https://github.com/jeanbza)
- [jtattermusch](https://github.com/jtattermusch)
@@ -32,5 +30,7 @@ for general contribution guidelines.
- [matt-kwong](https://github.com/matt-kwong)
- [menghanl](https://github.com/menghanl)
- [nicolasnoble](https://github.com/nicolasnoble)
+- [purnesh42h](https://github.com/purnesh42h)
- [srini100](https://github.com/srini100)
- [yongni](https://github.com/yongni)
+- [zasweq](https://github.com/zasweq)
diff --git a/vendor/google.golang.org/grpc/README.md b/vendor/google.golang.org/grpc/README.md
index b572707c6..f9a88d597 100644
--- a/vendor/google.golang.org/grpc/README.md
+++ b/vendor/google.golang.org/grpc/README.md
@@ -32,6 +32,7 @@ import "google.golang.org/grpc"
- [Low-level technical docs](Documentation) from this repository
- [Performance benchmark][]
- [Examples](examples)
+- [Contribution guidelines](CONTRIBUTING.md)
## FAQ
diff --git a/vendor/google.golang.org/grpc/balancer/balancer.go b/vendor/google.golang.org/grpc/balancer/balancer.go
index c9b343c71..b1264017d 100644
--- a/vendor/google.golang.org/grpc/balancer/balancer.go
+++ b/vendor/google.golang.org/grpc/balancer/balancer.go
@@ -360,6 +360,10 @@ type Balancer interface {
// call SubConn.Shutdown for its existing SubConns; however, this will be
// required in a future release, so it is recommended.
Close()
+ // ExitIdle instructs the LB policy to reconnect to backends / exit the
+ // IDLE state, if appropriate and possible. Note that SubConns that enter
+ // the IDLE state will not reconnect until SubConn.Connect is called.
+ ExitIdle()
}
// ExitIdler is an optional interface for balancers to implement. If
@@ -367,8 +371,8 @@ type Balancer interface {
// the ClientConn is idle. If unimplemented, ClientConn.Connect will cause
// all SubConns to connect.
//
-// Notice: it will be required for all balancers to implement this in a future
-// release.
+// Deprecated: All balancers must implement this interface. This interface will
+// be removed in a future release.
type ExitIdler interface {
// ExitIdle instructs the LB policy to reconnect to backends / exit the
// IDLE state, if appropriate and possible. Note that SubConns that enter
diff --git a/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go b/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go
index cc606f4da..360db08eb 100644
--- a/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go
+++ b/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go
@@ -37,6 +37,8 @@ import (
"google.golang.org/grpc/resolver"
)
+var randIntN = rand.IntN
+
// ChildState is the balancer state of a child along with the endpoint which
// identifies the child balancer.
type ChildState struct {
@@ -45,7 +47,15 @@ type ChildState struct {
// Balancer exposes only the ExitIdler interface of the child LB policy.
// Other methods of the child policy are called only by endpointsharding.
- Balancer balancer.ExitIdler
+ Balancer ExitIdler
+}
+
+// ExitIdler provides access to only the ExitIdle method of the child balancer.
+type ExitIdler interface {
+ // ExitIdle instructs the LB policy to reconnect to backends / exit the
+ // IDLE state, if appropriate and possible. Note that SubConns that enter
+ // the IDLE state will not reconnect until SubConn.Connect is called.
+ ExitIdle()
}
// Options are the options to configure the behaviour of the
@@ -104,6 +114,21 @@ type endpointSharding struct {
mu sync.Mutex
}
+// rotateEndpoints returns a slice of all the input endpoints rotated a random
+// amount.
+func rotateEndpoints(es []resolver.Endpoint) []resolver.Endpoint {
+ les := len(es)
+ if les == 0 {
+ return es
+ }
+ r := randIntN(les)
+ // Make a copy to avoid mutating data beyond the end of es.
+ ret := make([]resolver.Endpoint, les)
+ copy(ret, es[r:])
+ copy(ret[les-r:], es[:r])
+ return ret
+}
+
// UpdateClientConnState creates a child for new endpoints and deletes children
// for endpoints that are no longer present. It also updates all the children,
// and sends a single synchronous update of the childrens' aggregated state at
@@ -125,7 +150,7 @@ func (es *endpointSharding) UpdateClientConnState(state balancer.ClientConnState
newChildren := resolver.NewEndpointMap[*balancerWrapper]()
// Update/Create new children.
- for _, endpoint := range state.ResolverState.Endpoints {
+ for _, endpoint := range rotateEndpoints(state.ResolverState.Endpoints) {
if _, ok := newChildren.Get(endpoint); ok {
// Endpoint child was already created, continue to avoid duplicate
// update.
@@ -205,6 +230,16 @@ func (es *endpointSharding) Close() {
}
}
+func (es *endpointSharding) ExitIdle() {
+ es.childMu.Lock()
+ defer es.childMu.Unlock()
+ for _, bw := range es.children.Load().Values() {
+ if !bw.isClosed {
+ bw.child.ExitIdle()
+ }
+ }
+}
+
// updateState updates this component's state. It sends the aggregated state,
// and a picker with round robin behavior with all the child states present if
// needed.
@@ -261,7 +296,7 @@ func (es *endpointSharding) updateState() {
p := &pickerWithChildStates{
pickers: pickers,
childStates: childStates,
- next: uint32(rand.IntN(len(pickers))),
+ next: uint32(randIntN(len(pickers))),
}
es.cc.UpdateState(balancer.State{
ConnectivityState: aggState,
@@ -326,15 +361,13 @@ func (bw *balancerWrapper) UpdateState(state balancer.State) {
// ExitIdle pings an IDLE child balancer to exit idle in a new goroutine to
// avoid deadlocks due to synchronous balancer state updates.
func (bw *balancerWrapper) ExitIdle() {
- if ei, ok := bw.child.(balancer.ExitIdler); ok {
- go func() {
- bw.es.childMu.Lock()
- if !bw.isClosed {
- ei.ExitIdle()
- }
- bw.es.childMu.Unlock()
- }()
- }
+ go func() {
+ bw.es.childMu.Lock()
+ if !bw.isClosed {
+ bw.child.ExitIdle()
+ }
+ bw.es.childMu.Unlock()
+ }()
}
// updateClientConnStateLocked delivers the ClientConnState to the child
diff --git a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go
index 732eb56bb..01ac7f6f3 100644
--- a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go
+++ b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go
@@ -19,7 +19,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
-// protoc-gen-go v1.36.5
+// protoc-gen-go v1.36.6
// protoc v5.27.1
// source: grpc/lb/v1/load_balancer.proto
@@ -642,115 +642,47 @@ func (x *Server) GetDrop() bool {
var File_grpc_lb_v1_load_balancer_proto protoreflect.FileDescriptor
-var file_grpc_lb_v1_load_balancer_proto_rawDesc = string([]byte{
- 0x0a, 0x1e, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x6c, 0x62, 0x2f, 0x76, 0x31, 0x2f, 0x6c, 0x6f, 0x61,
- 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
- 0x12, 0x0a, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x1a, 0x1e, 0x67, 0x6f,
- 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75,
- 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1f, 0x67, 0x6f,
- 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x69,
- 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xc1, 0x01,
- 0x0a, 0x12, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x71,
- 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x0f, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f,
- 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e,
- 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x49, 0x6e, 0x69, 0x74, 0x69,
- 0x61, 0x6c, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x71,
- 0x75, 0x65, 0x73, 0x74, 0x48, 0x00, 0x52, 0x0e, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x52,
- 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3c, 0x0a, 0x0c, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74,
- 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67,
- 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74,
- 0x53, 0x74, 0x61, 0x74, 0x73, 0x48, 0x00, 0x52, 0x0b, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53,
- 0x74, 0x61, 0x74, 0x73, 0x42, 0x1b, 0x0a, 0x19, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x62, 0x61, 0x6c,
- 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x74, 0x79, 0x70,
- 0x65, 0x22, 0x2f, 0x0a, 0x19, 0x49, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x4c, 0x6f, 0x61, 0x64,
- 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x12,
- 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61,
- 0x6d, 0x65, 0x22, 0x60, 0x0a, 0x13, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74,
- 0x73, 0x50, 0x65, 0x72, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x2c, 0x0a, 0x12, 0x6c, 0x6f, 0x61,
- 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18,
- 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x6c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e,
- 0x63, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1b, 0x0a, 0x09, 0x6e, 0x75, 0x6d, 0x5f, 0x63,
- 0x61, 0x6c, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x08, 0x6e, 0x75, 0x6d, 0x43,
- 0x61, 0x6c, 0x6c, 0x73, 0x22, 0xb0, 0x03, 0x0a, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53,
- 0x74, 0x61, 0x74, 0x73, 0x12, 0x38, 0x0a, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d,
- 0x70, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65,
- 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74,
- 0x61, 0x6d, 0x70, 0x52, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x12, 0x2a,
- 0x0a, 0x11, 0x6e, 0x75, 0x6d, 0x5f, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x73, 0x74, 0x61, 0x72,
- 0x74, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0f, 0x6e, 0x75, 0x6d, 0x43, 0x61,
- 0x6c, 0x6c, 0x73, 0x53, 0x74, 0x61, 0x72, 0x74, 0x65, 0x64, 0x12, 0x2c, 0x0a, 0x12, 0x6e, 0x75,
- 0x6d, 0x5f, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64,
- 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x6e, 0x75, 0x6d, 0x43, 0x61, 0x6c, 0x6c, 0x73,
- 0x46, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64, 0x12, 0x5d, 0x0a, 0x2d, 0x6e, 0x75, 0x6d, 0x5f,
- 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64, 0x5f, 0x77,
- 0x69, 0x74, 0x68, 0x5f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x66, 0x61, 0x69, 0x6c, 0x65,
- 0x64, 0x5f, 0x74, 0x6f, 0x5f, 0x73, 0x65, 0x6e, 0x64, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x52,
- 0x26, 0x6e, 0x75, 0x6d, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x46, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65,
- 0x64, 0x57, 0x69, 0x74, 0x68, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x46, 0x61, 0x69, 0x6c, 0x65,
- 0x64, 0x54, 0x6f, 0x53, 0x65, 0x6e, 0x64, 0x12, 0x48, 0x0a, 0x21, 0x6e, 0x75, 0x6d, 0x5f, 0x63,
- 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64, 0x5f, 0x6b, 0x6e,
- 0x6f, 0x77, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x18, 0x07, 0x20, 0x01,
- 0x28, 0x03, 0x52, 0x1d, 0x6e, 0x75, 0x6d, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x46, 0x69, 0x6e, 0x69,
- 0x73, 0x68, 0x65, 0x64, 0x4b, 0x6e, 0x6f, 0x77, 0x6e, 0x52, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65,
- 0x64, 0x12, 0x58, 0x0a, 0x18, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73,
- 0x68, 0x65, 0x64, 0x5f, 0x77, 0x69, 0x74, 0x68, 0x5f, 0x64, 0x72, 0x6f, 0x70, 0x18, 0x08, 0x20,
- 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31,
- 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74, 0x73, 0x50, 0x65, 0x72, 0x54,
- 0x6f, 0x6b, 0x65, 0x6e, 0x52, 0x15, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x46, 0x69, 0x6e, 0x69, 0x73,
- 0x68, 0x65, 0x64, 0x57, 0x69, 0x74, 0x68, 0x44, 0x72, 0x6f, 0x70, 0x4a, 0x04, 0x08, 0x04, 0x10,
- 0x05, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x22, 0x90, 0x02, 0x0a, 0x13, 0x4c, 0x6f, 0x61, 0x64,
- 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12,
- 0x53, 0x0a, 0x10, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x72, 0x65, 0x73, 0x70, 0x6f,
- 0x6e, 0x73, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x72, 0x70, 0x63,
- 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x49, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x4c, 0x6f,
- 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73,
- 0x65, 0x48, 0x00, 0x52, 0x0f, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x52, 0x65, 0x73, 0x70,
- 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x39, 0x0a, 0x0b, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x5f, 0x6c,
- 0x69, 0x73, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, 0x72, 0x70, 0x63,
- 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x4c, 0x69, 0x73,
- 0x74, 0x48, 0x00, 0x52, 0x0a, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x4c, 0x69, 0x73, 0x74, 0x12,
- 0x4b, 0x0a, 0x11, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x5f, 0x72, 0x65, 0x73, 0x70,
- 0x6f, 0x6e, 0x73, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x72, 0x70,
- 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b,
- 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x48, 0x00, 0x52, 0x10, 0x66, 0x61, 0x6c, 0x6c,
- 0x62, 0x61, 0x63, 0x6b, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x42, 0x1c, 0x0a, 0x1a,
- 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x72, 0x65, 0x73,
- 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0x12, 0x0a, 0x10, 0x46, 0x61,
- 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x7e,
- 0x0a, 0x1a, 0x49, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c,
- 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x5a, 0x0a, 0x1c,
- 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x5f, 0x72, 0x65, 0x70,
- 0x6f, 0x72, 0x74, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01,
- 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74,
- 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x19, 0x63,
- 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74, 0x73, 0x52, 0x65, 0x70, 0x6f, 0x72, 0x74,
- 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x4a, 0x04, 0x08, 0x01, 0x10, 0x02, 0x22, 0x40,
- 0x0a, 0x0a, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x4c, 0x69, 0x73, 0x74, 0x12, 0x2c, 0x0a, 0x07,
- 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e,
- 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65,
- 0x72, 0x52, 0x07, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x73, 0x4a, 0x04, 0x08, 0x03, 0x10, 0x04,
- 0x22, 0x83, 0x01, 0x0a, 0x06, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x12, 0x1d, 0x0a, 0x0a, 0x69,
- 0x70, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52,
- 0x09, 0x69, 0x70, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f,
- 0x72, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x2c,
- 0x0a, 0x12, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x74,
- 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x6c, 0x6f, 0x61, 0x64,
- 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x12, 0x0a, 0x04,
- 0x64, 0x72, 0x6f, 0x70, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x52, 0x04, 0x64, 0x72, 0x6f, 0x70,
- 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x32, 0x62, 0x0a, 0x0c, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61,
- 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x12, 0x52, 0x0a, 0x0b, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63,
- 0x65, 0x4c, 0x6f, 0x61, 0x64, 0x12, 0x1e, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e,
- 0x76, 0x31, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65,
- 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x1f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e,
- 0x76, 0x31, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65,
- 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x28, 0x01, 0x30, 0x01, 0x42, 0x57, 0x0a, 0x0d, 0x69, 0x6f,
- 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x42, 0x11, 0x4c, 0x6f, 0x61,
- 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01,
- 0x5a, 0x31, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e,
- 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65,
- 0x72, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x6c, 0x62, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x6c, 0x62,
- 0x5f, 0x76, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33,
-})
+const file_grpc_lb_v1_load_balancer_proto_rawDesc = "" +
+ "\n" +
+ "\x1egrpc/lb/v1/load_balancer.proto\x12\n" +
+ "grpc.lb.v1\x1a\x1egoogle/protobuf/duration.proto\x1a\x1fgoogle/protobuf/timestamp.proto\"\xc1\x01\n" +
+ "\x12LoadBalanceRequest\x12P\n" +
+ "\x0finitial_request\x18\x01 \x01(\v2%.grpc.lb.v1.InitialLoadBalanceRequestH\x00R\x0einitialRequest\x12<\n" +
+ "\fclient_stats\x18\x02 \x01(\v2\x17.grpc.lb.v1.ClientStatsH\x00R\vclientStatsB\x1b\n" +
+ "\x19load_balance_request_type\"/\n" +
+ "\x19InitialLoadBalanceRequest\x12\x12\n" +
+ "\x04name\x18\x01 \x01(\tR\x04name\"`\n" +
+ "\x13ClientStatsPerToken\x12,\n" +
+ "\x12load_balance_token\x18\x01 \x01(\tR\x10loadBalanceToken\x12\x1b\n" +
+ "\tnum_calls\x18\x02 \x01(\x03R\bnumCalls\"\xb0\x03\n" +
+ "\vClientStats\x128\n" +
+ "\ttimestamp\x18\x01 \x01(\v2\x1a.google.protobuf.TimestampR\ttimestamp\x12*\n" +
+ "\x11num_calls_started\x18\x02 \x01(\x03R\x0fnumCallsStarted\x12,\n" +
+ "\x12num_calls_finished\x18\x03 \x01(\x03R\x10numCallsFinished\x12]\n" +
+ "-num_calls_finished_with_client_failed_to_send\x18\x06 \x01(\x03R&numCallsFinishedWithClientFailedToSend\x12H\n" +
+ "!num_calls_finished_known_received\x18\a \x01(\x03R\x1dnumCallsFinishedKnownReceived\x12X\n" +
+ "\x18calls_finished_with_drop\x18\b \x03(\v2\x1f.grpc.lb.v1.ClientStatsPerTokenR\x15callsFinishedWithDropJ\x04\b\x04\x10\x05J\x04\b\x05\x10\x06\"\x90\x02\n" +
+ "\x13LoadBalanceResponse\x12S\n" +
+ "\x10initial_response\x18\x01 \x01(\v2&.grpc.lb.v1.InitialLoadBalanceResponseH\x00R\x0finitialResponse\x129\n" +
+ "\vserver_list\x18\x02 \x01(\v2\x16.grpc.lb.v1.ServerListH\x00R\n" +
+ "serverList\x12K\n" +
+ "\x11fallback_response\x18\x03 \x01(\v2\x1c.grpc.lb.v1.FallbackResponseH\x00R\x10fallbackResponseB\x1c\n" +
+ "\x1aload_balance_response_type\"\x12\n" +
+ "\x10FallbackResponse\"~\n" +
+ "\x1aInitialLoadBalanceResponse\x12Z\n" +
+ "\x1cclient_stats_report_interval\x18\x02 \x01(\v2\x19.google.protobuf.DurationR\x19clientStatsReportIntervalJ\x04\b\x01\x10\x02\"@\n" +
+ "\n" +
+ "ServerList\x12,\n" +
+ "\aservers\x18\x01 \x03(\v2\x12.grpc.lb.v1.ServerR\aserversJ\x04\b\x03\x10\x04\"\x83\x01\n" +
+ "\x06Server\x12\x1d\n" +
+ "\n" +
+ "ip_address\x18\x01 \x01(\fR\tipAddress\x12\x12\n" +
+ "\x04port\x18\x02 \x01(\x05R\x04port\x12,\n" +
+ "\x12load_balance_token\x18\x03 \x01(\tR\x10loadBalanceToken\x12\x12\n" +
+ "\x04drop\x18\x04 \x01(\bR\x04dropJ\x04\b\x05\x10\x062b\n" +
+ "\fLoadBalancer\x12R\n" +
+ "\vBalanceLoad\x12\x1e.grpc.lb.v1.LoadBalanceRequest\x1a\x1f.grpc.lb.v1.LoadBalanceResponse(\x010\x01BW\n" +
+ "\rio.grpc.lb.v1B\x11LoadBalancerProtoP\x01Z1google.golang.org/grpc/balancer/grpclb/grpc_lb_v1b\x06proto3"
var (
file_grpc_lb_v1_load_balancer_proto_rawDescOnce sync.Once
diff --git a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go
index 84e6a2505..c4ace87b2 100644
--- a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go
+++ b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go
@@ -86,7 +86,7 @@ type LoadBalancerServer interface {
type UnimplementedLoadBalancerServer struct{}
func (UnimplementedLoadBalancerServer) BalanceLoad(grpc.BidiStreamingServer[LoadBalanceRequest, LoadBalanceResponse]) error {
- return status.Errorf(codes.Unimplemented, "method BalanceLoad not implemented")
+ return status.Error(codes.Unimplemented, "method BalanceLoad not implemented")
}
func (UnimplementedLoadBalancerServer) testEmbeddedByValue() {}
diff --git a/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go b/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go
index f2df56120..002052120 100644
--- a/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go
+++ b/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go
@@ -82,14 +82,8 @@ func (lb *lbBalancer) processServerList(l *lbpb.ServerList) {
}
md := metadata.Pairs(lbTokenKey, s.LoadBalanceToken)
- ip := net.IP(s.IpAddress)
- ipStr := ip.String()
- if ip.To4() == nil {
- // Add square brackets to ipv6 addresses, otherwise net.Dial() and
- // net.SplitHostPort() will return too many colons error.
- ipStr = fmt.Sprintf("[%s]", ipStr)
- }
- addr := imetadata.Set(resolver.Address{Addr: fmt.Sprintf("%s:%d", ipStr, s.Port)}, md)
+ ipStr := net.IP(s.IpAddress).String()
+ addr := imetadata.Set(resolver.Address{Addr: net.JoinHostPort(ipStr, fmt.Sprintf("%d", s.Port))}, md)
if lb.logger.V(2) {
lb.logger.Infof("Server list entry:|%d|, ipStr:|%s|, port:|%d|, load balancer token:|%v|", i, ipStr, s.Port, s.LoadBalanceToken)
}
diff --git a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go
index ea8899818..b15c10e46 100644
--- a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go
+++ b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go
@@ -169,7 +169,7 @@ func (b *pickfirstBalancer) UpdateClientConnState(state balancer.ClientConnState
addrs = state.ResolverState.Addresses
if cfg.ShuffleAddressList {
addrs = append([]resolver.Address{}, addrs...)
- rand.Shuffle(len(addrs), func(i, j int) { addrs[i], addrs[j] = addrs[j], addrs[i] })
+ internal.RandShuffle(len(addrs), func(i, j int) { addrs[i], addrs[j] = addrs[j], addrs[i] })
}
}
diff --git a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go
index 494314f23..9ffdd28a0 100644
--- a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go
+++ b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go
@@ -54,18 +54,9 @@ func init() {
balancer.Register(pickfirstBuilder{})
}
-type (
- // enableHealthListenerKeyType is a unique key type used in resolver
- // attributes to indicate whether the health listener usage is enabled.
- enableHealthListenerKeyType struct{}
- // managedByPickfirstKeyType is an attribute key type to inform Outlier
- // Detection that the generic health listener is being used.
- // TODO: https://github.com/grpc/grpc-go/issues/7915 - Remove this when
- // implementing the dualstack design. This is a hack. Once Dualstack is
- // completed, outlier detection will stop sending ejection updates through
- // the connectivity listener.
- managedByPickfirstKeyType struct{}
-)
+// enableHealthListenerKeyType is a unique key type used in resolver
+// attributes to indicate whether the health listener usage is enabled.
+type enableHealthListenerKeyType struct{}
var (
logger = grpclog.Component("pick-first-leaf-lb")
@@ -76,21 +67,21 @@ var (
disconnectionsMetric = expstats.RegisterInt64Count(expstats.MetricDescriptor{
Name: "grpc.lb.pick_first.disconnections",
Description: "EXPERIMENTAL. Number of times the selected subchannel becomes disconnected.",
- Unit: "disconnection",
+ Unit: "{disconnection}",
Labels: []string{"grpc.target"},
Default: false,
})
connectionAttemptsSucceededMetric = expstats.RegisterInt64Count(expstats.MetricDescriptor{
Name: "grpc.lb.pick_first.connection_attempts_succeeded",
Description: "EXPERIMENTAL. Number of successful connection attempts.",
- Unit: "attempt",
+ Unit: "{attempt}",
Labels: []string{"grpc.target"},
Default: false,
})
connectionAttemptsFailedMetric = expstats.RegisterInt64Count(expstats.MetricDescriptor{
Name: "grpc.lb.pick_first.connection_attempts_failed",
Description: "EXPERIMENTAL. Number of failed connection attempts.",
- Unit: "attempt",
+ Unit: "{attempt}",
Labels: []string{"grpc.target"},
Default: false,
})
@@ -149,17 +140,6 @@ func EnableHealthListener(state resolver.State) resolver.State {
return state
}
-// IsManagedByPickfirst returns whether an address belongs to a SubConn
-// managed by the pickfirst LB policy.
-// TODO: https://github.com/grpc/grpc-go/issues/7915 - This is a hack to disable
-// outlier_detection via the with connectivity listener when using pick_first.
-// Once Dualstack changes are complete, all SubConns will be created by
-// pick_first and outlier detection will only use the health listener for
-// ejection. This hack can then be removed.
-func IsManagedByPickfirst(addr resolver.Address) bool {
- return addr.BalancerAttributes.Value(managedByPickfirstKeyType{}) != nil
-}
-
type pfConfig struct {
serviceconfig.LoadBalancingConfig `json:"-"`
@@ -186,7 +166,6 @@ type scData struct {
}
func (b *pickfirstBalancer) newSCData(addr resolver.Address) (*scData, error) {
- addr.BalancerAttributes = addr.BalancerAttributes.WithValue(managedByPickfirstKeyType{}, true)
sd := &scData{
rawConnectivityState: connectivity.Idle,
effectiveState: connectivity.Idle,
@@ -304,7 +283,7 @@ func (b *pickfirstBalancer) UpdateClientConnState(state balancer.ClientConnState
newAddrs = state.ResolverState.Addresses
if cfg.ShuffleAddressList {
newAddrs = append([]resolver.Address{}, newAddrs...)
- internal.RandShuffle(len(endpoints), func(i, j int) { endpoints[i], endpoints[j] = endpoints[j], endpoints[i] })
+ internal.RandShuffle(len(newAddrs), func(i, j int) { newAddrs[i], newAddrs[j] = newAddrs[j], newAddrs[i] })
}
}
@@ -372,6 +351,13 @@ func (b *pickfirstBalancer) ExitIdle() {
b.mu.Lock()
defer b.mu.Unlock()
if b.state == connectivity.Idle {
+ // Move the balancer into CONNECTING state immediately. This is done to
+ // avoid staying in IDLE if a resolver update arrives before the first
+ // SubConn reports CONNECTING.
+ b.updateBalancerState(balancer.State{
+ ConnectivityState: connectivity.Connecting,
+ Picker: &picker{err: balancer.ErrNoSubConnAvailable},
+ })
b.startFirstPassLocked()
}
}
@@ -625,7 +611,7 @@ func (b *pickfirstBalancer) updateSubConnState(sd *scData, newState balancer.Sub
if !b.addressList.seekTo(sd.addr) {
// This should not fail as we should have only one SubConn after
// entering READY. The SubConn should be present in the addressList.
- b.logger.Errorf("Address %q not found address list in %v", sd.addr, b.addressList.addresses)
+ b.logger.Errorf("Address %q not found address list in %v", sd.addr, b.addressList.addresses)
return
}
if !b.healthCheckingEnabled {
diff --git a/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go b/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go
index 35da5d1ec..22045bf39 100644
--- a/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go
+++ b/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go
@@ -70,10 +70,3 @@ func (b *rrBalancer) UpdateClientConnState(ccs balancer.ClientConnState) error {
ResolverState: pickfirstleaf.EnableHealthListener(ccs.ResolverState),
})
}
-
-func (b *rrBalancer) ExitIdle() {
- // Should always be ok, as child is endpoint sharding.
- if ei, ok := b.Balancer.(balancer.ExitIdler); ok {
- ei.ExitIdle()
- }
-}
diff --git a/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go b/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go
index 825c31795..b1364a032 100644
--- a/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go
+++ b/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go
@@ -18,7 +18,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
-// protoc-gen-go v1.36.5
+// protoc-gen-go v1.36.6
// protoc v5.27.1
// source: grpc/binlog/v1/binarylog.proto
@@ -858,133 +858,68 @@ func (x *Address) GetIpPort() uint32 {
var File_grpc_binlog_v1_binarylog_proto protoreflect.FileDescriptor
-var file_grpc_binlog_v1_binarylog_proto_rawDesc = string([]byte{
- 0x0a, 0x1e, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x62, 0x69, 0x6e, 0x6c, 0x6f, 0x67, 0x2f, 0x76, 0x31,
- 0x2f, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
- 0x12, 0x11, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67,
- 0x2e, 0x76, 0x31, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74,
- 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72,
- 0x6f, 0x74, 0x6f, 0x1a, 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74,
- 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70,
- 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xbb, 0x07, 0x0a, 0x0c, 0x47, 0x72, 0x70, 0x63, 0x4c, 0x6f, 0x67,
- 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x38, 0x0a, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61,
- 0x6d, 0x70, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c,
- 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73,
- 0x74, 0x61, 0x6d, 0x70, 0x52, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x12,
- 0x17, 0x0a, 0x07, 0x63, 0x61, 0x6c, 0x6c, 0x5f, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x04,
- 0x52, 0x06, 0x63, 0x61, 0x6c, 0x6c, 0x49, 0x64, 0x12, 0x35, 0x0a, 0x17, 0x73, 0x65, 0x71, 0x75,
- 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x69, 0x64, 0x5f, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x5f, 0x63,
- 0x61, 0x6c, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x04, 0x52, 0x14, 0x73, 0x65, 0x71, 0x75, 0x65,
- 0x6e, 0x63, 0x65, 0x49, 0x64, 0x57, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x43, 0x61, 0x6c, 0x6c, 0x12,
- 0x3d, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e,
- 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76,
- 0x31, 0x2e, 0x47, 0x72, 0x70, 0x63, 0x4c, 0x6f, 0x67, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x2e, 0x45,
- 0x76, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x3e,
- 0x0a, 0x06, 0x6c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26,
- 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e,
- 0x76, 0x31, 0x2e, 0x47, 0x72, 0x70, 0x63, 0x4c, 0x6f, 0x67, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x2e,
- 0x4c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x52, 0x06, 0x6c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x12, 0x46,
- 0x0a, 0x0d, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18,
- 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e,
- 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74,
- 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0c, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74,
- 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x46, 0x0a, 0x0d, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72,
- 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e,
- 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76,
- 0x31, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x48, 0x00,
- 0x52, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x36,
- 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32,
- 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67,
- 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x48, 0x00, 0x52, 0x07, 0x6d,
- 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x36, 0x0a, 0x07, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x65,
- 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62,
- 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x61, 0x69,
- 0x6c, 0x65, 0x72, 0x48, 0x00, 0x52, 0x07, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x65, 0x72, 0x12, 0x2b,
- 0x0a, 0x11, 0x70, 0x61, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x74, 0x72, 0x75, 0x6e, 0x63, 0x61,
- 0x74, 0x65, 0x64, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x52, 0x10, 0x70, 0x61, 0x79, 0x6c, 0x6f,
- 0x61, 0x64, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x2e, 0x0a, 0x04, 0x70,
- 0x65, 0x65, 0x72, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63,
- 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x41, 0x64,
- 0x64, 0x72, 0x65, 0x73, 0x73, 0x52, 0x04, 0x70, 0x65, 0x65, 0x72, 0x22, 0xf5, 0x01, 0x0a, 0x09,
- 0x45, 0x76, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x16, 0x0a, 0x12, 0x45, 0x56, 0x45,
- 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10,
- 0x00, 0x12, 0x1c, 0x0a, 0x18, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f,
- 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x10, 0x01, 0x12,
- 0x1c, 0x0a, 0x18, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45,
- 0x52, 0x56, 0x45, 0x52, 0x5f, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x10, 0x02, 0x12, 0x1d, 0x0a,
- 0x19, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x4c, 0x49, 0x45,
- 0x4e, 0x54, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x03, 0x12, 0x1d, 0x0a, 0x19,
- 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, 0x45,
- 0x52, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x04, 0x12, 0x20, 0x0a, 0x1c, 0x45,
- 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54,
- 0x5f, 0x48, 0x41, 0x4c, 0x46, 0x5f, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x10, 0x05, 0x12, 0x1d, 0x0a,
- 0x19, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56,
- 0x45, 0x52, 0x5f, 0x54, 0x52, 0x41, 0x49, 0x4c, 0x45, 0x52, 0x10, 0x06, 0x12, 0x15, 0x0a, 0x11,
- 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x41, 0x4e, 0x43, 0x45,
- 0x4c, 0x10, 0x07, 0x22, 0x42, 0x0a, 0x06, 0x4c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x12, 0x12, 0x0a,
- 0x0e, 0x4c, 0x4f, 0x47, 0x47, 0x45, 0x52, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10,
- 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x4c, 0x4f, 0x47, 0x47, 0x45, 0x52, 0x5f, 0x43, 0x4c, 0x49, 0x45,
- 0x4e, 0x54, 0x10, 0x01, 0x12, 0x11, 0x0a, 0x0d, 0x4c, 0x4f, 0x47, 0x47, 0x45, 0x52, 0x5f, 0x53,
- 0x45, 0x52, 0x56, 0x45, 0x52, 0x10, 0x02, 0x42, 0x09, 0x0a, 0x07, 0x70, 0x61, 0x79, 0x6c, 0x6f,
- 0x61, 0x64, 0x22, 0xbb, 0x01, 0x0a, 0x0c, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x48, 0x65, 0x61,
- 0x64, 0x65, 0x72, 0x12, 0x37, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18,
- 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e,
- 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61,
- 0x74, 0x61, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x1f, 0x0a, 0x0b,
- 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28,
- 0x09, 0x52, 0x0a, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1c, 0x0a,
- 0x09, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09,
- 0x52, 0x09, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, 0x33, 0x0a, 0x07, 0x74,
- 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67,
- 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44,
- 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74,
- 0x22, 0x47, 0x0a, 0x0c, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72,
- 0x12, 0x37, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x01, 0x20, 0x01,
- 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79,
- 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x52,
- 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x22, 0xb1, 0x01, 0x0a, 0x07, 0x54, 0x72,
- 0x61, 0x69, 0x6c, 0x65, 0x72, 0x12, 0x37, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74,
- 0x61, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62,
- 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61,
- 0x64, 0x61, 0x74, 0x61, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x1f,
- 0x0a, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x02, 0x20,
- 0x01, 0x28, 0x0d, 0x52, 0x0a, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x12,
- 0x25, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67,
- 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x4d,
- 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73,
- 0x5f, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0d,
- 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x44, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x22, 0x35, 0x0a,
- 0x07, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x65, 0x6e, 0x67,
- 0x74, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x06, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68,
- 0x12, 0x12, 0x0a, 0x04, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x04,
- 0x64, 0x61, 0x74, 0x61, 0x22, 0x42, 0x0a, 0x08, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61,
- 0x12, 0x36, 0x0a, 0x05, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32,
- 0x20, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67,
- 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72,
- 0x79, 0x52, 0x05, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x22, 0x37, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x61,
- 0x64, 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79,
- 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76,
- 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75,
- 0x65, 0x22, 0xb8, 0x01, 0x0a, 0x07, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x33, 0x0a,
- 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x1f, 0x2e, 0x67, 0x72,
- 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e,
- 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79,
- 0x70, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x02, 0x20,
- 0x01, 0x28, 0x09, 0x52, 0x07, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x17, 0x0a, 0x07,
- 0x69, 0x70, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x06, 0x69,
- 0x70, 0x50, 0x6f, 0x72, 0x74, 0x22, 0x45, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x10, 0x0a,
- 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12,
- 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x50, 0x56, 0x34, 0x10, 0x01, 0x12, 0x0d,
- 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x50, 0x56, 0x36, 0x10, 0x02, 0x12, 0x0d, 0x0a,
- 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x49, 0x58, 0x10, 0x03, 0x42, 0x5c, 0x0a, 0x14,
- 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f,
- 0x67, 0x2e, 0x76, 0x31, 0x42, 0x0e, 0x42, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x4c, 0x6f, 0x67, 0x50,
- 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x32, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67,
- 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x62,
- 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x62, 0x69,
- 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x5f, 0x76, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74,
- 0x6f, 0x33,
-})
+const file_grpc_binlog_v1_binarylog_proto_rawDesc = "" +
+ "\n" +
+ "\x1egrpc/binlog/v1/binarylog.proto\x12\x11grpc.binarylog.v1\x1a\x1egoogle/protobuf/duration.proto\x1a\x1fgoogle/protobuf/timestamp.proto\"\xbb\a\n" +
+ "\fGrpcLogEntry\x128\n" +
+ "\ttimestamp\x18\x01 \x01(\v2\x1a.google.protobuf.TimestampR\ttimestamp\x12\x17\n" +
+ "\acall_id\x18\x02 \x01(\x04R\x06callId\x125\n" +
+ "\x17sequence_id_within_call\x18\x03 \x01(\x04R\x14sequenceIdWithinCall\x12=\n" +
+ "\x04type\x18\x04 \x01(\x0e2).grpc.binarylog.v1.GrpcLogEntry.EventTypeR\x04type\x12>\n" +
+ "\x06logger\x18\x05 \x01(\x0e2&.grpc.binarylog.v1.GrpcLogEntry.LoggerR\x06logger\x12F\n" +
+ "\rclient_header\x18\x06 \x01(\v2\x1f.grpc.binarylog.v1.ClientHeaderH\x00R\fclientHeader\x12F\n" +
+ "\rserver_header\x18\a \x01(\v2\x1f.grpc.binarylog.v1.ServerHeaderH\x00R\fserverHeader\x126\n" +
+ "\amessage\x18\b \x01(\v2\x1a.grpc.binarylog.v1.MessageH\x00R\amessage\x126\n" +
+ "\atrailer\x18\t \x01(\v2\x1a.grpc.binarylog.v1.TrailerH\x00R\atrailer\x12+\n" +
+ "\x11payload_truncated\x18\n" +
+ " \x01(\bR\x10payloadTruncated\x12.\n" +
+ "\x04peer\x18\v \x01(\v2\x1a.grpc.binarylog.v1.AddressR\x04peer\"\xf5\x01\n" +
+ "\tEventType\x12\x16\n" +
+ "\x12EVENT_TYPE_UNKNOWN\x10\x00\x12\x1c\n" +
+ "\x18EVENT_TYPE_CLIENT_HEADER\x10\x01\x12\x1c\n" +
+ "\x18EVENT_TYPE_SERVER_HEADER\x10\x02\x12\x1d\n" +
+ "\x19EVENT_TYPE_CLIENT_MESSAGE\x10\x03\x12\x1d\n" +
+ "\x19EVENT_TYPE_SERVER_MESSAGE\x10\x04\x12 \n" +
+ "\x1cEVENT_TYPE_CLIENT_HALF_CLOSE\x10\x05\x12\x1d\n" +
+ "\x19EVENT_TYPE_SERVER_TRAILER\x10\x06\x12\x15\n" +
+ "\x11EVENT_TYPE_CANCEL\x10\a\"B\n" +
+ "\x06Logger\x12\x12\n" +
+ "\x0eLOGGER_UNKNOWN\x10\x00\x12\x11\n" +
+ "\rLOGGER_CLIENT\x10\x01\x12\x11\n" +
+ "\rLOGGER_SERVER\x10\x02B\t\n" +
+ "\apayload\"\xbb\x01\n" +
+ "\fClientHeader\x127\n" +
+ "\bmetadata\x18\x01 \x01(\v2\x1b.grpc.binarylog.v1.MetadataR\bmetadata\x12\x1f\n" +
+ "\vmethod_name\x18\x02 \x01(\tR\n" +
+ "methodName\x12\x1c\n" +
+ "\tauthority\x18\x03 \x01(\tR\tauthority\x123\n" +
+ "\atimeout\x18\x04 \x01(\v2\x19.google.protobuf.DurationR\atimeout\"G\n" +
+ "\fServerHeader\x127\n" +
+ "\bmetadata\x18\x01 \x01(\v2\x1b.grpc.binarylog.v1.MetadataR\bmetadata\"\xb1\x01\n" +
+ "\aTrailer\x127\n" +
+ "\bmetadata\x18\x01 \x01(\v2\x1b.grpc.binarylog.v1.MetadataR\bmetadata\x12\x1f\n" +
+ "\vstatus_code\x18\x02 \x01(\rR\n" +
+ "statusCode\x12%\n" +
+ "\x0estatus_message\x18\x03 \x01(\tR\rstatusMessage\x12%\n" +
+ "\x0estatus_details\x18\x04 \x01(\fR\rstatusDetails\"5\n" +
+ "\aMessage\x12\x16\n" +
+ "\x06length\x18\x01 \x01(\rR\x06length\x12\x12\n" +
+ "\x04data\x18\x02 \x01(\fR\x04data\"B\n" +
+ "\bMetadata\x126\n" +
+ "\x05entry\x18\x01 \x03(\v2 .grpc.binarylog.v1.MetadataEntryR\x05entry\"7\n" +
+ "\rMetadataEntry\x12\x10\n" +
+ "\x03key\x18\x01 \x01(\tR\x03key\x12\x14\n" +
+ "\x05value\x18\x02 \x01(\fR\x05value\"\xb8\x01\n" +
+ "\aAddress\x123\n" +
+ "\x04type\x18\x01 \x01(\x0e2\x1f.grpc.binarylog.v1.Address.TypeR\x04type\x12\x18\n" +
+ "\aaddress\x18\x02 \x01(\tR\aaddress\x12\x17\n" +
+ "\aip_port\x18\x03 \x01(\rR\x06ipPort\"E\n" +
+ "\x04Type\x12\x10\n" +
+ "\fTYPE_UNKNOWN\x10\x00\x12\r\n" +
+ "\tTYPE_IPV4\x10\x01\x12\r\n" +
+ "\tTYPE_IPV6\x10\x02\x12\r\n" +
+ "\tTYPE_UNIX\x10\x03B\\\n" +
+ "\x14io.grpc.binarylog.v1B\x0eBinaryLogProtoP\x01Z2google.golang.org/grpc/binarylog/grpc_binarylog_v1b\x06proto3"
var (
file_grpc_binlog_v1_binarylog_proto_rawDescOnce sync.Once
diff --git a/vendor/google.golang.org/grpc/clientconn.go b/vendor/google.golang.org/grpc/clientconn.go
index 4f350ca56..a3c315f2d 100644
--- a/vendor/google.golang.org/grpc/clientconn.go
+++ b/vendor/google.golang.org/grpc/clientconn.go
@@ -208,7 +208,7 @@ func NewClient(target string, opts ...DialOption) (conn *ClientConn, err error)
channelz.Infof(logger, cc.channelz, "Channel authority set to %q", cc.authority)
cc.csMgr = newConnectivityStateManager(cc.ctx, cc.channelz)
- cc.pickerWrapper = newPickerWrapper(cc.dopts.copts.StatsHandlers)
+ cc.pickerWrapper = newPickerWrapper()
cc.metricsRecorderList = stats.NewMetricsRecorderList(cc.dopts.copts.StatsHandlers)
@@ -456,7 +456,7 @@ func (cc *ClientConn) validateTransportCredentials() error {
func (cc *ClientConn) channelzRegistration(target string) {
parentChannel, _ := cc.dopts.channelzParent.(*channelz.Channel)
cc.channelz = channelz.RegisterChannel(parentChannel, target)
- cc.addTraceEvent("created")
+ cc.addTraceEvent(fmt.Sprintf("created for target %q", target))
}
// chainUnaryClientInterceptors chains all unary client interceptors into one.
@@ -689,22 +689,31 @@ func (cc *ClientConn) Connect() {
cc.mu.Unlock()
}
-// waitForResolvedAddrs blocks until the resolver has provided addresses or the
-// context expires. Returns nil unless the context expires first; otherwise
-// returns a status error based on the context.
-func (cc *ClientConn) waitForResolvedAddrs(ctx context.Context) error {
+// waitForResolvedAddrs blocks until the resolver provides addresses or the
+// context expires, whichever happens first.
+//
+// Error is nil unless the context expires first; otherwise returns a status
+// error based on the context.
+//
+// The returned boolean indicates whether it did block or not. If the
+// resolution has already happened once before, it returns false without
+// blocking. Otherwise, it wait for the resolution and return true if
+// resolution has succeeded or return false along with error if resolution has
+// failed.
+func (cc *ClientConn) waitForResolvedAddrs(ctx context.Context) (bool, error) {
// This is on the RPC path, so we use a fast path to avoid the
// more-expensive "select" below after the resolver has returned once.
if cc.firstResolveEvent.HasFired() {
- return nil
+ return false, nil
}
+ internal.NewStreamWaitingForResolver()
select {
case <-cc.firstResolveEvent.Done():
- return nil
+ return true, nil
case <-ctx.Done():
- return status.FromContextError(ctx.Err()).Err()
+ return false, status.FromContextError(ctx.Err()).Err()
case <-cc.ctx.Done():
- return ErrClientConnClosing
+ return false, ErrClientConnClosing
}
}
@@ -1067,13 +1076,6 @@ func (cc *ClientConn) healthCheckConfig() *healthCheckConfig {
return cc.sc.healthCheckConfig
}
-func (cc *ClientConn) getTransport(ctx context.Context, failfast bool, method string) (transport.ClientTransport, balancer.PickResult, error) {
- return cc.pickerWrapper.pick(ctx, failfast, balancer.PickInfo{
- Ctx: ctx,
- FullMethodName: method,
- })
-}
-
func (cc *ClientConn) applyServiceConfigAndBalancer(sc *ServiceConfig, configSelector iresolver.ConfigSelector) {
if sc == nil {
// should never reach here.
@@ -1822,7 +1824,7 @@ func (cc *ClientConn) initAuthority() error {
} else if auth, ok := cc.resolverBuilder.(resolver.AuthorityOverrider); ok {
cc.authority = auth.OverrideAuthority(cc.parsedTarget)
} else if strings.HasPrefix(endpoint, ":") {
- cc.authority = "localhost" + endpoint
+ cc.authority = "localhost" + encodeAuthority(endpoint)
} else {
cc.authority = encodeAuthority(endpoint)
}
diff --git a/vendor/google.golang.org/grpc/credentials/alts/alts.go b/vendor/google.golang.org/grpc/credentials/alts/alts.go
index afcdb8a0d..35539eb1a 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/alts.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/alts.go
@@ -133,10 +133,11 @@ func DefaultServerOptions() *ServerOptions {
// altsTC is the credentials required for authenticating a connection using ALTS.
// It implements credentials.TransportCredentials interface.
type altsTC struct {
- info *credentials.ProtocolInfo
- side core.Side
- accounts []string
- hsAddress string
+ info *credentials.ProtocolInfo
+ side core.Side
+ accounts []string
+ hsAddress string
+ boundAccessToken string
}
// NewClientCreds constructs a client-side ALTS TransportCredentials object.
@@ -198,6 +199,7 @@ func (g *altsTC) ClientHandshake(ctx context.Context, addr string, rawConn net.C
MaxRpcVersion: maxRPCVersion,
MinRpcVersion: minRPCVersion,
}
+ opts.BoundAccessToken = g.boundAccessToken
chs, err := handshaker.NewClientHandshaker(ctx, hsConn, rawConn, opts)
if err != nil {
return nil, nil, err
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go
index 1795d0c9e..46617132a 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go
@@ -54,11 +54,10 @@ func SliceForAppend(in []byte, n int) (head, tail []byte) {
func ParseFramedMsg(b []byte, maxLen uint32) ([]byte, []byte, error) {
// If the size field is not complete, return the provided buffer as
// remaining buffer.
- if len(b) < MsgLenFieldSize {
+ length, sufficientBytes := parseMessageLength(b)
+ if !sufficientBytes {
return nil, b, nil
}
- msgLenField := b[:MsgLenFieldSize]
- length := binary.LittleEndian.Uint32(msgLenField)
if length > maxLen {
return nil, nil, fmt.Errorf("received the frame length %d larger than the limit %d", length, maxLen)
}
@@ -68,3 +67,14 @@ func ParseFramedMsg(b []byte, maxLen uint32) ([]byte, []byte, error) {
}
return b[:MsgLenFieldSize+length], b[MsgLenFieldSize+length:], nil
}
+
+// parseMessageLength returns the message length based on frame header. It also
+// returns a boolean indicating if the buffer contains sufficient bytes to parse
+// the length header. If there are insufficient bytes, (0, false) is returned.
+func parseMessageLength(b []byte) (uint32, bool) {
+ if len(b) < MsgLenFieldSize {
+ return 0, false
+ }
+ msgLenField := b[:MsgLenFieldSize]
+ return binary.LittleEndian.Uint32(msgLenField), true
+}
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go
index f1ea7bb20..f9d2646d4 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go
@@ -31,14 +31,18 @@ import (
// ALTSRecordCrypto is the interface for gRPC ALTS record protocol.
type ALTSRecordCrypto interface {
- // Encrypt encrypts the plaintext and computes the tag (if any) of dst
- // and plaintext. dst and plaintext may fully overlap or not at all.
+ // Encrypt encrypts the plaintext, computes the tag (if any) of dst and
+ // plaintext, and appends the result to dst, returning the updated slice.
+ // dst and plaintext may fully overlap or not at all.
Encrypt(dst, plaintext []byte) ([]byte, error)
// EncryptionOverhead returns the tag size (if any) in bytes.
EncryptionOverhead() int
- // Decrypt decrypts ciphertext and verify the tag (if any). dst and
- // ciphertext may alias exactly or not at all. To reuse ciphertext's
- // storage for the decrypted output, use ciphertext[:0] as dst.
+ // Decrypt decrypts ciphertext and verifies the tag (if any). If successful,
+ // this function appends the resulting plaintext to dst, returning the
+ // updated slice. dst and ciphertext may alias exactly or not at all. To
+ // reuse ciphertext's storage for the decrypted output, use ciphertext[:0]
+ // as dst. Even if the function fails, the contents of dst, up to its
+ // capacity, may be overwritten.
Decrypt(dst, ciphertext []byte) ([]byte, error)
}
@@ -63,6 +67,8 @@ const (
// The maximum write buffer size. This *must* be multiple of
// altsRecordDefaultLength.
altsWriteBufferMaxSize = 512 * 1024 // 512KiB
+ // The initial buffer used to read from the network.
+ altsReadBufferInitialSize = 32 * 1024 // 32KiB
)
var (
@@ -83,7 +89,7 @@ type conn struct {
net.Conn
crypto ALTSRecordCrypto
// buf holds data that has been read from the connection and decrypted,
- // but has not yet been returned by Read.
+ // but has not yet been returned by Read. It is a sub-slice of protected.
buf []byte
payloadLengthLimit int
// protected holds data read from the network but have not yet been
@@ -111,21 +117,13 @@ func NewConn(c net.Conn, side core.Side, recordProtocol string, key []byte, prot
}
overhead := MsgLenFieldSize + msgTypeFieldSize + crypto.EncryptionOverhead()
payloadLengthLimit := altsRecordDefaultLength - overhead
- var protectedBuf []byte
- if protected == nil {
- // We pre-allocate protected to be of size
- // 2*altsRecordDefaultLength-1 during initialization. We only
- // read from the network into protected when protected does not
- // contain a complete frame, which is at most
- // altsRecordDefaultLength-1 (bytes). And we read at most
- // altsRecordDefaultLength (bytes) data into protected at one
- // time. Therefore, 2*altsRecordDefaultLength-1 is large enough
- // to buffer data read from the network.
- protectedBuf = make([]byte, 0, 2*altsRecordDefaultLength-1)
- } else {
- protectedBuf = make([]byte, len(protected))
- copy(protectedBuf, protected)
- }
+ // We pre-allocate protected to be of size 32KB during initialization.
+ // We increase the size of the buffer by the required amount if it can't
+ // hold a complete encrypted record.
+ protectedBuf := make([]byte, max(altsReadBufferInitialSize, len(protected)))
+ // Copy additional data from hanshaker service.
+ copy(protectedBuf, protected)
+ protectedBuf = protectedBuf[:len(protected)]
altsConn := &conn{
Conn: c,
@@ -162,11 +160,26 @@ func (p *conn) Read(b []byte) (n int, err error) {
// Check whether a complete frame has been received yet.
for len(framedMsg) == 0 {
if len(p.protected) == cap(p.protected) {
- tmp := make([]byte, len(p.protected), cap(p.protected)+altsRecordDefaultLength)
- copy(tmp, p.protected)
- p.protected = tmp
+ // We can parse the length header to know exactly how large
+ // the buffer needs to be to hold the entire frame.
+ length, didParse := parseMessageLength(p.protected)
+ if !didParse {
+ // The protected buffer is initialized with a capacity of
+ // larger than 4B. It should always hold the message length
+ // header.
+ panic(fmt.Sprintf("protected buffer length shorter than expected: %d vs %d", len(p.protected), MsgLenFieldSize))
+ }
+ oldProtectedBuf := p.protected
+ // The new buffer must be able to hold the message length header
+ // and the entire message.
+ requiredCapacity := int(length) + MsgLenFieldSize
+ p.protected = make([]byte, requiredCapacity)
+ // Copy the contents of the old buffer and set the length of the
+ // new buffer to the number of bytes already read.
+ copy(p.protected, oldProtectedBuf)
+ p.protected = p.protected[:len(oldProtectedBuf)]
}
- n, err = p.Conn.Read(p.protected[len(p.protected):min(cap(p.protected), len(p.protected)+altsRecordDefaultLength)])
+ n, err = p.Conn.Read(p.protected[len(p.protected):cap(p.protected)])
if err != nil {
return 0, err
}
@@ -185,6 +198,15 @@ func (p *conn) Read(b []byte) (n int, err error) {
}
ciphertext := msg[msgTypeFieldSize:]
+ // Decrypt directly into the buffer, avoiding a copy from p.buf if
+ // possible.
+ if len(b) >= len(ciphertext) {
+ dec, err := p.crypto.Decrypt(b[:0], ciphertext)
+ if err != nil {
+ return 0, err
+ }
+ return len(dec), nil
+ }
// Decrypt requires that if the dst and ciphertext alias, they
// must alias exactly. Code here used to use msg[:0], but msg
// starts MsgLenFieldSize+msgTypeFieldSize bytes earlier than
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go
index 50721f690..f4974b504 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go
@@ -88,6 +88,8 @@ type ClientHandshakerOptions struct {
TargetServiceAccounts []string
// RPCVersions specifies the gRPC versions accepted by the client.
RPCVersions *altspb.RpcProtocolVersions
+ // BoundAccessToken is a bound access token to be sent to the server for authentication.
+ BoundAccessToken string
}
// ServerHandshakerOptions contains the server handshaker options that can
@@ -195,7 +197,9 @@ func (h *altsHandshaker) ClientHandshake(ctx context.Context) (net.Conn, credent
},
},
}
-
+ if h.clientOpts.BoundAccessToken != "" {
+ req.GetClientStart().AccessToken = h.clientOpts.BoundAccessToken
+ }
conn, result, err := h.doHandshake(req)
if err != nil {
return nil, nil, err
@@ -294,11 +298,11 @@ func (h *altsHandshaker) doHandshake(req *altspb.HandshakerReq) (net.Conn, *alts
func (h *altsHandshaker) accessHandshakerService(req *altspb.HandshakerReq) (*altspb.HandshakerResp, error) {
if err := h.stream.Send(req); err != nil {
- return nil, err
+ return nil, fmt.Errorf("failed to send ALTS handshaker request: %w", err)
}
resp, err := h.stream.Recv()
if err != nil {
- return nil, err
+ return nil, fmt.Errorf("failed to receive ALTS handshaker response: %w", err)
}
return resp, nil
}
@@ -308,6 +312,7 @@ func (h *altsHandshaker) accessHandshakerService(req *altspb.HandshakerReq) (*al
// whatever received from the network and send it to the handshaker service.
func (h *altsHandshaker) processUntilDone(resp *altspb.HandshakerResp, extra []byte) (*altspb.HandshakerResult, []byte, error) {
var lastWriteTime time.Time
+ buf := make([]byte, frameLimit)
for {
if len(resp.OutFrames) > 0 {
lastWriteTime = time.Now()
@@ -318,7 +323,6 @@ func (h *altsHandshaker) processUntilDone(resp *altspb.HandshakerResp, extra []b
if resp.Result != nil {
return resp.Result, extra, nil
}
- buf := make([]byte, frameLimit)
n, err := h.conn.Read(buf)
if err != nil && err != io.EOF {
return nil, nil, err
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go
index e0a1afc11..2580995d9 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go
@@ -22,9 +22,12 @@ package service
import (
"sync"
+ "time"
grpc "google.golang.org/grpc"
"google.golang.org/grpc/credentials/insecure"
+ "google.golang.org/grpc/internal/envconfig"
+ "google.golang.org/grpc/keepalive"
)
var (
@@ -50,7 +53,17 @@ func Dial(hsAddress string) (*grpc.ClientConn, error) {
// Disable the service config to avoid unnecessary TXT record lookups that
// cause timeouts with some versions of systemd-resolved.
var err error
- hsConn, err = grpc.NewClient(hsAddress, grpc.WithTransportCredentials(insecure.NewCredentials()), grpc.WithDisableServiceConfig())
+ opts := []grpc.DialOption{
+ grpc.WithTransportCredentials(insecure.NewCredentials()),
+ grpc.WithDisableServiceConfig(),
+ }
+ if envconfig.ALTSHandshakerKeepaliveParams {
+ opts = append(opts, grpc.WithKeepaliveParams(keepalive.ClientParameters{
+ Timeout: 10 * time.Second,
+ Time: 10 * time.Minute,
+ }))
+ }
+ hsConn, err = grpc.NewClient(hsAddress, opts...)
if err != nil {
return nil, err
}
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go
index ac2957a4e..331dd6c84 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go
@@ -17,7 +17,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
-// protoc-gen-go v1.36.5
+// protoc-gen-go v1.36.6
// protoc v5.27.1
// source: grpc/gcp/altscontext.proto
@@ -139,52 +139,21 @@ func (x *AltsContext) GetPeerAttributes() map[string]string {
var File_grpc_gcp_altscontext_proto protoreflect.FileDescriptor
-var file_grpc_gcp_altscontext_proto_rawDesc = string([]byte{
- 0x0a, 0x1a, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x63,
- 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x08, 0x67, 0x72,
- 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x1a, 0x28, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70,
- 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72,
- 0x69, 0x74, 0x79, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f,
- 0x22, 0xf1, 0x03, 0x0a, 0x0b, 0x41, 0x6c, 0x74, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74,
- 0x12, 0x31, 0x0a, 0x14, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f,
- 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13,
- 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f,
- 0x63, 0x6f, 0x6c, 0x12, 0x27, 0x0a, 0x0f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72,
- 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x72, 0x65,
- 0x63, 0x6f, 0x72, 0x64, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x3e, 0x0a, 0x0e,
- 0x73, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x5f, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x18, 0x03,
- 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e,
- 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x52, 0x0d, 0x73,
- 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x30, 0x0a, 0x14,
- 0x70, 0x65, 0x65, 0x72, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, 0x63, 0x63,
- 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x70, 0x65, 0x65, 0x72,
- 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x32,
- 0x0a, 0x15, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f,
- 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, 0x6c,
- 0x6f, 0x63, 0x61, 0x6c, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x63, 0x63, 0x6f, 0x75,
- 0x6e, 0x74, 0x12, 0x49, 0x0a, 0x11, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76,
- 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e,
- 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74,
- 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x0f, 0x70, 0x65,
- 0x65, 0x72, 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x52, 0x0a,
- 0x0f, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73,
- 0x18, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63,
- 0x70, 0x2e, 0x41, 0x6c, 0x74, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x50, 0x65,
- 0x65, 0x72, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72,
- 0x79, 0x52, 0x0e, 0x70, 0x65, 0x65, 0x72, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65,
- 0x73, 0x1a, 0x41, 0x0a, 0x13, 0x50, 0x65, 0x65, 0x72, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75,
- 0x74, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18,
- 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61,
- 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65,
- 0x3a, 0x02, 0x38, 0x01, 0x42, 0x6c, 0x0a, 0x15, 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e,
- 0x61, 0x6c, 0x74, 0x73, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x42, 0x10, 0x41,
- 0x6c, 0x74, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50,
- 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67,
- 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x63, 0x72, 0x65, 0x64, 0x65, 0x6e,
- 0x74, 0x69, 0x61, 0x6c, 0x73, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72,
- 0x6e, 0x61, 0x6c, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x67,
- 0x63, 0x70, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33,
-})
+const file_grpc_gcp_altscontext_proto_rawDesc = "" +
+ "\n" +
+ "\x1agrpc/gcp/altscontext.proto\x12\bgrpc.gcp\x1a(grpc/gcp/transport_security_common.proto\"\xf1\x03\n" +
+ "\vAltsContext\x121\n" +
+ "\x14application_protocol\x18\x01 \x01(\tR\x13applicationProtocol\x12'\n" +
+ "\x0frecord_protocol\x18\x02 \x01(\tR\x0erecordProtocol\x12>\n" +
+ "\x0esecurity_level\x18\x03 \x01(\x0e2\x17.grpc.gcp.SecurityLevelR\rsecurityLevel\x120\n" +
+ "\x14peer_service_account\x18\x04 \x01(\tR\x12peerServiceAccount\x122\n" +
+ "\x15local_service_account\x18\x05 \x01(\tR\x13localServiceAccount\x12I\n" +
+ "\x11peer_rpc_versions\x18\x06 \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\x0fpeerRpcVersions\x12R\n" +
+ "\x0fpeer_attributes\x18\a \x03(\v2).grpc.gcp.AltsContext.PeerAttributesEntryR\x0epeerAttributes\x1aA\n" +
+ "\x13PeerAttributesEntry\x12\x10\n" +
+ "\x03key\x18\x01 \x01(\tR\x03key\x12\x14\n" +
+ "\x05value\x18\x02 \x01(\tR\x05value:\x028\x01Bl\n" +
+ "\x15io.grpc.alts.internalB\x10AltsContextProtoP\x01Z?google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcpb\x06proto3"
var (
file_grpc_gcp_altscontext_proto_rawDescOnce sync.Once
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go
index 12759ac28..6370b2a6d 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go
@@ -17,7 +17,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
-// protoc-gen-go v1.36.5
+// protoc-gen-go v1.36.6
// protoc v5.27.1
// source: grpc/gcp/handshaker.proto
@@ -331,9 +331,11 @@ type StartClientHandshakeReq struct {
// ALTS connections. The access token that should be used to authenticate to
// the peer. The access token MUST be strongly bound to the ALTS credentials
// used to establish the connection that the token is sent over.
- AccessToken string `protobuf:"bytes,11,opt,name=access_token,json=accessToken,proto3" json:"access_token,omitempty"`
- unknownFields protoimpl.UnknownFields
- sizeCache protoimpl.SizeCache
+ AccessToken string `protobuf:"bytes,11,opt,name=access_token,json=accessToken,proto3" json:"access_token,omitempty"`
+ // (Optional) Ordered transport protocol preferences supported by the client.
+ TransportProtocolPreferences *TransportProtocolPreferences `protobuf:"bytes,12,opt,name=transport_protocol_preferences,json=transportProtocolPreferences,proto3" json:"transport_protocol_preferences,omitempty"`
+ unknownFields protoimpl.UnknownFields
+ sizeCache protoimpl.SizeCache
}
func (x *StartClientHandshakeReq) Reset() {
@@ -443,6 +445,13 @@ func (x *StartClientHandshakeReq) GetAccessToken() string {
return ""
}
+func (x *StartClientHandshakeReq) GetTransportProtocolPreferences() *TransportProtocolPreferences {
+ if x != nil {
+ return x.TransportProtocolPreferences
+ }
+ return nil
+}
+
type ServerHandshakeParameters struct {
state protoimpl.MessageState `protogen:"open.v1"`
// The record protocols supported by the server, e.g.,
@@ -534,9 +543,11 @@ type StartServerHandshakeReq struct {
// (Optional) RPC protocol versions supported by the server.
RpcVersions *RpcProtocolVersions `protobuf:"bytes,6,opt,name=rpc_versions,json=rpcVersions,proto3" json:"rpc_versions,omitempty"`
// (Optional) Maximum frame size supported by the server.
- MaxFrameSize uint32 `protobuf:"varint,7,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"`
- unknownFields protoimpl.UnknownFields
- sizeCache protoimpl.SizeCache
+ MaxFrameSize uint32 `protobuf:"varint,7,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"`
+ // (Optional) Transport protocol preferences supported by the server.
+ TransportProtocolPreferences *TransportProtocolPreferences `protobuf:"bytes,8,opt,name=transport_protocol_preferences,json=transportProtocolPreferences,proto3" json:"transport_protocol_preferences,omitempty"`
+ unknownFields protoimpl.UnknownFields
+ sizeCache protoimpl.SizeCache
}
func (x *StartServerHandshakeReq) Reset() {
@@ -618,6 +629,13 @@ func (x *StartServerHandshakeReq) GetMaxFrameSize() uint32 {
return 0
}
+func (x *StartServerHandshakeReq) GetTransportProtocolPreferences() *TransportProtocolPreferences {
+ if x != nil {
+ return x.TransportProtocolPreferences
+ }
+ return nil
+}
+
type NextHandshakeMessageReq struct {
state protoimpl.MessageState `protogen:"open.v1"`
// Bytes in out_frames returned from the peer's HandshakerResp. It is possible
@@ -798,9 +816,11 @@ type HandshakerResult struct {
// The RPC protocol versions supported by the peer.
PeerRpcVersions *RpcProtocolVersions `protobuf:"bytes,7,opt,name=peer_rpc_versions,json=peerRpcVersions,proto3" json:"peer_rpc_versions,omitempty"`
// The maximum frame size of the peer.
- MaxFrameSize uint32 `protobuf:"varint,8,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"`
- unknownFields protoimpl.UnknownFields
- sizeCache protoimpl.SizeCache
+ MaxFrameSize uint32 `protobuf:"varint,8,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"`
+ // (Optional) The transport protocol negotiated for this connection.
+ TransportProtocol *NegotiatedTransportProtocol `protobuf:"bytes,9,opt,name=transport_protocol,json=transportProtocol,proto3" json:"transport_protocol,omitempty"`
+ unknownFields protoimpl.UnknownFields
+ sizeCache protoimpl.SizeCache
}
func (x *HandshakerResult) Reset() {
@@ -889,6 +909,13 @@ func (x *HandshakerResult) GetMaxFrameSize() uint32 {
return 0
}
+func (x *HandshakerResult) GetTransportProtocol() *NegotiatedTransportProtocol {
+ if x != nil {
+ return x.TransportProtocol
+ }
+ return nil
+}
+
type HandshakerStatus struct {
state protoimpl.MessageState `protogen:"open.v1"`
// The status code. This could be the gRPC status code.
@@ -1024,206 +1051,94 @@ func (x *HandshakerResp) GetStatus() *HandshakerStatus {
var File_grpc_gcp_handshaker_proto protoreflect.FileDescriptor
-var file_grpc_gcp_handshaker_proto_rawDesc = string([]byte{
- 0x0a, 0x19, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f, 0x68, 0x61, 0x6e, 0x64, 0x73,
- 0x68, 0x61, 0x6b, 0x65, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x08, 0x67, 0x72, 0x70,
- 0x63, 0x2e, 0x67, 0x63, 0x70, 0x1a, 0x28, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f,
- 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72, 0x69,
- 0x74, 0x79, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22,
- 0x74, 0x0a, 0x08, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x12, 0x1d, 0x0a, 0x0a, 0x69,
- 0x70, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52,
- 0x09, 0x69, 0x70, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f,
- 0x72, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x35,
- 0x0a, 0x08, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e,
- 0x32, 0x19, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x4e, 0x65, 0x74, 0x77,
- 0x6f, 0x72, 0x6b, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x52, 0x08, 0x70, 0x72, 0x6f,
- 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x22, 0xe8, 0x01, 0x0a, 0x08, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69,
- 0x74, 0x79, 0x12, 0x29, 0x0a, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, 0x63,
- 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x0e, 0x73,
- 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x1c, 0x0a,
- 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x48,
- 0x00, 0x52, 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x42, 0x0a, 0x0a, 0x61,
- 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32,
- 0x22, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65, 0x6e, 0x74,
- 0x69, 0x74, 0x79, 0x2e, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x45, 0x6e,
- 0x74, 0x72, 0x79, 0x52, 0x0a, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x1a,
- 0x3d, 0x0a, 0x0f, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x45, 0x6e, 0x74,
- 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52,
- 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20,
- 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x42, 0x10,
- 0x0a, 0x0e, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, 0x6f, 0x6e, 0x65, 0x6f, 0x66,
- 0x22, 0xfb, 0x04, 0x0a, 0x17, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74,
- 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x12, 0x5b, 0x0a, 0x1b,
- 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72, 0x69,
- 0x74, 0x79, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28,
- 0x0e, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e,
- 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x52, 0x19,
- 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74,
- 0x79, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x33, 0x0a, 0x15, 0x61, 0x70, 0x70,
- 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f,
- 0x6c, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63,
- 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x29,
- 0x0a, 0x10, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f,
- 0x6c, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64,
- 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x3f, 0x0a, 0x11, 0x74, 0x61, 0x72,
- 0x67, 0x65, 0x74, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x18, 0x04,
- 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e,
- 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x10, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
- 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x0e, 0x6c, 0x6f,
- 0x63, 0x61, 0x6c, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, 0x05, 0x20, 0x01,
- 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64,
- 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x49, 0x64, 0x65,
- 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x39, 0x0a, 0x0e, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x65,
- 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e,
- 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e,
- 0x74, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74,
- 0x12, 0x3b, 0x0a, 0x0f, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f,
- 0x69, 0x6e, 0x74, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63,
- 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x52, 0x0e, 0x72,
- 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x12, 0x1f, 0x0a,
- 0x0b, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x08, 0x20, 0x01,
- 0x28, 0x09, 0x52, 0x0a, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x40,
- 0x0a, 0x0c, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x09,
- 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e,
- 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69,
- 0x6f, 0x6e, 0x73, 0x52, 0x0b, 0x72, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73,
- 0x12, 0x24, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x5f, 0x73, 0x69,
- 0x7a, 0x65, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x46, 0x72, 0x61,
- 0x6d, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x26, 0x0a, 0x0c, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73,
- 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0x80, 0x01,
- 0x01, 0x52, 0x0b, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xaf,
- 0x01, 0x0a, 0x19, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61,
- 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x12, 0x29, 0x0a, 0x10,
- 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73,
- 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x50, 0x72,
- 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x3d, 0x0a, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c,
- 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28,
- 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65,
- 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0f, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x49, 0x64, 0x65, 0x6e,
- 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x12, 0x1e, 0x0a, 0x05, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18,
- 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0x80, 0x01, 0x01, 0x48, 0x00, 0x52, 0x05, 0x74, 0x6f,
- 0x6b, 0x65, 0x6e, 0x88, 0x01, 0x01, 0x42, 0x08, 0x0a, 0x06, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e,
- 0x22, 0xa5, 0x04, 0x0a, 0x17, 0x53, 0x74, 0x61, 0x72, 0x74, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72,
- 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x12, 0x33, 0x0a, 0x15,
- 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74,
- 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x61, 0x70, 0x70,
- 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c,
- 0x73, 0x12, 0x6d, 0x0a, 0x14, 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x5f, 0x70,
- 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32,
- 0x3a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x53, 0x74, 0x61, 0x72, 0x74,
- 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52,
- 0x65, 0x71, 0x2e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61,
- 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x13, 0x68, 0x61, 0x6e,
- 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73,
- 0x12, 0x19, 0x0a, 0x08, 0x69, 0x6e, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x03, 0x20, 0x01,
- 0x28, 0x0c, 0x52, 0x07, 0x69, 0x6e, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x0e, 0x6c,
- 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x18, 0x04, 0x20,
- 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45,
- 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x45, 0x6e,
- 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x12, 0x3b, 0x0a, 0x0f, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65,
- 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32,
- 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45, 0x6e, 0x64, 0x70, 0x6f,
- 0x69, 0x6e, 0x74, 0x52, 0x0e, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x45, 0x6e, 0x64, 0x70, 0x6f,
- 0x69, 0x6e, 0x74, 0x12, 0x40, 0x0a, 0x0c, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69,
- 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x72, 0x70, 0x63,
- 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c,
- 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x0b, 0x72, 0x70, 0x63, 0x56, 0x65, 0x72,
- 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x66, 0x72, 0x61,
- 0x6d, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x0c, 0x6d,
- 0x61, 0x78, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x1a, 0x6b, 0x0a, 0x18, 0x48,
- 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65,
- 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01,
- 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x39, 0x0a, 0x05, 0x76, 0x61, 0x6c,
- 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e,
- 0x67, 0x63, 0x70, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68,
- 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x52, 0x05, 0x76,
- 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x62, 0x0a, 0x17, 0x4e, 0x65, 0x78, 0x74,
- 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65,
- 0x52, 0x65, 0x71, 0x12, 0x19, 0x0a, 0x08, 0x69, 0x6e, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18,
- 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x07, 0x69, 0x6e, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x2c,
- 0x0a, 0x12, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x5f, 0x6c, 0x61, 0x74, 0x65, 0x6e, 0x63,
- 0x79, 0x5f, 0x6d, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x10, 0x6e, 0x65, 0x74, 0x77,
- 0x6f, 0x72, 0x6b, 0x4c, 0x61, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4d, 0x73, 0x22, 0xe5, 0x01, 0x0a,
- 0x0d, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x52, 0x65, 0x71, 0x12, 0x46,
- 0x0a, 0x0c, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01,
- 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e,
- 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x48, 0x61, 0x6e, 0x64, 0x73,
- 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x48, 0x00, 0x52, 0x0b, 0x63, 0x6c, 0x69, 0x65, 0x6e,
- 0x74, 0x53, 0x74, 0x61, 0x72, 0x74, 0x12, 0x46, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72,
- 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67,
- 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x53, 0x74, 0x61, 0x72, 0x74, 0x53, 0x65, 0x72,
- 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x48,
- 0x00, 0x52, 0x0b, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x53, 0x74, 0x61, 0x72, 0x74, 0x12, 0x37,
- 0x0a, 0x04, 0x6e, 0x65, 0x78, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67,
- 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x4e, 0x65, 0x78, 0x74, 0x48, 0x61, 0x6e, 0x64,
- 0x73, 0x68, 0x61, 0x6b, 0x65, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x65, 0x71, 0x48,
- 0x00, 0x52, 0x04, 0x6e, 0x65, 0x78, 0x74, 0x42, 0x0b, 0x0a, 0x09, 0x72, 0x65, 0x71, 0x5f, 0x6f,
- 0x6e, 0x65, 0x6f, 0x66, 0x22, 0x9a, 0x03, 0x0a, 0x10, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61,
- 0x6b, 0x65, 0x72, 0x52, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x12, 0x31, 0x0a, 0x14, 0x61, 0x70, 0x70,
- 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f,
- 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61,
- 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x27, 0x0a, 0x0f,
- 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18,
- 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x50, 0x72, 0x6f,
- 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x19, 0x0a, 0x08, 0x6b, 0x65, 0x79, 0x5f, 0x64, 0x61, 0x74,
- 0x61, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x07, 0x6b, 0x65, 0x79, 0x44, 0x61, 0x74, 0x61,
- 0x12, 0x37, 0x0a, 0x0d, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74,
- 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67,
- 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0c, 0x70, 0x65, 0x65,
- 0x72, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x39, 0x0a, 0x0e, 0x6c, 0x6f, 0x63,
- 0x61, 0x6c, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28,
- 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65,
- 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x49, 0x64, 0x65, 0x6e,
- 0x74, 0x69, 0x74, 0x79, 0x12, 0x2a, 0x0a, 0x11, 0x6b, 0x65, 0x65, 0x70, 0x5f, 0x63, 0x68, 0x61,
- 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x6f, 0x70, 0x65, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52,
- 0x0f, 0x6b, 0x65, 0x65, 0x70, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x4f, 0x70, 0x65, 0x6e,
- 0x12, 0x49, 0x0a, 0x11, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72,
- 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x72,
- 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63,
- 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x0f, 0x70, 0x65, 0x65, 0x72,
- 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x6d,
- 0x61, 0x78, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x08, 0x20,
- 0x01, 0x28, 0x0d, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x53, 0x69, 0x7a,
- 0x65, 0x22, 0x40, 0x0a, 0x10, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x53,
- 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x01, 0x20,
- 0x01, 0x28, 0x0d, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x64, 0x65, 0x74,
- 0x61, 0x69, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x64, 0x65, 0x74, 0x61,
- 0x69, 0x6c, 0x73, 0x22, 0xbe, 0x01, 0x0a, 0x0e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b,
- 0x65, 0x72, 0x52, 0x65, 0x73, 0x70, 0x12, 0x1d, 0x0a, 0x0a, 0x6f, 0x75, 0x74, 0x5f, 0x66, 0x72,
- 0x61, 0x6d, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x09, 0x6f, 0x75, 0x74, 0x46,
- 0x72, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0e, 0x62, 0x79, 0x74, 0x65, 0x73, 0x5f, 0x63,
- 0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x0d, 0x62,
- 0x79, 0x74, 0x65, 0x73, 0x43, 0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x12, 0x32, 0x0a, 0x06,
- 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67,
- 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b,
- 0x65, 0x72, 0x52, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x52, 0x06, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74,
- 0x12, 0x32, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b,
- 0x32, 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e, 0x64,
- 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74,
- 0x61, 0x74, 0x75, 0x73, 0x2a, 0x4a, 0x0a, 0x11, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b,
- 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x22, 0x0a, 0x1e, 0x48, 0x41, 0x4e,
- 0x44, 0x53, 0x48, 0x41, 0x4b, 0x45, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x43, 0x4f, 0x4c, 0x5f,
- 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a,
- 0x03, 0x54, 0x4c, 0x53, 0x10, 0x01, 0x12, 0x08, 0x0a, 0x04, 0x41, 0x4c, 0x54, 0x53, 0x10, 0x02,
- 0x2a, 0x45, 0x0a, 0x0f, 0x4e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x50, 0x72, 0x6f, 0x74, 0x6f,
- 0x63, 0x6f, 0x6c, 0x12, 0x20, 0x0a, 0x1c, 0x4e, 0x45, 0x54, 0x57, 0x4f, 0x52, 0x4b, 0x5f, 0x50,
- 0x52, 0x4f, 0x54, 0x4f, 0x43, 0x4f, 0x4c, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46,
- 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x54, 0x43, 0x50, 0x10, 0x01, 0x12, 0x07,
- 0x0a, 0x03, 0x55, 0x44, 0x50, 0x10, 0x02, 0x32, 0x5b, 0x0a, 0x11, 0x48, 0x61, 0x6e, 0x64, 0x73,
- 0x68, 0x61, 0x6b, 0x65, 0x72, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0x46, 0x0a, 0x0b,
- 0x44, 0x6f, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x12, 0x17, 0x2e, 0x67, 0x72,
- 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65,
- 0x72, 0x52, 0x65, 0x71, 0x1a, 0x18, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e,
- 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x52, 0x65, 0x73, 0x70, 0x22, 0x00,
- 0x28, 0x01, 0x30, 0x01, 0x42, 0x6b, 0x0a, 0x15, 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e,
- 0x61, 0x6c, 0x74, 0x73, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x42, 0x0f, 0x48,
- 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01,
- 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e,
- 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x63, 0x72, 0x65, 0x64, 0x65, 0x6e, 0x74,
- 0x69, 0x61, 0x6c, 0x73, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e,
- 0x61, 0x6c, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x67, 0x63,
- 0x70, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33,
-})
+const file_grpc_gcp_handshaker_proto_rawDesc = "" +
+ "\n" +
+ "\x19grpc/gcp/handshaker.proto\x12\bgrpc.gcp\x1a(grpc/gcp/transport_security_common.proto\"t\n" +
+ "\bEndpoint\x12\x1d\n" +
+ "\n" +
+ "ip_address\x18\x01 \x01(\tR\tipAddress\x12\x12\n" +
+ "\x04port\x18\x02 \x01(\x05R\x04port\x125\n" +
+ "\bprotocol\x18\x03 \x01(\x0e2\x19.grpc.gcp.NetworkProtocolR\bprotocol\"\xe8\x01\n" +
+ "\bIdentity\x12)\n" +
+ "\x0fservice_account\x18\x01 \x01(\tH\x00R\x0eserviceAccount\x12\x1c\n" +
+ "\bhostname\x18\x02 \x01(\tH\x00R\bhostname\x12B\n" +
+ "\n" +
+ "attributes\x18\x03 \x03(\v2\".grpc.gcp.Identity.AttributesEntryR\n" +
+ "attributes\x1a=\n" +
+ "\x0fAttributesEntry\x12\x10\n" +
+ "\x03key\x18\x01 \x01(\tR\x03key\x12\x14\n" +
+ "\x05value\x18\x02 \x01(\tR\x05value:\x028\x01B\x10\n" +
+ "\x0eidentity_oneof\"\xe9\x05\n" +
+ "\x17StartClientHandshakeReq\x12[\n" +
+ "\x1bhandshake_security_protocol\x18\x01 \x01(\x0e2\x1b.grpc.gcp.HandshakeProtocolR\x19handshakeSecurityProtocol\x123\n" +
+ "\x15application_protocols\x18\x02 \x03(\tR\x14applicationProtocols\x12)\n" +
+ "\x10record_protocols\x18\x03 \x03(\tR\x0frecordProtocols\x12?\n" +
+ "\x11target_identities\x18\x04 \x03(\v2\x12.grpc.gcp.IdentityR\x10targetIdentities\x129\n" +
+ "\x0elocal_identity\x18\x05 \x01(\v2\x12.grpc.gcp.IdentityR\rlocalIdentity\x129\n" +
+ "\x0elocal_endpoint\x18\x06 \x01(\v2\x12.grpc.gcp.EndpointR\rlocalEndpoint\x12;\n" +
+ "\x0fremote_endpoint\x18\a \x01(\v2\x12.grpc.gcp.EndpointR\x0eremoteEndpoint\x12\x1f\n" +
+ "\vtarget_name\x18\b \x01(\tR\n" +
+ "targetName\x12@\n" +
+ "\frpc_versions\x18\t \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\vrpcVersions\x12$\n" +
+ "\x0emax_frame_size\x18\n" +
+ " \x01(\rR\fmaxFrameSize\x12&\n" +
+ "\faccess_token\x18\v \x01(\tB\x03\x80\x01\x01R\vaccessToken\x12l\n" +
+ "\x1etransport_protocol_preferences\x18\f \x01(\v2&.grpc.gcp.TransportProtocolPreferencesR\x1ctransportProtocolPreferences\"\xaf\x01\n" +
+ "\x19ServerHandshakeParameters\x12)\n" +
+ "\x10record_protocols\x18\x01 \x03(\tR\x0frecordProtocols\x12=\n" +
+ "\x10local_identities\x18\x02 \x03(\v2\x12.grpc.gcp.IdentityR\x0flocalIdentities\x12\x1e\n" +
+ "\x05token\x18\x03 \x01(\tB\x03\x80\x01\x01H\x00R\x05token\x88\x01\x01B\b\n" +
+ "\x06_token\"\x93\x05\n" +
+ "\x17StartServerHandshakeReq\x123\n" +
+ "\x15application_protocols\x18\x01 \x03(\tR\x14applicationProtocols\x12m\n" +
+ "\x14handshake_parameters\x18\x02 \x03(\v2:.grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntryR\x13handshakeParameters\x12\x19\n" +
+ "\bin_bytes\x18\x03 \x01(\fR\ainBytes\x129\n" +
+ "\x0elocal_endpoint\x18\x04 \x01(\v2\x12.grpc.gcp.EndpointR\rlocalEndpoint\x12;\n" +
+ "\x0fremote_endpoint\x18\x05 \x01(\v2\x12.grpc.gcp.EndpointR\x0eremoteEndpoint\x12@\n" +
+ "\frpc_versions\x18\x06 \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\vrpcVersions\x12$\n" +
+ "\x0emax_frame_size\x18\a \x01(\rR\fmaxFrameSize\x12l\n" +
+ "\x1etransport_protocol_preferences\x18\b \x01(\v2&.grpc.gcp.TransportProtocolPreferencesR\x1ctransportProtocolPreferences\x1ak\n" +
+ "\x18HandshakeParametersEntry\x12\x10\n" +
+ "\x03key\x18\x01 \x01(\x05R\x03key\x129\n" +
+ "\x05value\x18\x02 \x01(\v2#.grpc.gcp.ServerHandshakeParametersR\x05value:\x028\x01\"b\n" +
+ "\x17NextHandshakeMessageReq\x12\x19\n" +
+ "\bin_bytes\x18\x01 \x01(\fR\ainBytes\x12,\n" +
+ "\x12network_latency_ms\x18\x02 \x01(\rR\x10networkLatencyMs\"\xe5\x01\n" +
+ "\rHandshakerReq\x12F\n" +
+ "\fclient_start\x18\x01 \x01(\v2!.grpc.gcp.StartClientHandshakeReqH\x00R\vclientStart\x12F\n" +
+ "\fserver_start\x18\x02 \x01(\v2!.grpc.gcp.StartServerHandshakeReqH\x00R\vserverStart\x127\n" +
+ "\x04next\x18\x03 \x01(\v2!.grpc.gcp.NextHandshakeMessageReqH\x00R\x04nextB\v\n" +
+ "\treq_oneof\"\xf0\x03\n" +
+ "\x10HandshakerResult\x121\n" +
+ "\x14application_protocol\x18\x01 \x01(\tR\x13applicationProtocol\x12'\n" +
+ "\x0frecord_protocol\x18\x02 \x01(\tR\x0erecordProtocol\x12\x19\n" +
+ "\bkey_data\x18\x03 \x01(\fR\akeyData\x127\n" +
+ "\rpeer_identity\x18\x04 \x01(\v2\x12.grpc.gcp.IdentityR\fpeerIdentity\x129\n" +
+ "\x0elocal_identity\x18\x05 \x01(\v2\x12.grpc.gcp.IdentityR\rlocalIdentity\x12*\n" +
+ "\x11keep_channel_open\x18\x06 \x01(\bR\x0fkeepChannelOpen\x12I\n" +
+ "\x11peer_rpc_versions\x18\a \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\x0fpeerRpcVersions\x12$\n" +
+ "\x0emax_frame_size\x18\b \x01(\rR\fmaxFrameSize\x12T\n" +
+ "\x12transport_protocol\x18\t \x01(\v2%.grpc.gcp.NegotiatedTransportProtocolR\x11transportProtocol\"@\n" +
+ "\x10HandshakerStatus\x12\x12\n" +
+ "\x04code\x18\x01 \x01(\rR\x04code\x12\x18\n" +
+ "\adetails\x18\x02 \x01(\tR\adetails\"\xbe\x01\n" +
+ "\x0eHandshakerResp\x12\x1d\n" +
+ "\n" +
+ "out_frames\x18\x01 \x01(\fR\toutFrames\x12%\n" +
+ "\x0ebytes_consumed\x18\x02 \x01(\rR\rbytesConsumed\x122\n" +
+ "\x06result\x18\x03 \x01(\v2\x1a.grpc.gcp.HandshakerResultR\x06result\x122\n" +
+ "\x06status\x18\x04 \x01(\v2\x1a.grpc.gcp.HandshakerStatusR\x06status*J\n" +
+ "\x11HandshakeProtocol\x12\"\n" +
+ "\x1eHANDSHAKE_PROTOCOL_UNSPECIFIED\x10\x00\x12\a\n" +
+ "\x03TLS\x10\x01\x12\b\n" +
+ "\x04ALTS\x10\x02*E\n" +
+ "\x0fNetworkProtocol\x12 \n" +
+ "\x1cNETWORK_PROTOCOL_UNSPECIFIED\x10\x00\x12\a\n" +
+ "\x03TCP\x10\x01\x12\a\n" +
+ "\x03UDP\x10\x022[\n" +
+ "\x11HandshakerService\x12F\n" +
+ "\vDoHandshake\x12\x17.grpc.gcp.HandshakerReq\x1a\x18.grpc.gcp.HandshakerResp\"\x00(\x010\x01Bk\n" +
+ "\x15io.grpc.alts.internalB\x0fHandshakerProtoP\x01Z?google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcpb\x06proto3"
var (
file_grpc_gcp_handshaker_proto_rawDescOnce sync.Once
@@ -1240,21 +1155,23 @@ func file_grpc_gcp_handshaker_proto_rawDescGZIP() []byte {
var file_grpc_gcp_handshaker_proto_enumTypes = make([]protoimpl.EnumInfo, 2)
var file_grpc_gcp_handshaker_proto_msgTypes = make([]protoimpl.MessageInfo, 12)
var file_grpc_gcp_handshaker_proto_goTypes = []any{
- (HandshakeProtocol)(0), // 0: grpc.gcp.HandshakeProtocol
- (NetworkProtocol)(0), // 1: grpc.gcp.NetworkProtocol
- (*Endpoint)(nil), // 2: grpc.gcp.Endpoint
- (*Identity)(nil), // 3: grpc.gcp.Identity
- (*StartClientHandshakeReq)(nil), // 4: grpc.gcp.StartClientHandshakeReq
- (*ServerHandshakeParameters)(nil), // 5: grpc.gcp.ServerHandshakeParameters
- (*StartServerHandshakeReq)(nil), // 6: grpc.gcp.StartServerHandshakeReq
- (*NextHandshakeMessageReq)(nil), // 7: grpc.gcp.NextHandshakeMessageReq
- (*HandshakerReq)(nil), // 8: grpc.gcp.HandshakerReq
- (*HandshakerResult)(nil), // 9: grpc.gcp.HandshakerResult
- (*HandshakerStatus)(nil), // 10: grpc.gcp.HandshakerStatus
- (*HandshakerResp)(nil), // 11: grpc.gcp.HandshakerResp
- nil, // 12: grpc.gcp.Identity.AttributesEntry
- nil, // 13: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry
- (*RpcProtocolVersions)(nil), // 14: grpc.gcp.RpcProtocolVersions
+ (HandshakeProtocol)(0), // 0: grpc.gcp.HandshakeProtocol
+ (NetworkProtocol)(0), // 1: grpc.gcp.NetworkProtocol
+ (*Endpoint)(nil), // 2: grpc.gcp.Endpoint
+ (*Identity)(nil), // 3: grpc.gcp.Identity
+ (*StartClientHandshakeReq)(nil), // 4: grpc.gcp.StartClientHandshakeReq
+ (*ServerHandshakeParameters)(nil), // 5: grpc.gcp.ServerHandshakeParameters
+ (*StartServerHandshakeReq)(nil), // 6: grpc.gcp.StartServerHandshakeReq
+ (*NextHandshakeMessageReq)(nil), // 7: grpc.gcp.NextHandshakeMessageReq
+ (*HandshakerReq)(nil), // 8: grpc.gcp.HandshakerReq
+ (*HandshakerResult)(nil), // 9: grpc.gcp.HandshakerResult
+ (*HandshakerStatus)(nil), // 10: grpc.gcp.HandshakerStatus
+ (*HandshakerResp)(nil), // 11: grpc.gcp.HandshakerResp
+ nil, // 12: grpc.gcp.Identity.AttributesEntry
+ nil, // 13: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry
+ (*RpcProtocolVersions)(nil), // 14: grpc.gcp.RpcProtocolVersions
+ (*TransportProtocolPreferences)(nil), // 15: grpc.gcp.TransportProtocolPreferences
+ (*NegotiatedTransportProtocol)(nil), // 16: grpc.gcp.NegotiatedTransportProtocol
}
var file_grpc_gcp_handshaker_proto_depIdxs = []int32{
1, // 0: grpc.gcp.Endpoint.protocol:type_name -> grpc.gcp.NetworkProtocol
@@ -1265,27 +1182,30 @@ var file_grpc_gcp_handshaker_proto_depIdxs = []int32{
2, // 5: grpc.gcp.StartClientHandshakeReq.local_endpoint:type_name -> grpc.gcp.Endpoint
2, // 6: grpc.gcp.StartClientHandshakeReq.remote_endpoint:type_name -> grpc.gcp.Endpoint
14, // 7: grpc.gcp.StartClientHandshakeReq.rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions
- 3, // 8: grpc.gcp.ServerHandshakeParameters.local_identities:type_name -> grpc.gcp.Identity
- 13, // 9: grpc.gcp.StartServerHandshakeReq.handshake_parameters:type_name -> grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry
- 2, // 10: grpc.gcp.StartServerHandshakeReq.local_endpoint:type_name -> grpc.gcp.Endpoint
- 2, // 11: grpc.gcp.StartServerHandshakeReq.remote_endpoint:type_name -> grpc.gcp.Endpoint
- 14, // 12: grpc.gcp.StartServerHandshakeReq.rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions
- 4, // 13: grpc.gcp.HandshakerReq.client_start:type_name -> grpc.gcp.StartClientHandshakeReq
- 6, // 14: grpc.gcp.HandshakerReq.server_start:type_name -> grpc.gcp.StartServerHandshakeReq
- 7, // 15: grpc.gcp.HandshakerReq.next:type_name -> grpc.gcp.NextHandshakeMessageReq
- 3, // 16: grpc.gcp.HandshakerResult.peer_identity:type_name -> grpc.gcp.Identity
- 3, // 17: grpc.gcp.HandshakerResult.local_identity:type_name -> grpc.gcp.Identity
- 14, // 18: grpc.gcp.HandshakerResult.peer_rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions
- 9, // 19: grpc.gcp.HandshakerResp.result:type_name -> grpc.gcp.HandshakerResult
- 10, // 20: grpc.gcp.HandshakerResp.status:type_name -> grpc.gcp.HandshakerStatus
- 5, // 21: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry.value:type_name -> grpc.gcp.ServerHandshakeParameters
- 8, // 22: grpc.gcp.HandshakerService.DoHandshake:input_type -> grpc.gcp.HandshakerReq
- 11, // 23: grpc.gcp.HandshakerService.DoHandshake:output_type -> grpc.gcp.HandshakerResp
- 23, // [23:24] is the sub-list for method output_type
- 22, // [22:23] is the sub-list for method input_type
- 22, // [22:22] is the sub-list for extension type_name
- 22, // [22:22] is the sub-list for extension extendee
- 0, // [0:22] is the sub-list for field type_name
+ 15, // 8: grpc.gcp.StartClientHandshakeReq.transport_protocol_preferences:type_name -> grpc.gcp.TransportProtocolPreferences
+ 3, // 9: grpc.gcp.ServerHandshakeParameters.local_identities:type_name -> grpc.gcp.Identity
+ 13, // 10: grpc.gcp.StartServerHandshakeReq.handshake_parameters:type_name -> grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry
+ 2, // 11: grpc.gcp.StartServerHandshakeReq.local_endpoint:type_name -> grpc.gcp.Endpoint
+ 2, // 12: grpc.gcp.StartServerHandshakeReq.remote_endpoint:type_name -> grpc.gcp.Endpoint
+ 14, // 13: grpc.gcp.StartServerHandshakeReq.rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions
+ 15, // 14: grpc.gcp.StartServerHandshakeReq.transport_protocol_preferences:type_name -> grpc.gcp.TransportProtocolPreferences
+ 4, // 15: grpc.gcp.HandshakerReq.client_start:type_name -> grpc.gcp.StartClientHandshakeReq
+ 6, // 16: grpc.gcp.HandshakerReq.server_start:type_name -> grpc.gcp.StartServerHandshakeReq
+ 7, // 17: grpc.gcp.HandshakerReq.next:type_name -> grpc.gcp.NextHandshakeMessageReq
+ 3, // 18: grpc.gcp.HandshakerResult.peer_identity:type_name -> grpc.gcp.Identity
+ 3, // 19: grpc.gcp.HandshakerResult.local_identity:type_name -> grpc.gcp.Identity
+ 14, // 20: grpc.gcp.HandshakerResult.peer_rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions
+ 16, // 21: grpc.gcp.HandshakerResult.transport_protocol:type_name -> grpc.gcp.NegotiatedTransportProtocol
+ 9, // 22: grpc.gcp.HandshakerResp.result:type_name -> grpc.gcp.HandshakerResult
+ 10, // 23: grpc.gcp.HandshakerResp.status:type_name -> grpc.gcp.HandshakerStatus
+ 5, // 24: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry.value:type_name -> grpc.gcp.ServerHandshakeParameters
+ 8, // 25: grpc.gcp.HandshakerService.DoHandshake:input_type -> grpc.gcp.HandshakerReq
+ 11, // 26: grpc.gcp.HandshakerService.DoHandshake:output_type -> grpc.gcp.HandshakerResp
+ 26, // [26:27] is the sub-list for method output_type
+ 25, // [25:26] is the sub-list for method input_type
+ 25, // [25:25] is the sub-list for extension type_name
+ 25, // [25:25] is the sub-list for extension extendee
+ 0, // [0:25] is the sub-list for field type_name
}
func init() { file_grpc_gcp_handshaker_proto_init() }
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go
index 34443b1d2..21cb01be6 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go
@@ -95,7 +95,7 @@ type HandshakerServiceServer interface {
type UnimplementedHandshakerServiceServer struct{}
func (UnimplementedHandshakerServiceServer) DoHandshake(grpc.BidiStreamingServer[HandshakerReq, HandshakerResp]) error {
- return status.Errorf(codes.Unimplemented, "method DoHandshake not implemented")
+ return status.Error(codes.Unimplemented, "method DoHandshake not implemented")
}
func (UnimplementedHandshakerServiceServer) mustEmbedUnimplementedHandshakerServiceServer() {}
func (UnimplementedHandshakerServiceServer) testEmbeddedByValue() {}
diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go
index 5d38a74c6..cf48193cb 100644
--- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go
+++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go
@@ -17,7 +17,7 @@
// Code generated by protoc-gen-go. DO NOT EDIT.
// versions:
-// protoc-gen-go v1.36.5
+// protoc-gen-go v1.36.6
// protoc v5.27.1
// source: grpc/gcp/transport_security_common.proto
@@ -144,6 +144,97 @@ func (x *RpcProtocolVersions) GetMinRpcVersion() *RpcProtocolVersions_Version {
return nil
}
+// The ordered list of protocols that the client wishes to use, or the set
+// that the server supports.
+type TransportProtocolPreferences struct {
+ state protoimpl.MessageState `protogen:"open.v1"`
+ TransportProtocol []string `protobuf:"bytes,1,rep,name=transport_protocol,json=transportProtocol,proto3" json:"transport_protocol,omitempty"`
+ unknownFields protoimpl.UnknownFields
+ sizeCache protoimpl.SizeCache
+}
+
+func (x *TransportProtocolPreferences) Reset() {
+ *x = TransportProtocolPreferences{}
+ mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1]
+ ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+ ms.StoreMessageInfo(mi)
+}
+
+func (x *TransportProtocolPreferences) String() string {
+ return protoimpl.X.MessageStringOf(x)
+}
+
+func (*TransportProtocolPreferences) ProtoMessage() {}
+
+func (x *TransportProtocolPreferences) ProtoReflect() protoreflect.Message {
+ mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1]
+ if x != nil {
+ ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+ if ms.LoadMessageInfo() == nil {
+ ms.StoreMessageInfo(mi)
+ }
+ return ms
+ }
+ return mi.MessageOf(x)
+}
+
+// Deprecated: Use TransportProtocolPreferences.ProtoReflect.Descriptor instead.
+func (*TransportProtocolPreferences) Descriptor() ([]byte, []int) {
+ return file_grpc_gcp_transport_security_common_proto_rawDescGZIP(), []int{1}
+}
+
+func (x *TransportProtocolPreferences) GetTransportProtocol() []string {
+ if x != nil {
+ return x.TransportProtocol
+ }
+ return nil
+}
+
+// The negotiated transport protocol.
+type NegotiatedTransportProtocol struct {
+ state protoimpl.MessageState `protogen:"open.v1"`
+ TransportProtocol string `protobuf:"bytes,1,opt,name=transport_protocol,json=transportProtocol,proto3" json:"transport_protocol,omitempty"`
+ unknownFields protoimpl.UnknownFields
+ sizeCache protoimpl.SizeCache
+}
+
+func (x *NegotiatedTransportProtocol) Reset() {
+ *x = NegotiatedTransportProtocol{}
+ mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[2]
+ ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+ ms.StoreMessageInfo(mi)
+}
+
+func (x *NegotiatedTransportProtocol) String() string {
+ return protoimpl.X.MessageStringOf(x)
+}
+
+func (*NegotiatedTransportProtocol) ProtoMessage() {}
+
+func (x *NegotiatedTransportProtocol) ProtoReflect() protoreflect.Message {
+ mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[2]
+ if x != nil {
+ ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
+ if ms.LoadMessageInfo() == nil {
+ ms.StoreMessageInfo(mi)
+ }
+ return ms
+ }
+ return mi.MessageOf(x)
+}
+
+// Deprecated: Use NegotiatedTransportProtocol.ProtoReflect.Descriptor instead.
+func (*NegotiatedTransportProtocol) Descriptor() ([]byte, []int) {
+ return file_grpc_gcp_transport_security_common_proto_rawDescGZIP(), []int{2}
+}
+
+func (x *NegotiatedTransportProtocol) GetTransportProtocol() string {
+ if x != nil {
+ return x.TransportProtocol
+ }
+ return ""
+}
+
// RPC version contains a major version and a minor version.
type RpcProtocolVersions_Version struct {
state protoimpl.MessageState `protogen:"open.v1"`
@@ -155,7 +246,7 @@ type RpcProtocolVersions_Version struct {
func (x *RpcProtocolVersions_Version) Reset() {
*x = RpcProtocolVersions_Version{}
- mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1]
+ mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[3]
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
ms.StoreMessageInfo(mi)
}
@@ -167,7 +258,7 @@ func (x *RpcProtocolVersions_Version) String() string {
func (*RpcProtocolVersions_Version) ProtoMessage() {}
func (x *RpcProtocolVersions_Version) ProtoReflect() protoreflect.Message {
- mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1]
+ mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[3]
if x != nil {
ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x))
if ms.LoadMessageInfo() == nil {
@@ -199,40 +290,24 @@ func (x *RpcProtocolVersions_Version) GetMinor() uint32 {
var File_grpc_gcp_transport_security_common_proto protoreflect.FileDescriptor
-var file_grpc_gcp_transport_security_common_proto_rawDesc = string([]byte{
- 0x0a, 0x28, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73,
- 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x5f, 0x63, 0x6f,
- 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x08, 0x67, 0x72, 0x70, 0x63,
- 0x2e, 0x67, 0x63, 0x70, 0x22, 0xea, 0x01, 0x0a, 0x13, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74,
- 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x4d, 0x0a, 0x0f,
- 0x6d, 0x61, 0x78, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18,
- 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70,
- 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73,
- 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x6d, 0x61,
- 0x78, 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x0f, 0x6d,
- 0x69, 0x6e, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02,
- 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e,
- 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69,
- 0x6f, 0x6e, 0x73, 0x2e, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x6d, 0x69, 0x6e,
- 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x1a, 0x35, 0x0a, 0x07, 0x56, 0x65,
- 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x18, 0x01,
- 0x20, 0x01, 0x28, 0x0d, 0x52, 0x05, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x12, 0x14, 0x0a, 0x05, 0x6d,
- 0x69, 0x6e, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x05, 0x6d, 0x69, 0x6e, 0x6f,
- 0x72, 0x2a, 0x51, 0x0a, 0x0d, 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x4c, 0x65, 0x76,
- 0x65, 0x6c, 0x12, 0x11, 0x0a, 0x0d, 0x53, 0x45, 0x43, 0x55, 0x52, 0x49, 0x54, 0x59, 0x5f, 0x4e,
- 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x12, 0x0a, 0x0e, 0x49, 0x4e, 0x54, 0x45, 0x47, 0x52, 0x49,
- 0x54, 0x59, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x01, 0x12, 0x19, 0x0a, 0x15, 0x49, 0x4e, 0x54,
- 0x45, 0x47, 0x52, 0x49, 0x54, 0x59, 0x5f, 0x41, 0x4e, 0x44, 0x5f, 0x50, 0x52, 0x49, 0x56, 0x41,
- 0x43, 0x59, 0x10, 0x02, 0x42, 0x78, 0x0a, 0x15, 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e,
- 0x61, 0x6c, 0x74, 0x73, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x42, 0x1c, 0x54,
- 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79,
- 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67,
- 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67,
- 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x63, 0x72, 0x65, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x61, 0x6c,
- 0x73, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x2f,
- 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x67, 0x63, 0x70, 0x62, 0x06,
- 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33,
-})
+const file_grpc_gcp_transport_security_common_proto_rawDesc = "" +
+ "\n" +
+ "(grpc/gcp/transport_security_common.proto\x12\bgrpc.gcp\"\xea\x01\n" +
+ "\x13RpcProtocolVersions\x12M\n" +
+ "\x0fmax_rpc_version\x18\x01 \x01(\v2%.grpc.gcp.RpcProtocolVersions.VersionR\rmaxRpcVersion\x12M\n" +
+ "\x0fmin_rpc_version\x18\x02 \x01(\v2%.grpc.gcp.RpcProtocolVersions.VersionR\rminRpcVersion\x1a5\n" +
+ "\aVersion\x12\x14\n" +
+ "\x05major\x18\x01 \x01(\rR\x05major\x12\x14\n" +
+ "\x05minor\x18\x02 \x01(\rR\x05minor\"M\n" +
+ "\x1cTransportProtocolPreferences\x12-\n" +
+ "\x12transport_protocol\x18\x01 \x03(\tR\x11transportProtocol\"L\n" +
+ "\x1bNegotiatedTransportProtocol\x12-\n" +
+ "\x12transport_protocol\x18\x01 \x01(\tR\x11transportProtocol*Q\n" +
+ "\rSecurityLevel\x12\x11\n" +
+ "\rSECURITY_NONE\x10\x00\x12\x12\n" +
+ "\x0eINTEGRITY_ONLY\x10\x01\x12\x19\n" +
+ "\x15INTEGRITY_AND_PRIVACY\x10\x02Bx\n" +
+ "\x15io.grpc.alts.internalB\x1cTransportSecurityCommonProtoP\x01Z?google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcpb\x06proto3"
var (
file_grpc_gcp_transport_security_common_proto_rawDescOnce sync.Once
@@ -247,15 +322,17 @@ func file_grpc_gcp_transport_security_common_proto_rawDescGZIP() []byte {
}
var file_grpc_gcp_transport_security_common_proto_enumTypes = make([]protoimpl.EnumInfo, 1)
-var file_grpc_gcp_transport_security_common_proto_msgTypes = make([]protoimpl.MessageInfo, 2)
+var file_grpc_gcp_transport_security_common_proto_msgTypes = make([]protoimpl.MessageInfo, 4)
var file_grpc_gcp_transport_security_common_proto_goTypes = []any{
- (SecurityLevel)(0), // 0: grpc.gcp.SecurityLevel
- (*RpcProtocolVersions)(nil), // 1: grpc.gcp.RpcProtocolVersions
- (*RpcProtocolVersions_Version)(nil), // 2: grpc.gcp.RpcProtocolVersions.Version
+ (SecurityLevel)(0), // 0: grpc.gcp.SecurityLevel
+ (*RpcProtocolVersions)(nil), // 1: grpc.gcp.RpcProtocolVersions
+ (*TransportProtocolPreferences)(nil), // 2: grpc.gcp.TransportProtocolPreferences
+ (*NegotiatedTransportProtocol)(nil), // 3: grpc.gcp.NegotiatedTransportProtocol
+ (*RpcProtocolVersions_Version)(nil), // 4: grpc.gcp.RpcProtocolVersions.Version
}
var file_grpc_gcp_transport_security_common_proto_depIdxs = []int32{
- 2, // 0: grpc.gcp.RpcProtocolVersions.max_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version
- 2, // 1: grpc.gcp.RpcProtocolVersions.min_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version
+ 4, // 0: grpc.gcp.RpcProtocolVersions.max_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version
+ 4, // 1: grpc.gcp.RpcProtocolVersions.min_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version
2, // [2:2] is the sub-list for method output_type
2, // [2:2] is the sub-list for method input_type
2, // [2:2] is the sub-list for extension type_name
@@ -274,7 +351,7 @@ func file_grpc_gcp_transport_security_common_proto_init() {
GoPackagePath: reflect.TypeOf(x{}).PkgPath(),
RawDescriptor: unsafe.Slice(unsafe.StringData(file_grpc_gcp_transport_security_common_proto_rawDesc), len(file_grpc_gcp_transport_security_common_proto_rawDesc)),
NumEnums: 1,
- NumMessages: 2,
+ NumMessages: 4,
NumExtensions: 0,
NumServices: 0,
},
diff --git a/vendor/google.golang.org/grpc/credentials/credentials.go b/vendor/google.golang.org/grpc/credentials/credentials.go
index 665e790bb..c8e337cdd 100644
--- a/vendor/google.golang.org/grpc/credentials/credentials.go
+++ b/vendor/google.golang.org/grpc/credentials/credentials.go
@@ -96,10 +96,11 @@ func (c CommonAuthInfo) GetCommonAuthInfo() CommonAuthInfo {
return c
}
-// ProtocolInfo provides information regarding the gRPC wire protocol version,
-// security protocol, security protocol version in use, server name, etc.
+// ProtocolInfo provides static information regarding transport credentials.
type ProtocolInfo struct {
// ProtocolVersion is the gRPC wire protocol version.
+ //
+ // Deprecated: this is unused by gRPC.
ProtocolVersion string
// SecurityProtocol is the security protocol in use.
SecurityProtocol string
@@ -109,7 +110,16 @@ type ProtocolInfo struct {
//
// Deprecated: please use Peer.AuthInfo.
SecurityVersion string
- // ServerName is the user-configured server name.
+ // ServerName is the user-configured server name. If set, this overrides
+ // the default :authority header used for all RPCs on the channel using the
+ // containing credentials, unless grpc.WithAuthority is set on the channel,
+ // in which case that setting will take precedence.
+ //
+ // This must be a valid `:authority` header according to
+ // [RFC3986](https://datatracker.ietf.org/doc/html/rfc3986#section-3.2).
+ //
+ // Deprecated: Users should use grpc.WithAuthority to override the authority
+ // on a channel instead of configuring the credentials.
ServerName string
}
@@ -120,6 +130,20 @@ type AuthInfo interface {
AuthType() string
}
+// AuthorityValidator validates the authority used to override the `:authority`
+// header. This is an optional interface that implementations of AuthInfo can
+// implement if they support per-RPC authority overrides. It is invoked when the
+// application attempts to override the HTTP/2 `:authority` header using the
+// CallAuthority call option.
+type AuthorityValidator interface {
+ // ValidateAuthority checks the authority value used to override the
+ // `:authority` header. The authority parameter is the override value
+ // provided by the application via the CallAuthority option. This value
+ // typically corresponds to the server hostname or endpoint the RPC is
+ // targeting. It returns non-nil error if the validation fails.
+ ValidateAuthority(authority string) error
+}
+
// ErrConnDispatched indicates that rawConn has been dispatched out of gRPC
// and the caller should not close rawConn.
var ErrConnDispatched = errors.New("credentials: rawConn is dispatched out of gRPC")
@@ -159,12 +183,17 @@ type TransportCredentials interface {
// Clone makes a copy of this TransportCredentials.
Clone() TransportCredentials
// OverrideServerName specifies the value used for the following:
+ //
// - verifying the hostname on the returned certificates
// - as SNI in the client's handshake to support virtual hosting
// - as the value for `:authority` header at stream creation time
//
- // Deprecated: use grpc.WithAuthority instead. Will be supported
- // throughout 1.x.
+ // The provided string should be a valid `:authority` header according to
+ // [RFC3986](https://datatracker.ietf.org/doc/html/rfc3986#section-3.2).
+ //
+ // Deprecated: this method is unused by gRPC. Users should use
+ // grpc.WithAuthority to override the authority on a channel instead of
+ // configuring the credentials.
OverrideServerName(string) error
}
@@ -207,14 +236,32 @@ type RequestInfo struct {
AuthInfo AuthInfo
}
+// requestInfoKey is a struct to be used as the key to store RequestInfo in a
+// context.
+type requestInfoKey struct{}
+
// RequestInfoFromContext extracts the RequestInfo from the context if it exists.
//
// This API is experimental.
func RequestInfoFromContext(ctx context.Context) (ri RequestInfo, ok bool) {
- ri, ok = icredentials.RequestInfoFromContext(ctx).(RequestInfo)
+ ri, ok = ctx.Value(requestInfoKey{}).(RequestInfo)
return ri, ok
}
+// NewContextWithRequestInfo creates a new context from ctx and attaches ri to it.
+//
+// This RequestInfo will be accessible via RequestInfoFromContext.
+//
+// Intended to be used from tests for PerRPCCredentials implementations (that
+// often need to check connection's SecurityLevel). Should not be used from
+// non-test code: the gRPC client already prepares a context with the correct
+// RequestInfo attached when calling PerRPCCredentials.GetRequestMetadata.
+//
+// This API is experimental.
+func NewContextWithRequestInfo(ctx context.Context, ri RequestInfo) context.Context {
+ return context.WithValue(ctx, requestInfoKey{}, ri)
+}
+
// ClientHandshakeInfo holds data to be passed to ClientHandshake. This makes
// it possible to pass arbitrary data to the handshaker from gRPC, resolver,
// balancer etc. Individual credential implementations control the actual
diff --git a/vendor/google.golang.org/grpc/credentials/insecure/insecure.go b/vendor/google.golang.org/grpc/credentials/insecure/insecure.go
index 4c805c644..93156c0f3 100644
--- a/vendor/google.golang.org/grpc/credentials/insecure/insecure.go
+++ b/vendor/google.golang.org/grpc/credentials/insecure/insecure.go
@@ -30,7 +30,7 @@ import (
// NewCredentials returns a credentials which disables transport security.
//
// Note that using this credentials with per-RPC credentials which require
-// transport security is incompatible and will cause grpc.Dial() to fail.
+// transport security is incompatible and will cause RPCs to fail.
func NewCredentials() credentials.TransportCredentials {
return insecureTC{}
}
@@ -71,6 +71,12 @@ func (info) AuthType() string {
return "insecure"
}
+// ValidateAuthority allows any value to be overridden for the :authority
+// header.
+func (info) ValidateAuthority(string) error {
+ return nil
+}
+
// insecureBundle implements an insecure bundle.
// An insecure bundle provides a thin wrapper around insecureTC to support
// the credentials.Bundle interface.
diff --git a/vendor/google.golang.org/grpc/credentials/tls.go b/vendor/google.golang.org/grpc/credentials/tls.go
index bd5fe22b6..8277be7d6 100644
--- a/vendor/google.golang.org/grpc/credentials/tls.go
+++ b/vendor/google.golang.org/grpc/credentials/tls.go
@@ -22,6 +22,7 @@ import (
"context"
"crypto/tls"
"crypto/x509"
+ "errors"
"fmt"
"net"
"net/url"
@@ -50,6 +51,21 @@ func (t TLSInfo) AuthType() string {
return "tls"
}
+// ValidateAuthority validates the provided authority being used to override the
+// :authority header by verifying it against the peer certificates. It returns a
+// non-nil error if the validation fails.
+func (t TLSInfo) ValidateAuthority(authority string) error {
+ var errs []error
+ for _, cert := range t.State.PeerCertificates {
+ var err error
+ if err = cert.VerifyHostname(authority); err == nil {
+ return nil
+ }
+ errs = append(errs, err)
+ }
+ return fmt.Errorf("credentials: invalid authority %q: %v", authority, errors.Join(errs...))
+}
+
// cipherSuiteLookup returns the string version of a TLS cipher suite ID.
func cipherSuiteLookup(cipherSuiteID uint16) string {
for _, s := range tls.CipherSuites() {
@@ -94,14 +110,14 @@ func (c tlsCreds) Info() ProtocolInfo {
func (c *tlsCreds) ClientHandshake(ctx context.Context, authority string, rawConn net.Conn) (_ net.Conn, _ AuthInfo, err error) {
// use local cfg to avoid clobbering ServerName if using multiple endpoints
cfg := credinternal.CloneTLSConfig(c.config)
- if cfg.ServerName == "" {
- serverName, _, err := net.SplitHostPort(authority)
- if err != nil {
- // If the authority had no host port or if the authority cannot be parsed, use it as-is.
- serverName = authority
- }
- cfg.ServerName = serverName
+
+ serverName, _, err := net.SplitHostPort(authority)
+ if err != nil {
+ // If the authority had no host port or if the authority cannot be parsed, use it as-is.
+ serverName = authority
}
+ cfg.ServerName = serverName
+
conn := tls.Client(rawConn, cfg)
errChannel := make(chan error, 1)
go func() {
@@ -243,9 +259,11 @@ func applyDefaults(c *tls.Config) *tls.Config {
// certificates to establish the identity of the client need to be included in
// the credentials (eg: for mTLS), use NewTLS instead, where a complete
// tls.Config can be specified.
-// serverNameOverride is for testing only. If set to a non empty string,
-// it will override the virtual host name of authority (e.g. :authority header
-// field) in requests.
+//
+// serverNameOverride is for testing only. If set to a non empty string, it will
+// override the virtual host name of authority (e.g. :authority header field) in
+// requests. Users should use grpc.WithAuthority passed to grpc.NewClient to
+// override the authority of the client instead.
func NewClientTLSFromCert(cp *x509.CertPool, serverNameOverride string) TransportCredentials {
return NewTLS(&tls.Config{ServerName: serverNameOverride, RootCAs: cp})
}
@@ -255,9 +273,11 @@ func NewClientTLSFromCert(cp *x509.CertPool, serverNameOverride string) Transpor
// certificates to establish the identity of the client need to be included in
// the credentials (eg: for mTLS), use NewTLS instead, where a complete
// tls.Config can be specified.
-// serverNameOverride is for testing only. If set to a non empty string,
-// it will override the virtual host name of authority (e.g. :authority header
-// field) in requests.
+//
+// serverNameOverride is for testing only. If set to a non empty string, it will
+// override the virtual host name of authority (e.g. :authority header field) in
+// requests. Users should use grpc.WithAuthority passed to grpc.NewClient to
+// override the authority of the client instead.
func NewClientTLSFromFile(certFile, serverNameOverride string) (TransportCredentials, error) {
b, err := os.ReadFile(certFile)
if err != nil {
diff --git a/vendor/google.golang.org/grpc/dialoptions.go b/vendor/google.golang.org/grpc/dialoptions.go
index 405a2ffeb..7a5ac2e7c 100644
--- a/vendor/google.golang.org/grpc/dialoptions.go
+++ b/vendor/google.golang.org/grpc/dialoptions.go
@@ -213,6 +213,7 @@ func WithReadBufferSize(s int) DialOption {
func WithInitialWindowSize(s int32) DialOption {
return newFuncDialOption(func(o *dialOptions) {
o.copts.InitialWindowSize = s
+ o.copts.StaticWindowSize = true
})
}
@@ -222,6 +223,26 @@ func WithInitialWindowSize(s int32) DialOption {
func WithInitialConnWindowSize(s int32) DialOption {
return newFuncDialOption(func(o *dialOptions) {
o.copts.InitialConnWindowSize = s
+ o.copts.StaticWindowSize = true
+ })
+}
+
+// WithStaticStreamWindowSize returns a DialOption which sets the initial
+// stream window size to the value provided and disables dynamic flow control.
+func WithStaticStreamWindowSize(s int32) DialOption {
+ return newFuncDialOption(func(o *dialOptions) {
+ o.copts.InitialWindowSize = s
+ o.copts.StaticWindowSize = true
+ })
+}
+
+// WithStaticConnWindowSize returns a DialOption which sets the initial
+// connection window size to the value provided and disables dynamic flow
+// control.
+func WithStaticConnWindowSize(s int32) DialOption {
+ return newFuncDialOption(func(o *dialOptions) {
+ o.copts.InitialConnWindowSize = s
+ o.copts.StaticWindowSize = true
})
}
@@ -360,7 +381,7 @@ func WithReturnConnectionError() DialOption {
//
// Note that using this DialOption with per-RPC credentials (through
// WithCredentialsBundle or WithPerRPCCredentials) which require transport
-// security is incompatible and will cause grpc.Dial() to fail.
+// security is incompatible and will cause RPCs to fail.
//
// Deprecated: use WithTransportCredentials and insecure.NewCredentials()
// instead. Will be supported throughout 1.x.
@@ -587,6 +608,8 @@ func WithChainStreamInterceptor(interceptors ...StreamClientInterceptor) DialOpt
// WithAuthority returns a DialOption that specifies the value to be used as the
// :authority pseudo-header and as the server name in authentication handshake.
+// This overrides all other ways of setting authority on the channel, but can be
+// overridden per-call by using grpc.CallAuthority.
func WithAuthority(a string) DialOption {
return newFuncDialOption(func(o *dialOptions) {
o.authority = a
diff --git a/vendor/google.golang.org/grpc/encoding/proto/proto.go b/vendor/google.golang.org/grpc/encoding/proto/proto.go
index ceec319dd..1ab874c7a 100644
--- a/vendor/google.golang.org/grpc/encoding/proto/proto.go
+++ b/vendor/google.golang.org/grpc/encoding/proto/proto.go
@@ -46,9 +46,25 @@ func (c *codecV2) Marshal(v any) (data mem.BufferSlice, err error) {
return nil, fmt.Errorf("proto: failed to marshal, message is %T, want proto.Message", v)
}
+ // Important: if we remove this Size call then we cannot use
+ // UseCachedSize in MarshalOptions below.
size := proto.Size(vv)
+
+ // MarshalOptions with UseCachedSize allows reusing the result from the
+ // previous Size call. This is safe here because:
+ //
+ // 1. We just computed the size.
+ // 2. We assume the message is not being mutated concurrently.
+ //
+ // Important: If the proto.Size call above is removed, using UseCachedSize
+ // becomes unsafe and may lead to incorrect marshaling.
+ //
+ // For more details, see the doc of UseCachedSize:
+ // https://pkg.go.dev/google.golang.org/protobuf/proto#MarshalOptions
+ marshalOptions := proto.MarshalOptions{UseCachedSize: true}
+
if mem.IsBelowBufferPoolingThreshold(size) {
- buf, err := proto.Marshal(vv)
+ buf, err := marshalOptions.Marshal(vv)
if err != nil {
return nil, err
}
@@ -56,7 +72,7 @@ func (c *codecV2) Marshal(v any) (data mem.BufferSlice, err error) {
} else {
pool := mem.DefaultBufferPool()
buf := pool.Get(size)
- if _, err := (proto.MarshalOptions{}).MarshalAppend((*buf)[:0], vv); err != nil {
+ if _, err := marshalOptions.MarshalAppend((*buf)[:0], vv); err != nil {
pool.Put(buf)
return nil, err
}
diff --git a/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go b/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go
index fbc1ca356..ba25b8988 100644
--- a/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go
+++ b/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go
@@ -223,15 +223,7 @@ func (gsb *Balancer) ExitIdle() {
// There is no need to protect this read with a mutex, as the write to the
// Balancer field happens in SwitchTo, which completes before this can be
// called.
- if ei, ok := balToUpdate.Balancer.(balancer.ExitIdler); ok {
- ei.ExitIdle()
- return
- }
- gsb.mu.Lock()
- defer gsb.mu.Unlock()
- for sc := range balToUpdate.subconns {
- sc.Connect()
- }
+ balToUpdate.ExitIdle()
}
// updateSubConnState forwards the update to the appropriate child.
diff --git a/vendor/google.golang.org/grpc/internal/buffer/unbounded.go b/vendor/google.golang.org/grpc/internal/buffer/unbounded.go
index 11f91668a..467392b8d 100644
--- a/vendor/google.golang.org/grpc/internal/buffer/unbounded.go
+++ b/vendor/google.golang.org/grpc/internal/buffer/unbounded.go
@@ -83,6 +83,7 @@ func (b *Unbounded) Load() {
default:
}
} else if b.closing && !b.closed {
+ b.closed = true
close(b.c)
}
}
diff --git a/vendor/google.golang.org/grpc/internal/channelz/trace.go b/vendor/google.golang.org/grpc/internal/channelz/trace.go
index 2bffe4777..3b7ba5966 100644
--- a/vendor/google.golang.org/grpc/internal/channelz/trace.go
+++ b/vendor/google.golang.org/grpc/internal/channelz/trace.go
@@ -194,7 +194,7 @@ func (r RefChannelType) String() string {
// If channelz is not turned ON, this will simply log the event descriptions.
func AddTraceEvent(l grpclog.DepthLoggerV2, e Entity, depth int, desc *TraceEvent) {
// Log only the trace description associated with the bottom most entity.
- d := fmt.Sprintf("[%s]%s", e, desc.Desc)
+ d := fmt.Sprintf("[%s] %s", e, desc.Desc)
switch desc.Severity {
case CtUnknown, CtInfo:
l.InfoDepth(depth+1, d)
diff --git a/vendor/google.golang.org/grpc/internal/credentials/credentials.go b/vendor/google.golang.org/grpc/internal/credentials/credentials.go
index 9deee7f65..48b22d9cf 100644
--- a/vendor/google.golang.org/grpc/internal/credentials/credentials.go
+++ b/vendor/google.golang.org/grpc/internal/credentials/credentials.go
@@ -20,20 +20,6 @@ import (
"context"
)
-// requestInfoKey is a struct to be used as the key to store RequestInfo in a
-// context.
-type requestInfoKey struct{}
-
-// NewRequestInfoContext creates a context with ri.
-func NewRequestInfoContext(ctx context.Context, ri any) context.Context {
- return context.WithValue(ctx, requestInfoKey{}, ri)
-}
-
-// RequestInfoFromContext extracts the RequestInfo from ctx.
-func RequestInfoFromContext(ctx context.Context) any {
- return ctx.Value(requestInfoKey{})
-}
-
// clientHandshakeInfoKey is a struct used as the key to store
// ClientHandshakeInfo in a context.
type clientHandshakeInfoKey struct{}
diff --git a/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go b/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go
index cc5713fd9..7e060f5ed 100644
--- a/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go
+++ b/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go
@@ -26,30 +26,32 @@ import (
)
var (
- // TXTErrIgnore is set if TXT errors should be ignored ("GRPC_GO_IGNORE_TXT_ERRORS" is not "false").
+ // EnableTXTServiceConfig is set if the DNS resolver should perform TXT
+ // lookups for service config ("GRPC_ENABLE_TXT_SERVICE_CONFIG" is not
+ // "false").
+ EnableTXTServiceConfig = boolFromEnv("GRPC_ENABLE_TXT_SERVICE_CONFIG", true)
+
+ // TXTErrIgnore is set if TXT errors should be ignored
+ // ("GRPC_GO_IGNORE_TXT_ERRORS" is not "false").
TXTErrIgnore = boolFromEnv("GRPC_GO_IGNORE_TXT_ERRORS", true)
+
// RingHashCap indicates the maximum ring size which defaults to 4096
// entries but may be overridden by setting the environment variable
// "GRPC_RING_HASH_CAP". This does not override the default bounds
// checking which NACKs configs specifying ring sizes > 8*1024*1024 (~8M).
RingHashCap = uint64FromEnv("GRPC_RING_HASH_CAP", 4096, 1, 8*1024*1024)
- // LeastRequestLB is set if we should support the least_request_experimental
- // LB policy, which can be enabled by setting the environment variable
- // "GRPC_EXPERIMENTAL_ENABLE_LEAST_REQUEST" to "true".
- LeastRequestLB = boolFromEnv("GRPC_EXPERIMENTAL_ENABLE_LEAST_REQUEST", false)
+
// ALTSMaxConcurrentHandshakes is the maximum number of concurrent ALTS
// handshakes that can be performed.
ALTSMaxConcurrentHandshakes = uint64FromEnv("GRPC_ALTS_MAX_CONCURRENT_HANDSHAKES", 100, 1, 100)
+
// EnforceALPNEnabled is set if TLS connections to servers with ALPN disabled
// should be rejected. The HTTP/2 protocol requires ALPN to be enabled, this
// option is present for backward compatibility. This option may be overridden
// by setting the environment variable "GRPC_ENFORCE_ALPN_ENABLED" to "true"
// or "false".
EnforceALPNEnabled = boolFromEnv("GRPC_ENFORCE_ALPN_ENABLED", true)
- // XDSFallbackSupport is the env variable that controls whether support for
- // xDS fallback is turned on. If this is unset or is false, only the first
- // xDS server in the list of server configs will be used.
- XDSFallbackSupport = boolFromEnv("GRPC_EXPERIMENTAL_XDS_FALLBACK", true)
+
// NewPickFirstEnabled is set if the new pickfirst leaf policy is to be used
// instead of the exiting pickfirst implementation. This can be disabled by
// setting the environment variable "GRPC_EXPERIMENTAL_ENABLE_NEW_PICK_FIRST"
@@ -69,6 +71,10 @@ var (
// to gRFC A76. It can be enabled by setting the environment variable
// "GRPC_EXPERIMENTAL_RING_HASH_SET_REQUEST_HASH_KEY" to "true".
RingHashSetRequestHashKey = boolFromEnv("GRPC_EXPERIMENTAL_RING_HASH_SET_REQUEST_HASH_KEY", false)
+
+ // ALTSHandshakerKeepaliveParams is set if we should add the
+ // KeepaliveParams when dial the ALTS handshaker service.
+ ALTSHandshakerKeepaliveParams = boolFromEnv("GRPC_EXPERIMENTAL_ALTS_HANDSHAKER_KEEPALIVE_PARAMS", false)
)
func boolFromEnv(envVar string, def bool) bool {
diff --git a/vendor/google.golang.org/grpc/internal/envconfig/xds.go b/vendor/google.golang.org/grpc/internal/envconfig/xds.go
index 2eb97f832..b1f883bca 100644
--- a/vendor/google.golang.org/grpc/internal/envconfig/xds.go
+++ b/vendor/google.golang.org/grpc/internal/envconfig/xds.go
@@ -63,4 +63,15 @@ var (
// For more details, see:
// https://github.com/grpc/proposal/blob/master/A82-xds-system-root-certs.md.
XDSSystemRootCertsEnabled = boolFromEnv("GRPC_EXPERIMENTAL_XDS_SYSTEM_ROOT_CERTS", false)
+
+ // XDSSPIFFEEnabled controls if SPIFFE Bundle Maps can be used as roots of
+ // trust. For more details, see:
+ // https://github.com/grpc/proposal/blob/master/A87-mtls-spiffe-support.md
+ XDSSPIFFEEnabled = boolFromEnv("GRPC_EXPERIMENTAL_XDS_MTLS_SPIFFE", false)
+
+ // XDSHTTPConnectEnabled is true if gRPC should parse custom Metadata
+ // configuring use of an HTTP CONNECT proxy via xDS from cluster resources.
+ // For more details, see:
+ // https://github.com/grpc/proposal/blob/master/A86-xds-http-connect.md
+ XDSHTTPConnectEnabled = boolFromEnv("GRPC_EXPERIMENTAL_XDS_HTTP_CONNECT", false)
)
diff --git a/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go b/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go
index 8e8e86128..9b6d8a1fa 100644
--- a/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go
+++ b/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go
@@ -80,25 +80,11 @@ func (cs *CallbackSerializer) ScheduleOr(f func(ctx context.Context), onFailure
func (cs *CallbackSerializer) run(ctx context.Context) {
defer close(cs.done)
- // TODO: when Go 1.21 is the oldest supported version, this loop and Close
- // can be replaced with:
- //
- // context.AfterFunc(ctx, cs.callbacks.Close)
- for ctx.Err() == nil {
- select {
- case <-ctx.Done():
- // Do nothing here. Next iteration of the for loop will not happen,
- // since ctx.Err() would be non-nil.
- case cb := <-cs.callbacks.Get():
- cs.callbacks.Load()
- cb.(func(context.Context))(ctx)
- }
- }
-
- // Close the buffer to prevent new callbacks from being added.
- cs.callbacks.Close()
+ // Close the buffer when the context is canceled
+ // to prevent new callbacks from being added.
+ context.AfterFunc(ctx, cs.callbacks.Close)
- // Run all pending callbacks.
+ // Run all callbacks.
for cb := range cs.callbacks.Get() {
cs.callbacks.Load()
cb.(func(context.Context))(ctx)
diff --git a/vendor/google.golang.org/grpc/internal/grpcsync/event.go b/vendor/google.golang.org/grpc/internal/grpcsync/event.go
index fbe697c37..d788c2493 100644
--- a/vendor/google.golang.org/grpc/internal/grpcsync/event.go
+++ b/vendor/google.golang.org/grpc/internal/grpcsync/event.go
@@ -21,28 +21,25 @@
package grpcsync
import (
- "sync"
"sync/atomic"
)
// Event represents a one-time event that may occur in the future.
type Event struct {
- fired int32
+ fired atomic.Bool
c chan struct{}
- o sync.Once
}
// Fire causes e to complete. It is safe to call multiple times, and
// concurrently. It returns true iff this call to Fire caused the signaling
-// channel returned by Done to close.
+// channel returned by Done to close. If Fire returns false, it is possible
+// the Done channel has not been closed yet.
func (e *Event) Fire() bool {
- ret := false
- e.o.Do(func() {
- atomic.StoreInt32(&e.fired, 1)
+ if e.fired.CompareAndSwap(false, true) {
close(e.c)
- ret = true
- })
- return ret
+ return true
+ }
+ return false
}
// Done returns a channel that will be closed when Fire is called.
@@ -52,7 +49,7 @@ func (e *Event) Done() <-chan struct{} {
// HasFired returns true if Fire has been called.
func (e *Event) HasFired() bool {
- return atomic.LoadInt32(&e.fired) == 1
+ return e.fired.Load()
}
// NewEvent returns a new, ready-to-use Event.
diff --git a/vendor/google.golang.org/grpc/internal/internal.go b/vendor/google.golang.org/grpc/internal/internal.go
index 2ce012cda..2699223a2 100644
--- a/vendor/google.golang.org/grpc/internal/internal.go
+++ b/vendor/google.golang.org/grpc/internal/internal.go
@@ -182,35 +182,6 @@ var (
// other features, including the CSDS service.
NewXDSResolverWithClientForTesting any // func(xdsclient.XDSClient) (resolver.Builder, error)
- // RegisterRLSClusterSpecifierPluginForTesting registers the RLS Cluster
- // Specifier Plugin for testing purposes, regardless of the XDSRLS environment
- // variable.
- //
- // TODO: Remove this function once the RLS env var is removed.
- RegisterRLSClusterSpecifierPluginForTesting func()
-
- // UnregisterRLSClusterSpecifierPluginForTesting unregisters the RLS Cluster
- // Specifier Plugin for testing purposes. This is needed because there is no way
- // to unregister the RLS Cluster Specifier Plugin after registering it solely
- // for testing purposes using RegisterRLSClusterSpecifierPluginForTesting().
- //
- // TODO: Remove this function once the RLS env var is removed.
- UnregisterRLSClusterSpecifierPluginForTesting func()
-
- // RegisterRBACHTTPFilterForTesting registers the RBAC HTTP Filter for testing
- // purposes, regardless of the RBAC environment variable.
- //
- // TODO: Remove this function once the RBAC env var is removed.
- RegisterRBACHTTPFilterForTesting func()
-
- // UnregisterRBACHTTPFilterForTesting unregisters the RBAC HTTP Filter for
- // testing purposes. This is needed because there is no way to unregister the
- // HTTP Filter after registering it solely for testing purposes using
- // RegisterRBACHTTPFilterForTesting().
- //
- // TODO: Remove this function once the RBAC env var is removed.
- UnregisterRBACHTTPFilterForTesting func()
-
// ORCAAllowAnyMinReportingInterval is for examples/orca use ONLY.
ORCAAllowAnyMinReportingInterval any // func(so *orca.ServiceOptions)
@@ -266,6 +237,13 @@ var (
TimeAfterFunc = func(d time.Duration, f func()) Timer {
return time.AfterFunc(d, f)
}
+
+ // NewStreamWaitingForResolver is a test hook that is triggered when a
+ // new stream blocks while waiting for name resolution. This can be
+ // used in tests to synchronize resolver updates and avoid race conditions.
+ // When set, the function will be called before the stream enters
+ // the blocking state.
+ NewStreamWaitingForResolver = func() {}
)
// HealthChecker defines the signature of the client-side LB channel health
diff --git a/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go b/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go
index c0e227577..20b8fb098 100644
--- a/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go
+++ b/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go
@@ -186,23 +186,15 @@ func (r *delegatingResolver) Close() {
r.proxyResolver = nil
}
-func networkTypeFromAddr(addr resolver.Address) string {
- networkType, ok := networktype.Get(addr)
- if !ok {
- networkType, _ = transport.ParseDialTarget(addr.Addr)
- }
- return networkType
-}
-
-func isTCPAddressPresent(state *resolver.State) bool {
+func needsProxyResolver(state *resolver.State) bool {
for _, addr := range state.Addresses {
- if networkType := networkTypeFromAddr(addr); networkType == "tcp" {
+ if !skipProxy(addr) {
return true
}
}
for _, endpoint := range state.Endpoints {
for _, addr := range endpoint.Addresses {
- if networktype := networkTypeFromAddr(addr); networktype == "tcp" {
+ if !skipProxy(addr) {
return true
}
}
@@ -210,6 +202,29 @@ func isTCPAddressPresent(state *resolver.State) bool {
return false
}
+func skipProxy(address resolver.Address) bool {
+ // Avoid proxy when network is not tcp.
+ networkType, ok := networktype.Get(address)
+ if !ok {
+ networkType, _ = transport.ParseDialTarget(address.Addr)
+ }
+ if networkType != "tcp" {
+ return true
+ }
+
+ req := &http.Request{URL: &url.URL{
+ Scheme: "https",
+ Host: address.Addr,
+ }}
+ // Avoid proxy when address included in `NO_PROXY` environment variable or
+ // fails to get the proxy address.
+ url, err := HTTPSProxyFromEnvironment(req)
+ if err != nil || url == nil {
+ return true
+ }
+ return false
+}
+
// updateClientConnStateLocked constructs a combined list of addresses by
// pairing each proxy address with every target address of type TCP. For each
// pair, it creates a new [resolver.Address] using the proxy address and
@@ -240,8 +255,7 @@ func (r *delegatingResolver) updateClientConnStateLocked() error {
}
var addresses []resolver.Address
for _, targetAddr := range (*r.targetResolverState).Addresses {
- // Avoid proxy when network is not tcp.
- if networkType := networkTypeFromAddr(targetAddr); networkType != "tcp" {
+ if skipProxy(targetAddr) {
addresses = append(addresses, targetAddr)
continue
}
@@ -259,7 +273,7 @@ func (r *delegatingResolver) updateClientConnStateLocked() error {
var addrs []resolver.Address
for _, targetAddr := range endpt.Addresses {
// Avoid proxy when network is not tcp.
- if networkType := networkTypeFromAddr(targetAddr); networkType != "tcp" {
+ if skipProxy(targetAddr) {
addrs = append(addrs, targetAddr)
continue
}
@@ -340,9 +354,10 @@ func (r *delegatingResolver) updateTargetResolverState(state resolver.State) err
logger.Infof("Addresses received from target resolver: %v", state.Addresses)
}
r.targetResolverState = &state
- // If no addresses returned by resolver have network type as tcp , do not
- // wait for proxy update.
- if !isTCPAddressPresent(r.targetResolverState) {
+ // If all addresses returned by the target resolver have a non-TCP network
+ // type, or are listed in the `NO_PROXY` environment variable, do not wait
+ // for proxy update.
+ if !needsProxyResolver(r.targetResolverState) {
return r.cc.UpdateState(*r.targetResolverState)
}
diff --git a/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go b/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go
index ba5c5a95d..ada5251cf 100644
--- a/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go
+++ b/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go
@@ -132,13 +132,13 @@ func (b *dnsBuilder) Build(target resolver.Target, cc resolver.ClientConn, opts
// DNS address (non-IP).
ctx, cancel := context.WithCancel(context.Background())
d := &dnsResolver{
- host: host,
- port: port,
- ctx: ctx,
- cancel: cancel,
- cc: cc,
- rn: make(chan struct{}, 1),
- disableServiceConfig: opts.DisableServiceConfig,
+ host: host,
+ port: port,
+ ctx: ctx,
+ cancel: cancel,
+ cc: cc,
+ rn: make(chan struct{}, 1),
+ enableServiceConfig: envconfig.EnableTXTServiceConfig && !opts.DisableServiceConfig,
}
d.resolver, err = internal.NewNetResolver(target.URL.Host)
@@ -181,8 +181,8 @@ type dnsResolver struct {
// finishes, race detector sometimes will warn lookup (READ the lookup
// function pointers) inside watcher() goroutine has data race with
// replaceNetFunc (WRITE the lookup function pointers).
- wg sync.WaitGroup
- disableServiceConfig bool
+ wg sync.WaitGroup
+ enableServiceConfig bool
}
// ResolveNow invoke an immediate resolution of the target that this
@@ -346,7 +346,7 @@ func (d *dnsResolver) lookup() (*resolver.State, error) {
if len(srv) > 0 {
state = grpclbstate.Set(state, &grpclbstate.State{BalancerAddresses: srv})
}
- if !d.disableServiceConfig {
+ if d.enableServiceConfig {
state.ServiceConfig = d.lookupTXT(ctx)
}
return &state, nil
diff --git a/vendor/google.golang.org/grpc/internal/status/status.go b/vendor/google.golang.org/grpc/internal/status/status.go
index 1186f1e9a..aad171cd0 100644
--- a/vendor/google.golang.org/grpc/internal/status/status.go
+++ b/vendor/google.golang.org/grpc/internal/status/status.go
@@ -236,3 +236,11 @@ func IsRestrictedControlPlaneCode(s *Status) bool {
}
return false
}
+
+// RawStatusProto returns the internal protobuf message for use by gRPC itself.
+func RawStatusProto(s *Status) *spb.Status {
+ if s == nil {
+ return nil
+ }
+ return s.s
+}
diff --git a/vendor/google.golang.org/grpc/internal/transport/controlbuf.go b/vendor/google.golang.org/grpc/internal/transport/controlbuf.go
index ef72fbb3a..a2831e5d0 100644
--- a/vendor/google.golang.org/grpc/internal/transport/controlbuf.go
+++ b/vendor/google.golang.org/grpc/internal/transport/controlbuf.go
@@ -40,6 +40,13 @@ var updateHeaderTblSize = func(e *hpack.Encoder, v uint32) {
e.SetMaxDynamicTableSizeLimit(v)
}
+// itemNodePool is used to reduce heap allocations.
+var itemNodePool = sync.Pool{
+ New: func() any {
+ return &itemNode{}
+ },
+}
+
type itemNode struct {
it any
next *itemNode
@@ -51,7 +58,9 @@ type itemList struct {
}
func (il *itemList) enqueue(i any) {
- n := &itemNode{it: i}
+ n := itemNodePool.Get().(*itemNode)
+ n.next = nil
+ n.it = i
if il.tail == nil {
il.head, il.tail = n, n
return
@@ -71,7 +80,9 @@ func (il *itemList) dequeue() any {
return nil
}
i := il.head.it
+ temp := il.head
il.head = il.head.next
+ itemNodePool.Put(temp)
if il.head == nil {
il.tail = nil
}
@@ -146,10 +157,11 @@ type earlyAbortStream struct {
func (*earlyAbortStream) isTransportResponseFrame() bool { return false }
type dataFrame struct {
- streamID uint32
- endStream bool
- h []byte
- reader mem.Reader
+ streamID uint32
+ endStream bool
+ h []byte
+ data mem.BufferSlice
+ processing bool
// onEachWrite is called every time
// a part of data is written out.
onEachWrite func()
@@ -234,6 +246,7 @@ type outStream struct {
itl *itemList
bytesOutStanding int
wq *writeQuota
+ reader mem.Reader
next *outStream
prev *outStream
@@ -461,7 +474,9 @@ func (c *controlBuffer) finish() {
v.onOrphaned(ErrConnClosing)
}
case *dataFrame:
- _ = v.reader.Close()
+ if !v.processing {
+ v.data.Free()
+ }
}
}
@@ -650,10 +665,11 @@ func (l *loopyWriter) incomingSettingsHandler(s *incomingSettings) error {
func (l *loopyWriter) registerStreamHandler(h *registerStream) {
str := &outStream{
- id: h.streamID,
- state: empty,
- itl: &itemList{},
- wq: h.wq,
+ id: h.streamID,
+ state: empty,
+ itl: &itemList{},
+ wq: h.wq,
+ reader: mem.BufferSlice{}.Reader(),
}
l.estdStreams[h.streamID] = str
}
@@ -685,10 +701,11 @@ func (l *loopyWriter) headerHandler(h *headerFrame) error {
}
// Case 2: Client wants to originate stream.
str := &outStream{
- id: h.streamID,
- state: empty,
- itl: &itemList{},
- wq: h.wq,
+ id: h.streamID,
+ state: empty,
+ itl: &itemList{},
+ wq: h.wq,
+ reader: mem.BufferSlice{}.Reader(),
}
return l.originateStream(str, h)
}
@@ -790,10 +807,13 @@ func (l *loopyWriter) cleanupStreamHandler(c *cleanupStream) error {
// a RST_STREAM before stream initialization thus the stream might
// not be established yet.
delete(l.estdStreams, c.streamID)
+ str.reader.Close()
str.deleteSelf()
for head := str.itl.dequeueAll(); head != nil; head = head.next {
if df, ok := head.it.(*dataFrame); ok {
- _ = df.reader.Close()
+ if !df.processing {
+ df.data.Free()
+ }
}
}
}
@@ -928,7 +948,13 @@ func (l *loopyWriter) processData() (bool, error) {
if str == nil {
return true, nil
}
+ reader := str.reader
dataItem := str.itl.peek().(*dataFrame) // Peek at the first data item this stream.
+ if !dataItem.processing {
+ dataItem.processing = true
+ str.reader.Reset(dataItem.data)
+ dataItem.data.Free()
+ }
// A data item is represented by a dataFrame, since it later translates into
// multiple HTTP2 data frames.
// Every dataFrame has two buffers; h that keeps grpc-message header and data
@@ -936,13 +962,13 @@ func (l *loopyWriter) processData() (bool, error) {
// from data is copied to h to make as big as the maximum possible HTTP2 frame
// size.
- if len(dataItem.h) == 0 && dataItem.reader.Remaining() == 0 { // Empty data frame
+ if len(dataItem.h) == 0 && reader.Remaining() == 0 { // Empty data frame
// Client sends out empty data frame with endStream = true
if err := l.framer.fr.WriteData(dataItem.streamID, dataItem.endStream, nil); err != nil {
return false, err
}
str.itl.dequeue() // remove the empty data item from stream
- _ = dataItem.reader.Close()
+ _ = reader.Close()
if str.itl.isEmpty() {
str.state = empty
} else if trailer, ok := str.itl.peek().(*headerFrame); ok { // the next item is trailers.
@@ -971,8 +997,8 @@ func (l *loopyWriter) processData() (bool, error) {
}
// Compute how much of the header and data we can send within quota and max frame length
hSize := min(maxSize, len(dataItem.h))
- dSize := min(maxSize-hSize, dataItem.reader.Remaining())
- remainingBytes := len(dataItem.h) + dataItem.reader.Remaining() - hSize - dSize
+ dSize := min(maxSize-hSize, reader.Remaining())
+ remainingBytes := len(dataItem.h) + reader.Remaining() - hSize - dSize
size := hSize + dSize
var buf *[]byte
@@ -993,7 +1019,7 @@ func (l *loopyWriter) processData() (bool, error) {
defer pool.Put(buf)
copy((*buf)[:hSize], dataItem.h)
- _, _ = dataItem.reader.Read((*buf)[hSize:])
+ _, _ = reader.Read((*buf)[hSize:])
}
// Now that outgoing flow controls are checked we can replenish str's write quota
@@ -1014,7 +1040,7 @@ func (l *loopyWriter) processData() (bool, error) {
dataItem.h = dataItem.h[hSize:]
if remainingBytes == 0 { // All the data from that message was written out.
- _ = dataItem.reader.Close()
+ _ = reader.Close()
str.itl.dequeue()
}
if str.itl.isEmpty() {
diff --git a/vendor/google.golang.org/grpc/internal/transport/handler_server.go b/vendor/google.golang.org/grpc/internal/transport/handler_server.go
index 3dea23573..d954a64c3 100644
--- a/vendor/google.golang.org/grpc/internal/transport/handler_server.go
+++ b/vendor/google.golang.org/grpc/internal/transport/handler_server.go
@@ -277,11 +277,13 @@ func (ht *serverHandlerTransport) writeStatus(s *ServerStream, st *status.Status
if err == nil { // transport has not been closed
// Note: The trailer fields are compressed with hpack after this call returns.
// No WireLength field is set here.
+ s.hdrMu.Lock()
for _, sh := range ht.stats {
sh.HandleRPC(s.Context(), &stats.OutTrailer{
Trailer: s.trailer.Copy(),
})
}
+ s.hdrMu.Unlock()
}
ht.Close(errors.New("finished writing status"))
return err
diff --git a/vendor/google.golang.org/grpc/internal/transport/http2_client.go b/vendor/google.golang.org/grpc/internal/transport/http2_client.go
index 171e690a3..7cb238794 100644
--- a/vendor/google.golang.org/grpc/internal/transport/http2_client.go
+++ b/vendor/google.golang.org/grpc/internal/transport/http2_client.go
@@ -309,11 +309,9 @@ func NewHTTP2Client(connectCtx, ctx context.Context, addr resolver.Address, opts
scheme = "https"
}
}
- dynamicWindow := true
icwz := int32(initialWindowSize)
if opts.InitialConnWindowSize >= defaultWindowSize {
icwz = opts.InitialConnWindowSize
- dynamicWindow = false
}
writeBufSize := opts.WriteBufferSize
readBufSize := opts.ReadBufferSize
@@ -381,9 +379,8 @@ func NewHTTP2Client(connectCtx, ctx context.Context, addr resolver.Address, opts
t.controlBuf = newControlBuffer(t.ctxDone)
if opts.InitialWindowSize >= defaultWindowSize {
t.initialWindowSize = opts.InitialWindowSize
- dynamicWindow = false
}
- if dynamicWindow {
+ if !opts.StaticWindowSize {
t.bdpEst = &bdpEstimator{
bdp: initialWindowSize,
updateFlowControl: t.updateFlowControl,
@@ -545,7 +542,7 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr)
Method: callHdr.Method,
AuthInfo: t.authInfo,
}
- ctxWithRequestInfo := icredentials.NewRequestInfoContext(ctx, ri)
+ ctxWithRequestInfo := credentials.NewContextWithRequestInfo(ctx, ri)
authData, err := t.getTrAuthData(ctxWithRequestInfo, aud)
if err != nil {
return nil, err
@@ -559,6 +556,19 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr)
// Make the slice of certain predictable size to reduce allocations made by append.
hfLen := 7 // :method, :scheme, :path, :authority, content-type, user-agent, te
hfLen += len(authData) + len(callAuthData)
+ registeredCompressors := t.registeredCompressors
+ if callHdr.PreviousAttempts > 0 {
+ hfLen++
+ }
+ if callHdr.SendCompress != "" {
+ hfLen++
+ }
+ if registeredCompressors != "" {
+ hfLen++
+ }
+ if _, ok := ctx.Deadline(); ok {
+ hfLen++
+ }
headerFields := make([]hpack.HeaderField, 0, hfLen)
headerFields = append(headerFields, hpack.HeaderField{Name: ":method", Value: "POST"})
headerFields = append(headerFields, hpack.HeaderField{Name: ":scheme", Value: t.scheme})
@@ -571,7 +581,6 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr)
headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-previous-rpc-attempts", Value: strconv.Itoa(callHdr.PreviousAttempts)})
}
- registeredCompressors := t.registeredCompressors
if callHdr.SendCompress != "" {
headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-encoding", Value: callHdr.SendCompress})
// Include the outgoing compressor name when compressor is not registered
@@ -592,6 +601,9 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr)
// Send out timeout regardless its value. The server can detect timeout context by itself.
// TODO(mmukhi): Perhaps this field should be updated when actually writing out to the wire.
timeout := time.Until(dl)
+ if timeout <= 0 {
+ return nil, status.Error(codes.DeadlineExceeded, context.DeadlineExceeded.Error())
+ }
headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-timeout", Value: grpcutil.EncodeDuration(timeout)})
}
for k, v := range authData {
@@ -749,6 +761,25 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (*ClientS
callHdr = &newCallHdr
}
+ // The authority specified via the `CallAuthority` CallOption takes the
+ // highest precedence when determining the `:authority` header. It overrides
+ // any value present in the Host field of CallHdr. Before applying this
+ // override, the authority string is validated. If the credentials do not
+ // implement the AuthorityValidator interface, or if validation fails, the
+ // RPC is failed with a status code of `UNAVAILABLE`.
+ if callHdr.Authority != "" {
+ auth, ok := t.authInfo.(credentials.AuthorityValidator)
+ if !ok {
+ return nil, &NewStreamError{Err: status.Errorf(codes.Unavailable, "credentials type %q does not implement the AuthorityValidator interface, but authority override specified with CallAuthority call option", t.authInfo.AuthType())}
+ }
+ if err := auth.ValidateAuthority(callHdr.Authority); err != nil {
+ return nil, &NewStreamError{Err: status.Errorf(codes.Unavailable, "failed to validate authority %q : %v", callHdr.Authority, err)}
+ }
+ newCallHdr := *callHdr
+ newCallHdr.Host = callHdr.Authority
+ callHdr = &newCallHdr
+ }
+
headerFields, err := t.createHeaderFields(ctx, callHdr)
if err != nil {
return nil, &NewStreamError{Err: err, AllowTransparentRetry: false}
@@ -1069,32 +1100,29 @@ func (t *http2Client) GracefulClose() {
// Write formats the data into HTTP2 data frame(s) and sends it out. The caller
// should proceed only if Write returns nil.
func (t *http2Client) write(s *ClientStream, hdr []byte, data mem.BufferSlice, opts *WriteOptions) error {
- reader := data.Reader()
-
if opts.Last {
// If it's the last message, update stream state.
if !s.compareAndSwapState(streamActive, streamWriteDone) {
- _ = reader.Close()
return errStreamDone
}
} else if s.getState() != streamActive {
- _ = reader.Close()
return errStreamDone
}
df := &dataFrame{
streamID: s.id,
endStream: opts.Last,
h: hdr,
- reader: reader,
+ data: data,
}
- if hdr != nil || df.reader.Remaining() != 0 { // If it's not an empty data frame, check quota.
- if err := s.wq.get(int32(len(hdr) + df.reader.Remaining())); err != nil {
- _ = reader.Close()
+ dataLen := data.Len()
+ if hdr != nil || dataLen != 0 { // If it's not an empty data frame, check quota.
+ if err := s.wq.get(int32(len(hdr) + dataLen)); err != nil {
return err
}
}
+ data.Ref()
if err := t.controlBuf.put(df); err != nil {
- _ = reader.Close()
+ data.Free()
return err
}
t.incrMsgSent()
@@ -1483,13 +1511,6 @@ func (t *http2Client) operateHeaders(frame *http2.MetaHeadersFrame) {
case "grpc-message":
grpcMessage = decodeGrpcMessage(hf.Value)
case ":status":
- if hf.Value == "200" {
- httpStatusErr = ""
- statusCode := 200
- httpStatusCode = &statusCode
- break
- }
-
c, err := strconv.ParseInt(hf.Value, 10, 32)
if err != nil {
se := status.New(codes.Internal, fmt.Sprintf("transport: malformed http-status: %v", err))
@@ -1497,7 +1518,19 @@ func (t *http2Client) operateHeaders(frame *http2.MetaHeadersFrame) {
return
}
statusCode := int(c)
+ if statusCode >= 100 && statusCode < 200 {
+ if endStream {
+ se := status.New(codes.Internal, fmt.Sprintf(
+ "protocol error: informational header with status code %d must not have END_STREAM set", statusCode))
+ t.closeStream(s, se.Err(), true, http2.ErrCodeProtocol, se, nil, endStream)
+ }
+ return
+ }
httpStatusCode = &statusCode
+ if statusCode == 200 {
+ httpStatusErr = ""
+ break
+ }
httpStatusErr = fmt.Sprintf(
"unexpected HTTP status code received from server: %d (%s)",
diff --git a/vendor/google.golang.org/grpc/internal/transport/http2_server.go b/vendor/google.golang.org/grpc/internal/transport/http2_server.go
index 7e53eb173..83cee314c 100644
--- a/vendor/google.golang.org/grpc/internal/transport/http2_server.go
+++ b/vendor/google.golang.org/grpc/internal/transport/http2_server.go
@@ -39,6 +39,7 @@ import (
"google.golang.org/grpc/internal/grpclog"
"google.golang.org/grpc/internal/grpcutil"
"google.golang.org/grpc/internal/pretty"
+ istatus "google.golang.org/grpc/internal/status"
"google.golang.org/grpc/internal/syscall"
"google.golang.org/grpc/mem"
"google.golang.org/protobuf/proto"
@@ -131,6 +132,10 @@ type http2Server struct {
maxStreamID uint32 // max stream ID ever seen
logger *grpclog.PrefixLogger
+ // setResetPingStrikes is stored as a closure instead of making this a
+ // method on http2Server to avoid a heap allocation when converting a method
+ // to a closure for passing to frames objects.
+ setResetPingStrikes func()
}
// NewServerTransport creates a http2 transport with conn and configuration
@@ -175,16 +180,13 @@ func NewServerTransport(conn net.Conn, config *ServerConfig) (_ ServerTransport,
Val: config.MaxStreams,
})
}
- dynamicWindow := true
iwz := int32(initialWindowSize)
if config.InitialWindowSize >= defaultWindowSize {
iwz = config.InitialWindowSize
- dynamicWindow = false
}
icwz := int32(initialWindowSize)
if config.InitialConnWindowSize >= defaultWindowSize {
icwz = config.InitialConnWindowSize
- dynamicWindow = false
}
if iwz != defaultWindowSize {
isettings = append(isettings, http2.Setting{
@@ -265,6 +267,9 @@ func NewServerTransport(conn net.Conn, config *ServerConfig) (_ ServerTransport,
initialWindowSize: iwz,
bufferPool: config.BufferPool,
}
+ t.setResetPingStrikes = func() {
+ atomic.StoreUint32(&t.resetPingStrikes, 1)
+ }
var czSecurity credentials.ChannelzSecurityValue
if au, ok := authInfo.(credentials.ChannelzSecurityInfo); ok {
czSecurity = au.GetSecurityValue()
@@ -284,7 +289,7 @@ func NewServerTransport(conn net.Conn, config *ServerConfig) (_ ServerTransport,
t.logger = prefixLoggerForServerTransport(t)
t.controlBuf = newControlBuffer(t.done)
- if dynamicWindow {
+ if !config.StaticWindowSize {
t.bdpEst = &bdpEstimator{
bdp: initialWindowSize,
updateFlowControl: t.updateFlowControl,
@@ -595,10 +600,25 @@ func (t *http2Server) operateHeaders(ctx context.Context, frame *http2.MetaHeade
return nil
}
}
+
+ if s.ctx.Err() != nil {
+ t.mu.Unlock()
+ // Early abort in case the timeout was zero or so low it already fired.
+ t.controlBuf.put(&earlyAbortStream{
+ httpStatus: http.StatusOK,
+ streamID: s.id,
+ contentSubtype: s.contentSubtype,
+ status: status.New(codes.DeadlineExceeded, context.DeadlineExceeded.Error()),
+ rst: !frame.StreamEnded(),
+ })
+ return nil
+ }
+
t.activeStreams[streamID] = s
if len(t.activeStreams) == 1 {
t.idle = time.Time{}
}
+
// Start a timer to close the stream on reaching the deadline.
if timeoutSet {
// We need to wait for s.cancel to be updated before calling
@@ -1015,10 +1035,6 @@ func (t *http2Server) writeHeader(s *ServerStream, md metadata.MD) error {
return nil
}
-func (t *http2Server) setResetPingStrikes() {
- atomic.StoreUint32(&t.resetPingStrikes, 1)
-}
-
func (t *http2Server) writeHeaderLocked(s *ServerStream) error {
// TODO(mmukhi): Benchmark if the performance gets better if count the metadata and other header fields
// first and create a slice of that exact size.
@@ -1055,7 +1071,7 @@ func (t *http2Server) writeHeaderLocked(s *ServerStream) error {
return nil
}
-// WriteStatus sends stream status to the client and terminates the stream.
+// writeStatus sends stream status to the client and terminates the stream.
// There is no further I/O operations being able to perform on this stream.
// TODO(zhaoq): Now it indicates the end of entire stream. Revisit if early
// OK is adopted.
@@ -1083,7 +1099,7 @@ func (t *http2Server) writeStatus(s *ServerStream, st *status.Status) error {
headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-status", Value: strconv.Itoa(int(st.Code()))})
headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-message", Value: encodeGrpcMessage(st.Message())})
- if p := st.Proto(); p != nil && len(p.Details) > 0 {
+ if p := istatus.RawStatusProto(st); len(p.GetDetails()) > 0 {
// Do not use the user's grpc-status-details-bin (if present) if we are
// even attempting to set our own.
delete(s.trailer, grpcStatusDetailsBinHeader)
@@ -1131,17 +1147,13 @@ func (t *http2Server) writeStatus(s *ServerStream, st *status.Status) error {
// Write converts the data into HTTP2 data frame and sends it out. Non-nil error
// is returns if it fails (e.g., framing error, transport error).
func (t *http2Server) write(s *ServerStream, hdr []byte, data mem.BufferSlice, _ *WriteOptions) error {
- reader := data.Reader()
-
if !s.isHeaderSent() { // Headers haven't been written yet.
if err := t.writeHeader(s, nil); err != nil {
- _ = reader.Close()
return err
}
} else {
// Writing headers checks for this condition.
if s.getState() == streamDone {
- _ = reader.Close()
return t.streamContextErr(s)
}
}
@@ -1149,15 +1161,16 @@ func (t *http2Server) write(s *ServerStream, hdr []byte, data mem.BufferSlice, _
df := &dataFrame{
streamID: s.id,
h: hdr,
- reader: reader,
+ data: data,
onEachWrite: t.setResetPingStrikes,
}
- if err := s.wq.get(int32(len(hdr) + df.reader.Remaining())); err != nil {
- _ = reader.Close()
+ dataLen := data.Len()
+ if err := s.wq.get(int32(len(hdr) + dataLen)); err != nil {
return t.streamContextErr(s)
}
+ data.Ref()
if err := t.controlBuf.put(df); err != nil {
- _ = reader.Close()
+ data.Free()
return err
}
t.incrMsgSent()
@@ -1340,10 +1353,10 @@ func (t *http2Server) closeStream(s *ServerStream, rst bool, rstCode http2.ErrCo
// called to interrupt the potential blocking on other goroutines.
s.cancel()
- oldState := s.swapState(streamDone)
- if oldState == streamDone {
- return
- }
+ // We can't return early even if the stream's state is "done" as the state
+ // might have been set by the `finishStream` method. Deleting the stream via
+ // `finishStream` can get blocked on flow control.
+ s.swapState(streamDone)
t.deleteStream(s, eosReceived)
t.controlBuf.put(&cleanupStream{
diff --git a/vendor/google.golang.org/grpc/internal/transport/http_util.go b/vendor/google.golang.org/grpc/internal/transport/http_util.go
index f997f9fdb..e3663f87f 100644
--- a/vendor/google.golang.org/grpc/internal/transport/http_util.go
+++ b/vendor/google.golang.org/grpc/internal/transport/http_util.go
@@ -196,11 +196,11 @@ func decodeTimeout(s string) (time.Duration, error) {
if !ok {
return 0, fmt.Errorf("transport: timeout unit is not recognized: %q", s)
}
- t, err := strconv.ParseInt(s[:size-1], 10, 64)
+ t, err := strconv.ParseUint(s[:size-1], 10, 64)
if err != nil {
return 0, err
}
- const maxHours = math.MaxInt64 / int64(time.Hour)
+ const maxHours = math.MaxInt64 / uint64(time.Hour)
if d == time.Hour && t > maxHours {
// This timeout would overflow math.MaxInt64; clamp it.
return time.Duration(math.MaxInt64), nil
diff --git a/vendor/google.golang.org/grpc/internal/transport/transport.go b/vendor/google.golang.org/grpc/internal/transport/transport.go
index af4a4aeab..7dd53e80a 100644
--- a/vendor/google.golang.org/grpc/internal/transport/transport.go
+++ b/vendor/google.golang.org/grpc/internal/transport/transport.go
@@ -466,6 +466,7 @@ type ServerConfig struct {
MaxHeaderListSize *uint32
HeaderTableSize *uint32
BufferPool mem.BufferPool
+ StaticWindowSize bool
}
// ConnectOptions covers all relevant options for communicating with the server.
@@ -504,6 +505,8 @@ type ConnectOptions struct {
MaxHeaderListSize *uint32
// The mem.BufferPool to use when reading/writing to the wire.
BufferPool mem.BufferPool
+ // StaticWindowSize controls whether dynamic window sizing is enabled.
+ StaticWindowSize bool
}
// WriteOptions provides additional hints and information for message
@@ -540,6 +543,11 @@ type CallHdr struct {
PreviousAttempts int // value of grpc-previous-rpc-attempts header to set
DoneFunc func() // called when the stream is finished
+
+ // Authority is used to explicitly override the `:authority` header. If set,
+ // this value takes precedence over the Host field and will be used as the
+ // value for the `:authority` header.
+ Authority string
}
// ClientTransport is the common interface for all gRPC client-side transport
diff --git a/vendor/google.golang.org/grpc/internal/xds/clients/config.go b/vendor/google.golang.org/grpc/internal/xds/clients/config.go
new file mode 100644
index 000000000..f106465f6
--- /dev/null
+++ b/vendor/google.golang.org/grpc/internal/xds/clients/config.go
@@ -0,0 +1,112 @@
+/*
+ *
+ * Copyright 2024 gRPC authors.
+ *
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ * http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ *
+ */
+
+// Package clients provides implementations of the clients to interact with
+// xDS and LRS servers.
+//
+// # xDS Client
+//
+// The xDS client allows applications to:
+// - Create client instances with in-memory configurations.
+// - Register watches for named resources.
+// - Receive resources via the ADS (Aggregated Discovery Service) stream.
+//
+// This enables applications to dynamically discover and configure resources
+// such as listeners, routes, clusters, and endpoints from an xDS management
+// server.
+//
+// # LRS Client
+//
+// The LRS (Load Reporting Service) client allows applications to report load
+// data to an LRS server via the LRS stream. This data can be used for
+// monitoring, traffic management, and other purposes.
+//
+// # Experimental
+//
+// NOTICE: This package is EXPERIMENTAL and may be changed or removed
+// in a later release.
+package clients
+
+// ServerIdentifier holds identifying information for connecting to an xDS
+// management or LRS server.
+type ServerIdentifier struct {
+ // ServerURI is the target URI of the server.
+ ServerURI string
+
+ // Extensions can be populated with arbitrary data to be passed to the
+ // TransportBuilder and/or xDS Client's ResourceType implementations.
+ // This field can be used to provide additional configuration or context
+ // specific to the user's needs.
+ //
+ // The xDS and LRS clients do not interpret the contents of this field.
+ // It is the responsibility of the user's custom TransportBuilder and/or
+ // ResourceType implementations to handle and interpret these extensions.
+ //
+ // For example, a custom TransportBuilder might use this field to
+ // configure a specific security credentials.
+ //
+ // Extensions may be any type that is comparable, as they are used as map
+ // keys internally. If Extensions are not able to be used as a map key,
+ // the client may panic.
+ //
+ // See: https://go.dev/ref/spec#Comparison_operators
+ //
+ // Any equivalent extensions in all ServerIdentifiers present in a single
+ // client's configuration should have the same value. Not following this
+ // restriction may result in excess resource usage.
+ Extensions any
+}
+
+// Node represents the identity of the xDS client, allowing xDS and LRS servers
+// to identify the source of xDS requests.
+type Node struct {
+ // ID is a string identifier of the application.
+ ID string
+ // Cluster is the name of the cluster the application belongs to.
+ Cluster string
+ // Locality is the location of the application including region, zone,
+ // sub-zone.
+ Locality Locality
+ // Metadata provides additional context about the application by associating
+ // arbitrary key-value pairs with it.
+ Metadata any
+ // UserAgentName is the user agent name of application.
+ UserAgentName string
+ // UserAgentVersion is the user agent version of application.
+ UserAgentVersion string
+}
+
+// Locality represents the location of the xDS client application.
+type Locality struct {
+ // Region is the region of the xDS client application.
+ Region string
+ // Zone is the area within a region.
+ Zone string
+ // SubZone is the further subdivision within a zone.
+ SubZone string
+}
+
+// MetricsReporter is used by the XDSClient to report metrics.
+type MetricsReporter interface {
+ // ReportMetric reports a metric. The metric will be one of the predefined
+ // set of types depending on the client (XDSClient or LRSClient).
+ //
+ // Each client will produce different metrics. Please see the client's
+ // documentation for a list of possible metrics events.
+ ReportMetric(metric any)
+}
diff --git a/vendor/google.golang.org/grpc/internal/xds/clients/transport_builder.go b/vendor/google.golang.org/grpc/internal/xds/clients/transport_builder.go
new file mode 100644
index 000000000..f940675d9
--- /dev/null
+++ b/vendor/google.golang.org/grpc/internal/xds/clients/transport_builder.go
@@ -0,0 +1,53 @@
+/*
+ *
+ * Copyright 2024 gRPC authors.
+ *
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ * http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ *
+ */
+
+package clients
+
+import (
+ "context"
+)
+
+// TransportBuilder provides the functionality to create a communication
+// channel to an xDS or LRS server.
+type TransportBuilder interface {
+ // Build creates a new Transport instance to the server based on the
+ // provided ServerIdentifier.
+ Build(serverIdentifier ServerIdentifier) (Transport, error)
+}
+
+// Transport provides the functionality to communicate with an xDS or LRS
+// server using streaming calls.
+type Transport interface {
+ // NewStream creates a new streaming call to the server for the specific
+ // RPC method name. The returned Stream interface can be used to send and
+ // receive messages on the stream.
+ NewStream(context.Context, string) (Stream, error)
+
+ // Close closes the Transport.
+ Close()
+}
+
+// Stream provides methods to send and receive messages on a stream. Messages
+// are represented as a byte slice.
+type Stream interface {
+ // Send sends the provided message on the stream.
+ Send([]byte) error
+
+ // Recv blocks until the next message is received on the stream.
+ Recv() ([]byte, error)
+}
diff --git a/vendor/google.golang.org/grpc/internal/xds/xds.go b/vendor/google.golang.org/grpc/internal/xds/xds.go
index 024c388b7..b9a4ec90a 100644
--- a/vendor/google.golang.org/grpc/internal/xds/xds.go
+++ b/vendor/google.golang.org/grpc/internal/xds/xds.go
@@ -14,12 +14,17 @@
* limitations under the License.
*/
-// Package xds contains methods to Get/Set handshake cluster names. It is separated
-// out from the top level /internal package to avoid circular dependencies.
+// Package xds contains functions, structs, and utilities for working with
+// handshake cluster names, as well as shared components used by xds balancers
+// and resolvers. It is separated from the top-level /internal package to
+// avoid circular dependencies.
package xds
import (
+ "fmt"
+
"google.golang.org/grpc/attributes"
+ "google.golang.org/grpc/internal/xds/clients"
"google.golang.org/grpc/resolver"
)
@@ -40,3 +45,60 @@ func GetXDSHandshakeClusterName(attr *attributes.Attributes) (string, bool) {
name, ok := v.(string)
return name, ok
}
+
+// LocalityString generates a string representation of clients.Locality in the
+// format specified in gRFC A76.
+func LocalityString(l clients.Locality) string {
+ return fmt.Sprintf("{region=%q, zone=%q, sub_zone=%q}", l.Region, l.Zone, l.SubZone)
+}
+
+// IsLocalityEqual allows the values to be compared by Attributes.Equal.
+func IsLocalityEqual(l clients.Locality, o any) bool {
+ ol, ok := o.(clients.Locality)
+ if !ok {
+ return false
+ }
+ return l.Region == ol.Region && l.Zone == ol.Zone && l.SubZone == ol.SubZone
+}
+
+// LocalityFromString converts a string representation of clients.locality as
+// specified in gRFC A76, into a LocalityID struct.
+func LocalityFromString(s string) (ret clients.Locality, _ error) {
+ _, err := fmt.Sscanf(s, "{region=%q, zone=%q, sub_zone=%q}", &ret.Region, &ret.Zone, &ret.SubZone)
+ if err != nil {
+ return clients.Locality{}, fmt.Errorf("%s is not a well formatted locality ID, error: %v", s, err)
+ }
+ return ret, nil
+}
+
+type localityKeyType string
+
+const localityKey = localityKeyType("grpc.xds.internal.address.locality")
+
+// GetLocalityID returns the locality ID of addr.
+func GetLocalityID(addr resolver.Address) clients.Locality {
+ path, _ := addr.BalancerAttributes.Value(localityKey).(clients.Locality)
+ return path
+}
+
+// SetLocalityID sets locality ID in addr to l.
+func SetLocalityID(addr resolver.Address, l clients.Locality) resolver.Address {
+ addr.BalancerAttributes = addr.BalancerAttributes.WithValue(localityKey, l)
+ return addr
+}
+
+// SetLocalityIDInEndpoint sets locality ID in endpoint to l.
+func SetLocalityIDInEndpoint(endpoint resolver.Endpoint, l clients.Locality) resolver.Endpoint {
+ endpoint.Attributes = endpoint.Attributes.WithValue(localityKey, l)
+ return endpoint
+}
+
+// ResourceTypeMapForTesting maps TypeUrl to corresponding ResourceType.
+var ResourceTypeMapForTesting map[string]any
+
+// UnknownCSMLabels are TelemetryLabels emitted from CDS if CSM Telemetry Label
+// data is not present in the CDS Resource.
+var UnknownCSMLabels = map[string]string{
+ "csm.service_name": "unknown",
+ "csm.service_namespace_name": "unknown",
+}
diff --git a/vendor/google.golang.org/grpc/mem/buffer_slice.go b/vendor/google.golang.org/grpc/mem/buffer_slice.go
index 65002e2cc..af510d20c 100644
--- a/vendor/google.golang.org/grpc/mem/buffer_slice.go
+++ b/vendor/google.golang.org/grpc/mem/buffer_slice.go
@@ -137,6 +137,9 @@ type Reader interface {
Close() error
// Remaining returns the number of unread bytes remaining in the slice.
Remaining() int
+ // Reset frees the currently held buffer slice and starts reading from the
+ // provided slice. This allows reusing the reader object.
+ Reset(s BufferSlice)
}
type sliceReader struct {
@@ -150,6 +153,14 @@ func (r *sliceReader) Remaining() int {
return r.len
}
+func (r *sliceReader) Reset(s BufferSlice) {
+ r.data.Free()
+ s.Ref()
+ r.data = s
+ r.len = s.Len()
+ r.bufferIdx = 0
+}
+
func (r *sliceReader) Close() error {
r.data.Free()
r.data = nil
diff --git a/vendor/google.golang.org/grpc/picker_wrapper.go b/vendor/google.golang.org/grpc/picker_wrapper.go
index a2d2a798d..aa52bfe95 100644
--- a/vendor/google.golang.org/grpc/picker_wrapper.go
+++ b/vendor/google.golang.org/grpc/picker_wrapper.go
@@ -29,7 +29,6 @@ import (
"google.golang.org/grpc/internal/channelz"
istatus "google.golang.org/grpc/internal/status"
"google.golang.org/grpc/internal/transport"
- "google.golang.org/grpc/stats"
"google.golang.org/grpc/status"
)
@@ -48,14 +47,11 @@ type pickerGeneration struct {
// actions and unblock when there's a picker update.
type pickerWrapper struct {
// If pickerGen holds a nil pointer, the pickerWrapper is closed.
- pickerGen atomic.Pointer[pickerGeneration]
- statsHandlers []stats.Handler // to record blocking picker calls
+ pickerGen atomic.Pointer[pickerGeneration]
}
-func newPickerWrapper(statsHandlers []stats.Handler) *pickerWrapper {
- pw := &pickerWrapper{
- statsHandlers: statsHandlers,
- }
+func newPickerWrapper() *pickerWrapper {
+ pw := &pickerWrapper{}
pw.pickerGen.Store(&pickerGeneration{
blockingCh: make(chan struct{}),
})
@@ -93,6 +89,12 @@ func doneChannelzWrapper(acbw *acBalancerWrapper, result *balancer.PickResult) {
}
}
+type pick struct {
+ transport transport.ClientTransport // the selected transport
+ result balancer.PickResult // the contents of the pick from the LB policy
+ blocked bool // set if a picker call queued for a new picker
+}
+
// pick returns the transport that will be used for the RPC.
// It may block in the following cases:
// - there's no picker
@@ -100,15 +102,16 @@ func doneChannelzWrapper(acbw *acBalancerWrapper, result *balancer.PickResult) {
// - the current picker returns other errors and failfast is false.
// - the subConn returned by the current picker is not READY
// When one of these situations happens, pick blocks until the picker gets updated.
-func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.PickInfo) (transport.ClientTransport, balancer.PickResult, error) {
+func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.PickInfo) (pick, error) {
var ch chan struct{}
var lastPickErr error
+ pickBlocked := false
for {
pg := pw.pickerGen.Load()
if pg == nil {
- return nil, balancer.PickResult{}, ErrClientConnClosing
+ return pick{}, ErrClientConnClosing
}
if pg.picker == nil {
ch = pg.blockingCh
@@ -127,9 +130,9 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.
}
switch ctx.Err() {
case context.DeadlineExceeded:
- return nil, balancer.PickResult{}, status.Error(codes.DeadlineExceeded, errStr)
+ return pick{}, status.Error(codes.DeadlineExceeded, errStr)
case context.Canceled:
- return nil, balancer.PickResult{}, status.Error(codes.Canceled, errStr)
+ return pick{}, status.Error(codes.Canceled, errStr)
}
case <-ch:
}
@@ -145,9 +148,7 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.
// In the second case, the only way it will get to this conditional is
// if there is a new picker.
if ch != nil {
- for _, sh := range pw.statsHandlers {
- sh.HandleRPC(ctx, &stats.PickerUpdated{})
- }
+ pickBlocked = true
}
ch = pg.blockingCh
@@ -164,7 +165,7 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.
if istatus.IsRestrictedControlPlaneCode(st) {
err = status.Errorf(codes.Internal, "received picker error with illegal status: %v", err)
}
- return nil, balancer.PickResult{}, dropError{error: err}
+ return pick{}, dropError{error: err}
}
// For all other errors, wait for ready RPCs should block and other
// RPCs should fail with unavailable.
@@ -172,7 +173,7 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.
lastPickErr = err
continue
}
- return nil, balancer.PickResult{}, status.Error(codes.Unavailable, err.Error())
+ return pick{}, status.Error(codes.Unavailable, err.Error())
}
acbw, ok := pickResult.SubConn.(*acBalancerWrapper)
@@ -183,9 +184,8 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.
if t := acbw.ac.getReadyTransport(); t != nil {
if channelz.IsOn() {
doneChannelzWrapper(acbw, &pickResult)
- return t, pickResult, nil
}
- return t, pickResult, nil
+ return pick{transport: t, result: pickResult, blocked: pickBlocked}, nil
}
if pickResult.Done != nil {
// Calling done with nil error, no bytes sent and no bytes received.
diff --git a/vendor/google.golang.org/grpc/resolver/resolver.go b/vendor/google.golang.org/grpc/resolver/resolver.go
index b84ef26d4..8e6af9514 100644
--- a/vendor/google.golang.org/grpc/resolver/resolver.go
+++ b/vendor/google.golang.org/grpc/resolver/resolver.go
@@ -332,6 +332,11 @@ type AuthorityOverrider interface {
// OverrideAuthority returns the authority to use for a ClientConn with the
// given target. The implementation must generate it without blocking,
// typically in line, and must keep it unchanged.
+ //
+ // The returned string must be a valid ":authority" header value, i.e. be
+ // encoded according to
+ // [RFC3986](https://datatracker.ietf.org/doc/html/rfc3986#section-3.2) as
+ // necessary.
OverrideAuthority(Target) string
}
diff --git a/vendor/google.golang.org/grpc/rpc_util.go b/vendor/google.golang.org/grpc/rpc_util.go
index ad20e9dff..47ea09f5c 100644
--- a/vendor/google.golang.org/grpc/rpc_util.go
+++ b/vendor/google.golang.org/grpc/rpc_util.go
@@ -160,6 +160,7 @@ type callInfo struct {
codec baseCodec
maxRetryRPCBufferSize int
onFinish []func(err error)
+ authority string
}
func defaultCallInfo() *callInfo {
@@ -365,6 +366,36 @@ func (o MaxRecvMsgSizeCallOption) before(c *callInfo) error {
}
func (o MaxRecvMsgSizeCallOption) after(*callInfo, *csAttempt) {}
+// CallAuthority returns a CallOption that sets the HTTP/2 :authority header of
+// an RPC to the specified value. When using CallAuthority, the credentials in
+// use must implement the AuthorityValidator interface.
+//
+// # Experimental
+//
+// Notice: This API is EXPERIMENTAL and may be changed or removed in a later
+// release.
+func CallAuthority(authority string) CallOption {
+ return AuthorityOverrideCallOption{Authority: authority}
+}
+
+// AuthorityOverrideCallOption is a CallOption that indicates the HTTP/2
+// :authority header value to use for the call.
+//
+// # Experimental
+//
+// Notice: This type is EXPERIMENTAL and may be changed or removed in a later
+// release.
+type AuthorityOverrideCallOption struct {
+ Authority string
+}
+
+func (o AuthorityOverrideCallOption) before(c *callInfo) error {
+ c.authority = o.Authority
+ return nil
+}
+
+func (o AuthorityOverrideCallOption) after(*callInfo, *csAttempt) {}
+
// MaxCallSendMsgSize returns a CallOption which sets the maximum message size
// in bytes the client can send. If this is not set, gRPC uses the default
// `math.MaxInt32`.
diff --git a/vendor/google.golang.org/grpc/server.go b/vendor/google.golang.org/grpc/server.go
index 976e70ae0..1da2a542a 100644
--- a/vendor/google.golang.org/grpc/server.go
+++ b/vendor/google.golang.org/grpc/server.go
@@ -179,6 +179,7 @@ type serverOptions struct {
numServerWorkers uint32
bufferPool mem.BufferPool
waitForHandlers bool
+ staticWindowSize bool
}
var defaultServerOptions = serverOptions{
@@ -279,6 +280,7 @@ func ReadBufferSize(s int) ServerOption {
func InitialWindowSize(s int32) ServerOption {
return newFuncServerOption(func(o *serverOptions) {
o.initialWindowSize = s
+ o.staticWindowSize = true
})
}
@@ -287,6 +289,29 @@ func InitialWindowSize(s int32) ServerOption {
func InitialConnWindowSize(s int32) ServerOption {
return newFuncServerOption(func(o *serverOptions) {
o.initialConnWindowSize = s
+ o.staticWindowSize = true
+ })
+}
+
+// StaticStreamWindowSize returns a ServerOption to set the initial stream
+// window size to the value provided and disables dynamic flow control.
+// The lower bound for window size is 64K and any value smaller than that
+// will be ignored.
+func StaticStreamWindowSize(s int32) ServerOption {
+ return newFuncServerOption(func(o *serverOptions) {
+ o.initialWindowSize = s
+ o.staticWindowSize = true
+ })
+}
+
+// StaticConnWindowSize returns a ServerOption to set the initial connection
+// window size to the value provided and disables dynamic flow control.
+// The lower bound for window size is 64K and any value smaller than that
+// will be ignored.
+func StaticConnWindowSize(s int32) ServerOption {
+ return newFuncServerOption(func(o *serverOptions) {
+ o.initialConnWindowSize = s
+ o.staticWindowSize = true
})
}
@@ -986,6 +1011,7 @@ func (s *Server) newHTTP2Transport(c net.Conn) transport.ServerTransport {
MaxHeaderListSize: s.opts.maxHeaderListSize,
HeaderTableSize: s.opts.headerTableSize,
BufferPool: s.opts.bufferPool,
+ StaticWindowSize: s.opts.staticWindowSize,
}
st, err := transport.NewServerTransport(c, config)
if err != nil {
@@ -1572,6 +1598,7 @@ func (s *Server) processStreamingRPC(ctx context.Context, stream *transport.Serv
s: stream,
p: &parser{r: stream, bufferPool: s.opts.bufferPool},
codec: s.getCodec(stream.ContentSubtype()),
+ desc: sd,
maxReceiveMessageSize: s.opts.maxReceiveMessageSize,
maxSendMessageSize: s.opts.maxSendMessageSize,
trInfo: trInfo,
diff --git a/vendor/google.golang.org/grpc/stats/handlers.go b/vendor/google.golang.org/grpc/stats/handlers.go
index dc03731e4..67194a592 100644
--- a/vendor/google.golang.org/grpc/stats/handlers.go
+++ b/vendor/google.golang.org/grpc/stats/handlers.go
@@ -38,6 +38,15 @@ type RPCTagInfo struct {
// FailFast indicates if this RPC is failfast.
// This field is only valid on client side, it's always false on server side.
FailFast bool
+ // NameResolutionDelay indicates if the RPC needed to wait for the
+ // initial name resolver update before it could begin. This should only
+ // happen if the channel is IDLE when the RPC is started. Note that
+ // all retry or hedging attempts for an RPC that experienced a delay
+ // will have it set.
+ //
+ // This field is only valid on the client side; it is always false on
+ // the server side.
+ NameResolutionDelay bool
}
// Handler defines the interface for the related stats handling (e.g., RPCs, connections).
diff --git a/vendor/google.golang.org/grpc/stats/stats.go b/vendor/google.golang.org/grpc/stats/stats.go
index baf7740ef..10bf998aa 100644
--- a/vendor/google.golang.org/grpc/stats/stats.go
+++ b/vendor/google.golang.org/grpc/stats/stats.go
@@ -64,15 +64,21 @@ func (s *Begin) IsClient() bool { return s.Client }
func (s *Begin) isRPCStats() {}
-// PickerUpdated indicates that the LB policy provided a new picker while the
-// RPC was waiting for one.
-type PickerUpdated struct{}
+// DelayedPickComplete indicates that the RPC is unblocked following a delay in
+// selecting a connection for the call.
+type DelayedPickComplete struct{}
-// IsClient indicates if the stats information is from client side. Only Client
-// Side interfaces with a Picker, thus always returns true.
-func (*PickerUpdated) IsClient() bool { return true }
+// IsClient indicates DelayedPickComplete is available on the client.
+func (*DelayedPickComplete) IsClient() bool { return true }
-func (*PickerUpdated) isRPCStats() {}
+func (*DelayedPickComplete) isRPCStats() {}
+
+// PickerUpdated indicates that the RPC is unblocked following a delay in
+// selecting a connection for the call.
+//
+// Deprecated: will be removed in a future release; use DelayedPickComplete
+// instead.
+type PickerUpdated = DelayedPickComplete
// InPayload contains stats about an incoming payload.
type InPayload struct {
diff --git a/vendor/google.golang.org/grpc/stream.go b/vendor/google.golang.org/grpc/stream.go
index 12163150b..0a0af8961 100644
--- a/vendor/google.golang.org/grpc/stream.go
+++ b/vendor/google.golang.org/grpc/stream.go
@@ -101,9 +101,9 @@ type ClientStream interface {
// It must only be called after stream.CloseAndRecv has returned, or
// stream.Recv has returned a non-nil error (including io.EOF).
Trailer() metadata.MD
- // CloseSend closes the send direction of the stream. It closes the stream
- // when non-nil error is met. It is also not safe to call CloseSend
- // concurrently with SendMsg.
+ // CloseSend closes the send direction of the stream. This method always
+ // returns a nil error. The status of the stream may be discovered using
+ // RecvMsg. It is also not safe to call CloseSend concurrently with SendMsg.
CloseSend() error
// Context returns the context for this stream.
//
@@ -212,14 +212,15 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth
}
// Provide an opportunity for the first RPC to see the first service config
// provided by the resolver.
- if err := cc.waitForResolvedAddrs(ctx); err != nil {
+ nameResolutionDelayed, err := cc.waitForResolvedAddrs(ctx)
+ if err != nil {
return nil, err
}
var mc serviceconfig.MethodConfig
var onCommit func()
newStream := func(ctx context.Context, done func()) (iresolver.ClientStream, error) {
- return newClientStreamWithParams(ctx, desc, cc, method, mc, onCommit, done, opts...)
+ return newClientStreamWithParams(ctx, desc, cc, method, mc, onCommit, done, nameResolutionDelayed, opts...)
}
rpcInfo := iresolver.RPCInfo{Context: ctx, Method: method}
@@ -257,7 +258,7 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth
return newStream(ctx, func() {})
}
-func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *ClientConn, method string, mc serviceconfig.MethodConfig, onCommit, doneFunc func(), opts ...CallOption) (_ iresolver.ClientStream, err error) {
+func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *ClientConn, method string, mc serviceconfig.MethodConfig, onCommit, doneFunc func(), nameResolutionDelayed bool, opts ...CallOption) (_ iresolver.ClientStream, err error) {
callInfo := defaultCallInfo()
if mc.WaitForReady != nil {
callInfo.failFast = !*mc.WaitForReady
@@ -296,6 +297,7 @@ func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *Client
Method: method,
ContentSubtype: callInfo.contentSubtype,
DoneFunc: doneFunc,
+ Authority: callInfo.authority,
}
// Set our outgoing compression according to the UseCompressor CallOption, if
@@ -321,19 +323,20 @@ func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *Client
}
cs := &clientStream{
- callHdr: callHdr,
- ctx: ctx,
- methodConfig: &mc,
- opts: opts,
- callInfo: callInfo,
- cc: cc,
- desc: desc,
- codec: callInfo.codec,
- compressorV0: compressorV0,
- compressorV1: compressorV1,
- cancel: cancel,
- firstAttempt: true,
- onCommit: onCommit,
+ callHdr: callHdr,
+ ctx: ctx,
+ methodConfig: &mc,
+ opts: opts,
+ callInfo: callInfo,
+ cc: cc,
+ desc: desc,
+ codec: callInfo.codec,
+ compressorV0: compressorV0,
+ compressorV1: compressorV1,
+ cancel: cancel,
+ firstAttempt: true,
+ onCommit: onCommit,
+ nameResolutionDelay: nameResolutionDelayed,
}
if !cc.dopts.disableRetry {
cs.retryThrottler = cc.retryThrottler.Load().(*retryThrottler)
@@ -417,7 +420,7 @@ func (cs *clientStream) newAttemptLocked(isTransparent bool) (*csAttempt, error)
var beginTime time.Time
shs := cs.cc.dopts.copts.StatsHandlers
for _, sh := range shs {
- ctx = sh.TagRPC(ctx, &stats.RPCTagInfo{FullMethodName: method, FailFast: cs.callInfo.failFast})
+ ctx = sh.TagRPC(ctx, &stats.RPCTagInfo{FullMethodName: method, FailFast: cs.callInfo.failFast, NameResolutionDelay: cs.nameResolutionDelay})
beginTime = time.Now()
begin := &stats.Begin{
Client: true,
@@ -466,8 +469,9 @@ func (cs *clientStream) newAttemptLocked(isTransparent bool) (*csAttempt, error)
func (a *csAttempt) getTransport() error {
cs := a.cs
- var err error
- a.transport, a.pickResult, err = cs.cc.getTransport(a.ctx, cs.callInfo.failFast, cs.callHdr.Method)
+ pickInfo := balancer.PickInfo{Ctx: a.ctx, FullMethodName: cs.callHdr.Method}
+ pick, err := cs.cc.pickerWrapper.pick(a.ctx, cs.callInfo.failFast, pickInfo)
+ a.transport, a.pickResult = pick.transport, pick.result
if err != nil {
if de, ok := err.(dropError); ok {
err = de.error
@@ -478,6 +482,11 @@ func (a *csAttempt) getTransport() error {
if a.trInfo != nil {
a.trInfo.firstLine.SetRemoteAddr(a.transport.RemoteAddr())
}
+ if pick.blocked {
+ for _, sh := range a.statsHandlers {
+ sh.HandleRPC(a.ctx, &stats.DelayedPickComplete{})
+ }
+ }
return nil
}
@@ -540,6 +549,8 @@ type clientStream struct {
sentLast bool // sent an end stream
+ receivedFirstMsg bool // set after the first message is received
+
methodConfig *MethodConfig
ctx context.Context // the application's context, wrapped by stats/tracing
@@ -573,6 +584,9 @@ type clientStream struct {
onCommit func()
replayBuffer []replayOp // operations to replay on retry
replayBufferSize int // current size of replayBuffer
+ // nameResolutionDelay indicates if there was a delay in the name resolution.
+ // This field is only valid on client side, it's always false on server side.
+ nameResolutionDelay bool
}
type replayOp struct {
@@ -987,7 +1001,7 @@ func (cs *clientStream) RecvMsg(m any) error {
func (cs *clientStream) CloseSend() error {
if cs.sentLast {
- // TODO: return an error and finish the stream instead, due to API misuse?
+ // Return a nil error on repeated calls to this method.
return nil
}
cs.sentLast = true
@@ -1008,7 +1022,10 @@ func (cs *clientStream) CloseSend() error {
binlog.Log(cs.ctx, chc)
}
}
- // We never returned an error here for reasons.
+ // We don't return an error here as we expect users to read all messages
+ // from the stream and get the RPC status from RecvMsg(). Note that
+ // SendMsg() must return an error when one occurs so the application
+ // knows to stop sending messages, but that does not apply here.
return nil
}
@@ -1129,11 +1146,16 @@ func (a *csAttempt) recvMsg(m any, payInfo *payloadInfo) (err error) {
if statusErr := a.transportStream.Status().Err(); statusErr != nil {
return statusErr
}
+ // Received no msg and status OK for non-server streaming rpcs.
+ if !cs.desc.ServerStreams && !cs.receivedFirstMsg {
+ return status.Error(codes.Internal, "cardinality violation: received no response message from non-server-streaming RPC")
+ }
return io.EOF // indicates successful end of stream.
}
return toRPCErr(err)
}
+ cs.receivedFirstMsg = true
if a.trInfo != nil {
a.mu.Lock()
if a.trInfo.tr != nil {
@@ -1162,7 +1184,7 @@ func (a *csAttempt) recvMsg(m any, payInfo *payloadInfo) (err error) {
} else if err != nil {
return toRPCErr(err)
}
- return toRPCErr(errors.New("grpc: client streaming protocol violation: get , want "))
+ return status.Error(codes.Internal, "cardinality violation: expected for non server-streaming RPCs, but received another message")
}
func (a *csAttempt) finish(err error) {
@@ -1344,6 +1366,7 @@ type addrConnStream struct {
transport transport.ClientTransport
ctx context.Context
sentLast bool
+ receivedFirstMsg bool
desc *StreamDesc
codec baseCodec
sendCompressorV0 Compressor
@@ -1372,7 +1395,7 @@ func (as *addrConnStream) Trailer() metadata.MD {
func (as *addrConnStream) CloseSend() error {
if as.sentLast {
- // TODO: return an error and finish the stream instead, due to API misuse?
+ // Return a nil error on repeated calls to this method.
return nil
}
as.sentLast = true
@@ -1469,10 +1492,15 @@ func (as *addrConnStream) RecvMsg(m any) (err error) {
if statusErr := as.transportStream.Status().Err(); statusErr != nil {
return statusErr
}
+ // Received no msg and status OK for non-server streaming rpcs.
+ if !as.desc.ServerStreams && !as.receivedFirstMsg {
+ return status.Error(codes.Internal, "cardinality violation: received no response message from non-server-streaming RPC")
+ }
return io.EOF // indicates successful end of stream.
}
return toRPCErr(err)
}
+ as.receivedFirstMsg = true
if as.desc.ServerStreams {
// Subsequent messages should be received by subsequent RecvMsg calls.
@@ -1486,7 +1514,7 @@ func (as *addrConnStream) RecvMsg(m any) (err error) {
} else if err != nil {
return toRPCErr(err)
}
- return toRPCErr(errors.New("grpc: client streaming protocol violation: get , want "))
+ return status.Error(codes.Internal, "cardinality violation: expected for non server-streaming RPCs, but received another message")
}
func (as *addrConnStream) finish(err error) {
@@ -1571,6 +1599,7 @@ type serverStream struct {
s *transport.ServerStream
p *parser
codec baseCodec
+ desc *StreamDesc
compressorV0 Compressor
compressorV1 encoding.Compressor
@@ -1579,6 +1608,8 @@ type serverStream struct {
sendCompressorName string
+ recvFirstMsg bool // set after the first message is received
+
maxReceiveMessageSize int
maxSendMessageSize int
trInfo *traceInfo
@@ -1765,6 +1796,10 @@ func (ss *serverStream) RecvMsg(m any) (err error) {
binlog.Log(ss.ctx, chc)
}
}
+ // Received no request msg for non-client streaming rpcs.
+ if !ss.desc.ClientStreams && !ss.recvFirstMsg {
+ return status.Error(codes.Internal, "cardinality violation: received no request message from non-client-streaming RPC")
+ }
return err
}
if err == io.ErrUnexpectedEOF {
@@ -1772,6 +1807,7 @@ func (ss *serverStream) RecvMsg(m any) (err error) {
}
return toRPCErr(err)
}
+ ss.recvFirstMsg = true
if len(ss.statsHandler) != 0 {
for _, sh := range ss.statsHandler {
sh.HandleRPC(ss.s.Context(), &stats.InPayload{
@@ -1791,7 +1827,19 @@ func (ss *serverStream) RecvMsg(m any) (err error) {
binlog.Log(ss.ctx, cm)
}
}
- return nil
+
+ if ss.desc.ClientStreams {
+ // Subsequent messages should be received by subsequent RecvMsg calls.
+ return nil
+ }
+ // Special handling for non-client-stream rpcs.
+ // This recv expects EOF or errors, so we don't collect inPayload.
+ if err := recv(ss.p, ss.codec, ss.s, ss.decompressorV0, m, ss.maxReceiveMessageSize, nil, ss.decompressorV1, true); err == io.EOF {
+ return nil
+ } else if err != nil {
+ return err
+ }
+ return status.Error(codes.Internal, "cardinality violation: received multiple request messages for non-client-streaming RPC")
}
// MethodFromServerStream returns the method string for the input stream.
diff --git a/vendor/google.golang.org/grpc/version.go b/vendor/google.golang.org/grpc/version.go
index 51da8ed59..76f2e0d06 100644
--- a/vendor/google.golang.org/grpc/version.go
+++ b/vendor/google.golang.org/grpc/version.go
@@ -19,4 +19,4 @@
package grpc
// Version is the current grpc version.
-const Version = "1.72.1"
+const Version = "1.76.0"
diff --git a/vendor/modules.txt b/vendor/modules.txt
index 70faecbd5..3e93dc5c5 100644
--- a/vendor/modules.txt
+++ b/vendor/modules.txt
@@ -122,7 +122,7 @@ github.com/AzureAD/microsoft-authentication-library-for-go/apps/public
# github.com/MakeNowJust/heredoc v1.0.0
## explicit; go 1.12
github.com/MakeNowJust/heredoc
-# github.com/Masterminds/semver/v3 v3.3.1
+# github.com/Masterminds/semver/v3 v3.4.0
## explicit; go 1.21
github.com/Masterminds/semver/v3
# github.com/aws/aws-sdk-go v1.55.5
@@ -228,8 +228,8 @@ github.com/ghodss/yaml
# github.com/go-errors/errors v1.4.2
## explicit; go 1.14
github.com/go-errors/errors
-# github.com/go-jose/go-jose/v4 v4.0.5
-## explicit; go 1.21
+# github.com/go-jose/go-jose/v4 v4.1.2
+## explicit; go 1.23.0
github.com/go-jose/go-jose/v4
github.com/go-jose/go-jose/v4/cipher
github.com/go-jose/go-jose/v4/json
@@ -420,8 +420,8 @@ github.com/jmespath/go-jmespath
# github.com/json-iterator/go v1.1.12
## explicit; go 1.12
github.com/json-iterator/go
-# github.com/klauspost/cpuid/v2 v2.0.9
-## explicit; go 1.13
+# github.com/klauspost/cpuid/v2 v2.2.5
+## explicit; go 1.15
github.com/klauspost/cpuid/v2
# github.com/kylelemons/godebug v1.1.0
## explicit; go 1.11
@@ -536,7 +536,7 @@ github.com/russross/blackfriday/v2
# github.com/ryanuber/go-glob v1.0.0
## explicit
github.com/ryanuber/go-glob
-# github.com/sergi/go-diff v1.2.0
+# github.com/sergi/go-diff v1.3.1
## explicit; go 1.12
github.com/sergi/go-diff/diffmatchpatch
# github.com/sirupsen/logrus v1.9.3
@@ -546,7 +546,7 @@ github.com/sirupsen/logrus
## explicit; go 1.15
github.com/spf13/cobra
github.com/spf13/cobra/doc
-# github.com/spf13/pflag v1.0.9
+# github.com/spf13/pflag v1.0.10
## explicit; go 1.12
github.com/spf13/pflag
# github.com/x448/float16 v0.8.4
@@ -588,8 +588,8 @@ go.opencensus.io/trace/tracestate
## explicit; go 1.22.0
go.opentelemetry.io/auto/sdk
go.opentelemetry.io/auto/sdk/internal/telemetry
-# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0
-## explicit; go 1.22.0
+# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0
+## explicit; go 1.23.0
go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc
go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal
# go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0
@@ -598,7 +598,7 @@ go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp
go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request
go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv
go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconvutil
-# go.opentelemetry.io/otel v1.36.0
+# go.opentelemetry.io/otel v1.37.0
## explicit; go 1.23.0
go.opentelemetry.io/otel
go.opentelemetry.io/otel/attribute
@@ -608,15 +608,16 @@ go.opentelemetry.io/otel/codes
go.opentelemetry.io/otel/internal/baggage
go.opentelemetry.io/otel/internal/global
go.opentelemetry.io/otel/propagation
-go.opentelemetry.io/otel/semconv/v1.17.0
go.opentelemetry.io/otel/semconv/v1.20.0
go.opentelemetry.io/otel/semconv/v1.26.0
-# go.opentelemetry.io/otel/metric v1.36.0
+go.opentelemetry.io/otel/semconv/v1.30.0
+go.opentelemetry.io/otel/semconv/v1.34.0
+# go.opentelemetry.io/otel/metric v1.37.0
## explicit; go 1.23.0
go.opentelemetry.io/otel/metric
go.opentelemetry.io/otel/metric/embedded
go.opentelemetry.io/otel/metric/noop
-# go.opentelemetry.io/otel/trace v1.36.0
+# go.opentelemetry.io/otel/trace v1.37.0
## explicit; go 1.23.0
go.opentelemetry.io/otel/trace
go.opentelemetry.io/otel/trace/embedded
@@ -705,7 +706,7 @@ golang.org/x/text/secure/bidirule
golang.org/x/text/transform
golang.org/x/text/unicode/bidi
golang.org/x/text/unicode/norm
-# golang.org/x/time v0.13.0
+# golang.org/x/time v0.14.0
## explicit; go 1.24.0
golang.org/x/time/rate
# golang.org/x/xerrors v0.0.0-20240716161551-93cc26a95ae9
@@ -767,17 +768,17 @@ google.golang.org/api/transport/http/internal/propagation
google.golang.org/genproto/googleapis/cloud/location
google.golang.org/genproto/googleapis/type/date
google.golang.org/genproto/googleapis/type/expr
-# google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb
+# google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c
## explicit; go 1.23.0
google.golang.org/genproto/googleapis/api
google.golang.org/genproto/googleapis/api/annotations
-# google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb
-## explicit; go 1.23.0
+# google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda
+## explicit; go 1.24.0
google.golang.org/genproto/googleapis/rpc/code
google.golang.org/genproto/googleapis/rpc/errdetails
google.golang.org/genproto/googleapis/rpc/status
-# google.golang.org/grpc v1.72.1
-## explicit; go 1.23
+# google.golang.org/grpc v1.76.0
+## explicit; go 1.24.0
google.golang.org/grpc
google.golang.org/grpc/attributes
google.golang.org/grpc/backoff
@@ -841,6 +842,7 @@ google.golang.org/grpc/internal/syscall
google.golang.org/grpc/internal/transport
google.golang.org/grpc/internal/transport/networktype
google.golang.org/grpc/internal/xds
+google.golang.org/grpc/internal/xds/clients
google.golang.org/grpc/keepalive
google.golang.org/grpc/mem
google.golang.org/grpc/metadata
@@ -1430,8 +1432,8 @@ kmodules.xyz/monitoring-agent-api/api/v1
# kmodules.xyz/offshoot-api v0.34.0
## explicit; go 1.24.0
kmodules.xyz/offshoot-api/api/v1
-# kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b
-## explicit; go 1.24.0
+# kubevault.dev/apimachinery v0.24.0-rc.0
+## explicit; go 1.25.0
kubevault.dev/apimachinery/apis
kubevault.dev/apimachinery/apis/catalog
kubevault.dev/apimachinery/apis/catalog/v1alpha1