diff --git a/go.mod b/go.mod index 4b878e99d..7cf03da95 100644 --- a/go.mod +++ b/go.mod @@ -13,7 +13,7 @@ require ( github.com/hashicorp/vault/sdk v0.12.0 github.com/pkg/errors v0.9.1 github.com/spf13/cobra v1.10.1 - github.com/spf13/pflag v1.0.9 + github.com/spf13/pflag v1.0.10 golang.org/x/text v0.32.0 gomodules.xyz/logs v0.0.7 gomodules.xyz/password-generator v0.2.9 @@ -29,7 +29,7 @@ require ( k8s.io/kubectl v0.30.2 kmodules.xyz/client-go v0.34.2 kmodules.xyz/custom-resources v0.34.0 - kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b + kubevault.dev/apimachinery v0.24.0-rc.0 sigs.k8s.io/secrets-store-csi-driver v1.5.1 sigs.k8s.io/yaml v1.6.0 ) @@ -67,7 +67,7 @@ require ( github.com/Azure/go-ansiterm v0.0.0-20230124172434-306776ec8161 // indirect github.com/AzureAD/microsoft-authentication-library-for-go v1.2.2 // indirect github.com/MakeNowJust/heredoc v1.0.0 // indirect - github.com/Masterminds/semver/v3 v3.3.1 // indirect + github.com/Masterminds/semver/v3 v3.4.0 // indirect github.com/beorn7/perks v1.0.1 // indirect github.com/blang/semver/v4 v4.0.0 // indirect github.com/cenkalti/backoff/v3 v3.2.2 // indirect @@ -84,7 +84,7 @@ require ( github.com/fsnotify/fsnotify v1.9.0 // indirect github.com/fxamacker/cbor/v2 v2.9.0 // indirect github.com/ghodss/yaml v1.0.0 // indirect - github.com/go-jose/go-jose/v4 v4.0.5 // indirect + github.com/go-jose/go-jose/v4 v4.1.2 // indirect github.com/go-logr/logr v1.4.3 // indirect github.com/go-logr/stdr v1.2.2 // indirect github.com/go-openapi/jsonpointer v0.22.1 // indirect @@ -118,7 +118,7 @@ require ( github.com/inconshreveable/mousetrap v1.1.0 // indirect github.com/jmespath/go-jmespath v0.4.1-0.20220621161143-b0104c826a24 // indirect github.com/json-iterator/go v1.1.12 // indirect - github.com/klauspost/cpuid/v2 v2.0.9 // indirect + github.com/klauspost/cpuid/v2 v2.2.5 // indirect github.com/kylelemons/godebug v1.1.0 // indirect github.com/liggitt/tabwriter v0.0.0-20181228230101-89fcab3d43de // indirect github.com/mitchellh/go-homedir v1.1.0 // indirect @@ -145,7 +145,7 @@ require ( github.com/rancher/wrangler/v3 v3.2.0-rc.3 // indirect github.com/russross/blackfriday/v2 v2.1.0 // indirect github.com/ryanuber/go-glob v1.0.0 // indirect - github.com/sergi/go-diff v1.2.0 // indirect + github.com/sergi/go-diff v1.3.1 // indirect github.com/sirupsen/logrus v1.9.3 // indirect github.com/x448/float16 v0.8.4 // indirect github.com/xlab/treeprint v1.2.0 // indirect @@ -154,18 +154,18 @@ require ( github.com/zeebo/xxh3 v1.0.2 // indirect go.opencensus.io v0.24.0 // indirect go.opentelemetry.io/auto/sdk v1.1.0 // indirect - go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0 // indirect + go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0 // indirect go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0 // indirect - go.opentelemetry.io/otel v1.36.0 // indirect - go.opentelemetry.io/otel/metric v1.36.0 // indirect - go.opentelemetry.io/otel/trace v1.36.0 // indirect + go.opentelemetry.io/otel v1.37.0 // indirect + go.opentelemetry.io/otel/metric v1.37.0 // indirect + go.opentelemetry.io/otel/trace v1.37.0 // indirect golang.org/x/crypto v0.46.0 // indirect golang.org/x/net v0.47.0 // indirect golang.org/x/oauth2 v0.33.0 // indirect golang.org/x/sync v0.19.0 // indirect golang.org/x/sys v0.39.0 // indirect golang.org/x/term v0.38.0 // indirect - golang.org/x/time v0.13.0 // indirect + golang.org/x/time v0.14.0 // indirect gomodules.xyz/clock v0.0.0-20200817085942-06523dba733f // indirect gomodules.xyz/flags v0.1.3 // indirect gomodules.xyz/jsonpatch/v2 v2.5.0 // indirect @@ -173,9 +173,9 @@ require ( gomodules.xyz/sets v0.2.1 // indirect gomodules.xyz/wait v0.2.0 // indirect google.golang.org/genproto v0.0.0-20240730163845-b1a4ccb954bf // indirect - google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb // indirect - google.golang.org/grpc v1.72.1 // indirect + google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda // indirect + google.golang.org/grpc v1.76.0 // indirect gopkg.in/evanphx/json-patch.v4 v4.13.0 // indirect gopkg.in/inf.v0 v0.9.1 // indirect gopkg.in/yaml.v2 v2.4.0 // indirect diff --git a/go.sum b/go.sum index 22964f8cb..49e21f884 100644 --- a/go.sum +++ b/go.sum @@ -47,8 +47,8 @@ github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03 github.com/BurntSushi/xgb v0.0.0-20160522181843-27f122750802/go.mod h1:IVnqGOEym/WlBOVXweHU+Q+/VP0lqqI8lqeDx9IjBqo= github.com/MakeNowJust/heredoc v1.0.0 h1:cXCdzVdstXyiTqTvfqk9SDHpKNjxuom+DOlyEeQ4pzQ= github.com/MakeNowJust/heredoc v1.0.0/go.mod h1:mG5amYoWBHf8vpLOuehzbGGw0EHxpZZ6lCpQ4fNJ8LE= -github.com/Masterminds/semver/v3 v3.3.1 h1:QtNSWtVZ3nBfk8mAOu/B6v7FMJ+NHTIgUPi7rj+4nv4= -github.com/Masterminds/semver/v3 v3.3.1/go.mod h1:4V+yj/TJE1HU9XfppCwVMZq3I84lprf4nC11bSS5beM= +github.com/Masterminds/semver/v3 v3.4.0 h1:Zog+i5UMtVoCU8oKka5P7i9q9HgrJeGzI9SA1Xbatp0= +github.com/Masterminds/semver/v3 v3.4.0/go.mod h1:4V+yj/TJE1HU9XfppCwVMZq3I84lprf4nC11bSS5beM= github.com/OneOfOne/xxhash v1.2.2/go.mod h1:HSdplMjZKSmBqAxg5vPj2TmRDmfkzw+cTzAElWljhcU= github.com/alecthomas/template v0.0.0-20160405071501-a0175ee3bccc/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc= github.com/alecthomas/units v0.0.0-20151022065526-2efee857e7cf/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0= @@ -77,6 +77,8 @@ github.com/chai2010/gettext-go v1.0.2 h1:1Lwwip6Q2QGsAdl/ZKPCwTe9fe0CjlUbqj5bFNS github.com/chai2010/gettext-go v1.0.2/go.mod h1:y+wnP2cHYaVj19NZhYKAwEMH2CI1gNHeQQ+5AjwawxA= github.com/client9/misspell v0.3.4/go.mod h1:qj6jICC3Q7zFZvVWo7KLAzC3yx5G7kyvSDkc90ppPyw= github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc= +github.com/cncf/xds/go v0.0.0-20250501225837-2ac532fd4443 h1:aQ3y1lwWyqYPiWZThqv1aFbZMiM9vblcSArJRf2Irls= +github.com/cncf/xds/go v0.0.0-20250501225837-2ac532fd4443/go.mod h1:W+zGtBO5Y1IgJhy4+A9GOqVhqLpfZi+vwmdNXUehLA8= github.com/coreos/bbolt v1.3.2/go.mod h1:iRUV2dpdMOn7Bo10OQBFzIJO9kkE559Wcmn+qkEiiKk= github.com/coreos/etcd v3.3.13+incompatible/go.mod h1:uF7uidLiAD3TWHmW31ZFd/JWoc32PjwdhPthX9715RE= github.com/coreos/go-semver v0.3.0/go.mod h1:nnelYz7RCh+5ahJtPPxZlU+153eP4D4r3EedlOD2RNk= @@ -100,7 +102,12 @@ github.com/emicklei/go-restful/v3 v3.13.0/go.mod h1:6n3XBCmQQb25CM2LCACGz8ukIrRr github.com/envoyproxy/go-control-plane v0.9.0/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4= github.com/envoyproxy/go-control-plane v0.9.1-0.20191026205805-5f8ba28d4473/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4= github.com/envoyproxy/go-control-plane v0.9.4/go.mod h1:6rpuAdCZL397s3pYoYcLgu1mIlRU8Am5FuJP05cCM98= +github.com/envoyproxy/go-control-plane v0.13.4 h1:zEqyPVyku6IvWCFwux4x9RxkLOMUL+1vC9xUFv5l2/M= +github.com/envoyproxy/go-control-plane/envoy v1.32.4 h1:jb83lalDRZSpPWW2Z7Mck/8kXZ5CQAFYVjQcdVIr83A= +github.com/envoyproxy/go-control-plane/envoy v1.32.4/go.mod h1:Gzjc5k8JcJswLjAx1Zm+wSYE20UrLtt7JZMWiWQXQEw= github.com/envoyproxy/protoc-gen-validate v0.1.0/go.mod h1:iSmxcyjqTsJpI2R4NaDN7+kN2VEUnK/pcBlmesArF7c= +github.com/envoyproxy/protoc-gen-validate v1.2.1 h1:DEo3O99U8j4hBFwbJfrz9VtgcDfUKS7KJ7spH3d86P8= +github.com/envoyproxy/protoc-gen-validate v1.2.1/go.mod h1:d/C80l/jxXLdfEIhX1W2TmLfsJ31lvEjwamM4DxlWXU= github.com/evanphx/json-patch v5.9.11+incompatible h1:ixHHqfcGvxhWkniF1tWxBHA0yb4Z+d1UQi45df52xW8= github.com/evanphx/json-patch v5.9.11+incompatible/go.mod h1:50XU6AFN0ol/bzJsmQLiYLvXMP4fmwYFNcr97nuDLSk= github.com/evanphx/json-patch/v5 v5.9.11 h1:/8HVnzMq13/3x9TPvjG08wUGqBTmZBsCWzjTM0wiaDU= @@ -124,8 +131,8 @@ github.com/ghodss/yaml v1.0.0/go.mod h1:4dBDuWmgqj2HViK6kFavaiC9ZROes6MMH2rRYeME github.com/go-errors/errors v1.4.2 h1:J6MZopCL4uSllY1OfXM374weqZFFItUbrImctkmUxIA= github.com/go-errors/errors v1.4.2/go.mod h1:sIVyrIiJhuEF+Pj9Ebtd6P/rEYROXFi3BopGUQ5a5Og= github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU= -github.com/go-jose/go-jose/v4 v4.0.5 h1:M6T8+mKZl/+fNNuFHvGIzDz7BTLQPIounk/b9dw3AaE= -github.com/go-jose/go-jose/v4 v4.0.5/go.mod h1:s3P1lRrkT8igV8D9OjyL4WRyHvjB6a4JSllnOrmmBOA= +github.com/go-jose/go-jose/v4 v4.1.2 h1:TK/7NqRQZfgAh+Td8AlsrvtPoUyiHh0LqVvokh+1vHI= +github.com/go-jose/go-jose/v4 v4.1.2/go.mod h1:22cg9HWM1pOlnRiY+9cQYJ9XHmya1bYW8OeDM6Ku6Oo= github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE= github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk= @@ -315,8 +322,8 @@ github.com/kisielk/errcheck v1.5.0/go.mod h1:pFxgyoBC7bSaBwPgfKdkLd5X25qrDl4LWUI github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/klauspost/compress v1.18.1 h1:bcSGx7UbpBqMChDtsF28Lw6v/G94LPrrbMbdC3JH2co= github.com/klauspost/compress v1.18.1/go.mod h1:ZQFFVG+MdnR0P+l6wpXgIL4NTtwiKIdBnrBd8Nrxr+0= -github.com/klauspost/cpuid/v2 v2.0.9 h1:lgaqFMSdTdQYdZ04uHyN2d/eKdOMyi2YLSvlQIBFYa4= -github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= +github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= +github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/kmodules/apiserver v0.34.4-0.20251227112449-07fa35efc6fc h1:R5bKc1c8Qu7z+7+O0xNWxIPjCYuaHUVZ+dSfeCZEd+c= github.com/kmodules/apiserver v0.34.4-0.20251227112449-07fa35efc6fc/go.mod h1:QPnnahMO5C2m3lm6fPW3+JmyQbvHZQ8uudAu/493P2w= github.com/kmodules/controller-runtime v0.22.5-0.20251227114913-f011264689cd h1:cpLV7Pr+pSo3kDYY4HsLZfbdF1WPQuPTP+Jo3hyoWzw= @@ -395,6 +402,8 @@ github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINE github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= +github.com/planetscale/vtprotobuf v0.6.1-0.20240319094008-0393e58bdf10 h1:GFCKgmp0tecUJ0sJuv4pzYCqS9+RGSn52M3FUwPs+uo= +github.com/planetscale/vtprotobuf v0.6.1-0.20240319094008-0393e58bdf10/go.mod h1:t/avpk3KcrXxUnYOhZhMXJlSEyie6gQbtLq5NM3loB8= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U= github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= @@ -436,8 +445,8 @@ github.com/ryanuber/columnize v0.0.0-20160712163229-9b3edd62028f/go.mod h1:sm1tb github.com/ryanuber/go-glob v1.0.0 h1:iQh3xXAumdQ+4Ufa5b25cRpC5TYKlno6hsv6Cb3pkBk= github.com/ryanuber/go-glob v1.0.0/go.mod h1:807d1WSdnB0XRJzKNil9Om6lcp/3a0v4qIHxIXzX/Yc= github.com/sean-/seed v0.0.0-20170313163322-e2103e2c3529/go.mod h1:DxrIzT+xaE7yg65j358z/aeFdxmN0P9QXhEzd20vsDc= -github.com/sergi/go-diff v1.2.0 h1:XU+rvMAioB0UC3q1MFrIQy4Vo5/4VsRDQQXHsEya6xQ= -github.com/sergi/go-diff v1.2.0/go.mod h1:STckp+ISIX8hZLjrqAeVduY0gWCT9IjLuqbuNXdaHfM= +github.com/sergi/go-diff v1.3.1 h1:xkr+Oxo4BOQKmkn/B9eMK0g5Kg/983T9DqqPHwYqD+8= +github.com/sergi/go-diff v1.3.1/go.mod h1:aMJSSKb2lpPvRNec0+w3fl7LP9IOFzdc9Pa4NFbPK1I= github.com/shurcooL/sanitized_anchor_name v1.0.0/go.mod h1:1NzhyTcUVG4SuEtjjoZeVRXNmyL/1OwPU0+IJeTBvfc= github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo= github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ= @@ -455,8 +464,9 @@ github.com/spf13/cobra v1.10.1/go.mod h1:7SmJGaTHFVBY0jW4NXGluQoLvhqFQM+6XSKD+P4 github.com/spf13/jwalterweatherman v1.0.0/go.mod h1:cQK4TGJAtQXfYWX+Ddv3mKDzgVb68N+wFjFa4jdeBTo= github.com/spf13/pflag v1.0.3/go.mod h1:DYY7MBk1bdzusC3SYhjObp+wFpr4gzcvqqNjLnInEg4= github.com/spf13/pflag v1.0.5/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg= -github.com/spf13/pflag v1.0.9 h1:9exaQaMOCwffKiiiYk6/BndUBv+iRViNW+4lEMi0PvY= github.com/spf13/pflag v1.0.9/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg= +github.com/spf13/pflag v1.0.10 h1:4EBh2KAYBwaONj6b2Ye1GiHfwjqyROoF4RwYO+vPwFk= +github.com/spf13/pflag v1.0.10/go.mod h1:McXfInJRrz4CZXVZOBLb0bTZqETkiAhM9Iw0y3An2Bg= github.com/spf13/viper v1.7.0/go.mod h1:8WkrPz2fc9jxqZNCJI/76HCieCp4Q8HaLFoCha5qpdg= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= @@ -499,20 +509,20 @@ go.opencensus.io v0.24.0 h1:y73uSU6J157QMP2kn2r30vwW1A2W2WFwSCGnAVxeaD0= go.opencensus.io v0.24.0/go.mod h1:vNK8G9p7aAivkbmorf4v+7Hgx+Zs0yY+0fOtgBfjQKo= go.opentelemetry.io/auto/sdk v1.1.0 h1:cH53jehLUN6UFLY71z+NDOiNJqDdPRaXzTel0sJySYA= go.opentelemetry.io/auto/sdk v1.1.0/go.mod h1:3wSPjt5PWp2RhlCcmmOial7AvC4DQqZb7a7wCow3W8A= -go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0 h1:x7wzEgXfnzJcHDwStJT+mxOz4etr2EcexjqhBvmoakw= -go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0/go.mod h1:rg+RlpR5dKwaS95IyyZqj5Wd4E13lk/msnTS0Xl9lJM= +go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0 h1:q4XOmH/0opmeuJtPsbFNivyl7bCt7yRBbeEm2sC/XtQ= +go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0/go.mod h1:snMWehoOh2wsEwnvvwtDyFCxVeDAODenXHtn5vzrKjo= go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0 h1:F7Jx+6hwnZ41NSFTO5q4LYDtJRXBf2PD0rNBkeB/lus= go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0/go.mod h1:UHB22Z8QsdRDrnAtX4PntOl36ajSxcdUMt1sF7Y6E7Q= -go.opentelemetry.io/otel v1.36.0 h1:UumtzIklRBY6cI/lllNZlALOF5nNIzJVb16APdvgTXg= -go.opentelemetry.io/otel v1.36.0/go.mod h1:/TcFMXYjyRNh8khOAO9ybYkqaDBb/70aVwkNML4pP8E= -go.opentelemetry.io/otel/metric v1.36.0 h1:MoWPKVhQvJ+eeXWHFBOPoBOi20jh6Iq2CcCREuTYufE= -go.opentelemetry.io/otel/metric v1.36.0/go.mod h1:zC7Ks+yeyJt4xig9DEw9kuUFe5C3zLbVjV2PzT6qzbs= -go.opentelemetry.io/otel/sdk v1.36.0 h1:b6SYIuLRs88ztox4EyrvRti80uXIFy+Sqzoh9kFULbs= -go.opentelemetry.io/otel/sdk v1.36.0/go.mod h1:+lC+mTgD+MUWfjJubi2vvXWcVxyr9rmlshZni72pXeY= -go.opentelemetry.io/otel/sdk/metric v1.36.0 h1:r0ntwwGosWGaa0CrSt8cuNuTcccMXERFwHX4dThiPis= -go.opentelemetry.io/otel/sdk/metric v1.36.0/go.mod h1:qTNOhFDfKRwX0yXOqJYegL5WRaW376QbB7P4Pb0qva4= -go.opentelemetry.io/otel/trace v1.36.0 h1:ahxWNuqZjpdiFAyrIoQ4GIiAIhxAunQR6MUoKrsNd4w= -go.opentelemetry.io/otel/trace v1.36.0/go.mod h1:gQ+OnDZzrybY4k4seLzPAWNwVBBVlF2szhehOBB/tGA= +go.opentelemetry.io/otel v1.37.0 h1:9zhNfelUvx0KBfu/gb+ZgeAfAgtWrfHJZcAqFC228wQ= +go.opentelemetry.io/otel v1.37.0/go.mod h1:ehE/umFRLnuLa/vSccNq9oS1ErUlkkK71gMcN34UG8I= +go.opentelemetry.io/otel/metric v1.37.0 h1:mvwbQS5m0tbmqML4NqK+e3aDiO02vsf/WgbsdpcPoZE= +go.opentelemetry.io/otel/metric v1.37.0/go.mod h1:04wGrZurHYKOc+RKeye86GwKiTb9FKm1WHtO+4EVr2E= +go.opentelemetry.io/otel/sdk v1.37.0 h1:ItB0QUqnjesGRvNcmAcU0LyvkVyGJ2xftD29bWdDvKI= +go.opentelemetry.io/otel/sdk v1.37.0/go.mod h1:VredYzxUvuo2q3WRcDnKDjbdvmO0sCzOvVAiY+yUkAg= +go.opentelemetry.io/otel/sdk/metric v1.37.0 h1:90lI228XrB9jCMuSdA0673aubgRobVZFhbjxHHspCPc= +go.opentelemetry.io/otel/sdk/metric v1.37.0/go.mod h1:cNen4ZWfiD37l5NhS+Keb5RXVWZWpRE+9WyVCpbo5ps= +go.opentelemetry.io/otel/trace v1.37.0 h1:HLdcFNbRQBE2imdSEgm/kwqmQj1Or1l/7bW6mxVK7z4= +go.opentelemetry.io/otel/trace v1.37.0/go.mod h1:TlgrlQ+PtQO5XFerSPUYG0JSgGyryXewPGyayAWSBS0= go.uber.org/atomic v1.4.0/go.mod h1:gD2HeocX3+yG+ygLZcrzQJaqmWj9AIm7n08wl/qW/PE= go.uber.org/goleak v1.3.0 h1:2K3zAYmnTNqV73imy9J1T3WC+gmCePx2hEGkimedGto= go.uber.org/goleak v1.3.0/go.mod h1:CoHD4mav9JJNrW/WLlf7HGZPjdw8EucARQHekz1X6bE= @@ -605,6 +615,7 @@ golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20210616094352-59db8d763f22/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.39.0 h1:CvCKL8MeisomCi6qNZ+wbb0DN9E5AATixKsvNtMoMFk= golang.org/x/sys v0.39.0/go.mod h1:OgkHotnGiDImocRcuBABYBEXf8A9a87e/uXjp9XT3ks= golang.org/x/term v0.38.0 h1:PQ5pkm/rLO6HnxFR7N2lJHOZX6Kez5Y1gDSJla6jo7Q= @@ -617,8 +628,8 @@ golang.org/x/text v0.32.0 h1:ZD01bjUt1FQ9WJ0ClOL5vxgxOI/sVCNgX1YtKwcY0mU= golang.org/x/text v0.32.0/go.mod h1:o/rUWzghvpD5TXrTIBuJU77MTaN0ljMWE47kxGJQ7jY= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= -golang.org/x/time v0.13.0 h1:eUlYslOIt32DgYD6utsuUeHs4d7AsEYLuIAdg7FlYgI= -golang.org/x/time v0.13.0/go.mod h1:eL/Oa2bBBK0TkX57Fyni+NgnyQQN4LitPmob2Hjnqw4= +golang.org/x/time v0.14.0 h1:MRx4UaLrDotUKUdCIqzPC48t1Y9hANFKIRpNx+Te8PI= +golang.org/x/time v0.14.0/go.mod h1:eL/Oa2bBBK0TkX57Fyni+NgnyQQN4LitPmob2Hjnqw4= golang.org/x/tools v0.0.0-20180221164845-07fd8470d635/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20190114222345-bf090417da8b/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= @@ -675,6 +686,8 @@ gomodules.xyz/wait v0.2.0 h1:HnRIh+cvIrrKIFaXoYznCVVirv2/2xu3KzjSzsQmYAY= gomodules.xyz/wait v0.2.0/go.mod h1:g/epKzZQuCqgvhzhaoG4cSBNGHqnOrhFR4Q7szDJ1JM= gomodules.xyz/x v0.0.17 h1:Ik3wf0suCMiYPY0miFUh+q8BpjsUHc/7zvANbFViBQA= gomodules.xyz/x v0.0.17/go.mod h1:7R5182LvgWj1ZGlnpbhfSLsxM3lFN7LBettztpX+A2I= +gonum.org/v1/gonum v0.16.0 h1:5+ul4Swaf3ESvrOnidPp4GZbzf0mxVQpDCYUQE7OJfk= +gonum.org/v1/gonum v0.16.0/go.mod h1:fef3am4MQ93R2HHpKnLk4/Tbh/s0+wqD5nfa6Pnwy4E= google.golang.org/api v0.4.0/go.mod h1:8k5glujaEP+g9n7WNsDg8QP6cUVNI86fCNMcbazEtwE= google.golang.org/api v0.7.0/go.mod h1:WtwebWUNSVBH/HAw79HIFXZNqEvBhG+Ra+ax0hx3E3M= google.golang.org/api v0.8.0/go.mod h1:o4eAsZoiT+ibD93RtjEohWalFOjRDx6CVaqeizhEnKg= @@ -698,10 +711,10 @@ google.golang.org/genproto v0.0.0-20191108220845-16a3f7862a1a/go.mod h1:n3cpQtvx google.golang.org/genproto v0.0.0-20200526211855-cb27e3aa2013/go.mod h1:NbSheEEYHJ7i3ixzK3sjbqSGDJWnxyFXZblF3eUsNvo= google.golang.org/genproto v0.0.0-20240730163845-b1a4ccb954bf h1:OqdXDEakZCVtDiZTjcxfwbHPCT11ycCEsTKesBVKvyY= google.golang.org/genproto v0.0.0-20240730163845-b1a4ccb954bf/go.mod h1:mCr1K1c8kX+1iSBREvU3Juo11CB+QOEWxbRS01wWl5M= -google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb h1:p31xT4yrYrSM/G4Sn2+TNUkVhFCbG9y8itM2S6Th950= -google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:jbe3Bkdp+Dh2IrslsFCklNhweNTBgSYanP1UXhJDhKg= -google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb h1:TLPQVbx1GJ8VKZxz52VAxl1EBgKXXbTiU9Fc5fZeLn4= -google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb/go.mod h1:LuRYeWDFV6WOn90g357N17oMCaxpgCnbi/44qJvDn2I= +google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c h1:AtEkQdl5b6zsybXcbz00j1LwNodDuH6hVifIaNqk7NQ= +google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c/go.mod h1:ea2MjsO70ssTfCjiwHgI0ZFqcw45Ksuk2ckf9G468GA= +google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda h1:i/Q+bfisr7gq6feoJnS/DlpdwEL4ihp41fvRiM3Ork0= +google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda/go.mod h1:7i2o+ce6H/6BluujYR+kqX3GKH+dChPTQU19wjRPiGk= google.golang.org/grpc v1.19.0/go.mod h1:mqu4LbDTu4XGKhr4mRzUsmM4RtVoemTSY81AxZiDr8c= google.golang.org/grpc v1.20.1/go.mod h1:10oTOabMzJvdu6/UiuZezV6QK5dSlG84ov/aaiqXj38= google.golang.org/grpc v1.21.1/go.mod h1:oYelfM1adQP15Ek0mdvEgi9Df8B9CZIaU1084ijfRaM= @@ -709,8 +722,8 @@ google.golang.org/grpc v1.23.0/go.mod h1:Y5yQAOtifL1yxbo5wqy6BxZv8vAUGQwXBOALyac google.golang.org/grpc v1.25.1/go.mod h1:c3i+UQWmh7LiEpx4sFZnkU36qjEYZ0imhYfXVyQciAY= google.golang.org/grpc v1.27.0/go.mod h1:qbnxyOmOxrQa7FizSgH+ReBfzJrCY1pSN7KXBS8abTk= google.golang.org/grpc v1.33.2/go.mod h1:JMHMWHQWaTccqQQlmk3MJZS+GWXOdAesneDmEnv2fbc= -google.golang.org/grpc v1.72.1 h1:HR03wO6eyZ7lknl75XlxABNVLLFc2PAb6mHlYh756mA= -google.golang.org/grpc v1.72.1/go.mod h1:wH5Aktxcg25y1I3w7H69nHfXdOG3UiadoBtjh3izSDM= +google.golang.org/grpc v1.76.0 h1:UnVkv1+uMLYXoIz6o7chp59WfQUYA2ex/BXQ9rHZu7A= +google.golang.org/grpc v1.76.0/go.mod h1:Ju12QI8M6iQJtbcsV+awF5a4hfJMLi4X0JLo94ULZ6c= google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8= google.golang.org/protobuf v0.0.0-20200221191635-4d8936d0db64/go.mod h1:kwYJMbMJ01Woi6D6+Kah6886xMZcty6N08ah7+eCXa0= google.golang.org/protobuf v0.0.0-20200228230310-ab0ca4ff8a60/go.mod h1:cfTl7dwQJ+fmap5saPgwCLgHXTUD7jkjRqWcaiX5VyM= @@ -784,8 +797,8 @@ kmodules.xyz/monitoring-agent-api v0.34.0 h1:SNgKvC1j8oYWQcdClyV2T5GsOQoG40c3pK9 kmodules.xyz/monitoring-agent-api v0.34.0/go.mod h1:XFDfMHDZQeNEPdTDeDr4M0dT4UCWs+4IYzgHw7JDlms= kmodules.xyz/offshoot-api v0.34.0 h1:HnOOp8FrCjTWjtNApRDo6Ahe79tOlLrJmyye4xxO4Kk= kmodules.xyz/offshoot-api v0.34.0/go.mod h1:F+B59yYw4CZJ4uD4xu6C+mMLzIXUtuH7E+SbDICl9jE= -kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b h1:47Zn1Ir7+NkjiQgfTGuuChRdPQvAb/IAmJXkB8+89a0= -kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b/go.mod h1:1v8EABmDsiQW5ru3QVR8itrTbWyyDkd0oLoStryCrc4= +kubevault.dev/apimachinery v0.24.0-rc.0 h1:BNGX/kO6rK1kG+U+E0VPmTbguym7fzrcUOeCs5brL4M= +kubevault.dev/apimachinery v0.24.0-rc.0/go.mod h1:vyd2IxokWQV0FdE9t9C3T8EJplt4tVJtCXBDYZ0K8u8= rsc.io/binaryregexp v0.2.0/go.mod h1:qTv7/COck+e2FymRvadv62gMdZztPaShugOCi3I+8D8= sigs.k8s.io/json v0.0.0-20250730193827-2d320260d730 h1:IpInykpT6ceI+QxKBbEflcR5EXP7sU1kvOlxwZh5txg= sigs.k8s.io/json v0.0.0-20250730193827-2d320260d730/go.mod h1:mdzfpAEoE6DHQEN0uh9ZbOCuHbLK5wOm7dK4ctXE9Tg= diff --git a/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md b/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md index f95a504fe..fabe5e43d 100644 --- a/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md +++ b/vendor/github.com/Masterminds/semver/v3/CHANGELOG.md @@ -1,5 +1,31 @@ # Changelog +## 3.4.0 (2025-06-27) + +### Added + +- #268: Added property to Constraints to include prereleases for Check and Validate + +### Changed + +- #263: Updated Go testing for 1.24, 1.23, and 1.22 +- #269: Updated the error message handling for message case and wrapping errors +- #266: Restore the ability to have leading 0's when parsing with NewVersion. + Opt-out of this by setting CoerceNewVersion to false. + +### Fixed + +- #257: Fixed the CodeQL link (thanks @dmitris) +- #262: Restored detailed errors when failed to parse with NewVersion. Opt-out + of this by setting DetailedNewVersionErrors to false for faster performance. +- #267: Handle pre-releases for an "and" group if one constraint includes them + +## 3.3.1 (2024-11-19) + +### Fixed + +- #253: Fix for allowing some version that were invalid + ## 3.3.0 (2024-08-27) ### Added @@ -137,7 +163,7 @@ functions. These are described in the added and changed sections below. - #78: Fix unchecked error in example code (thanks @ravron) - #70: Fix the handling of pre-releases and the 0.0.0 release edge case - #97: Fixed copyright file for proper display on GitHub -- #107: Fix handling prerelease when sorting alphanum and num +- #107: Fix handling prerelease when sorting alphanum and num - #109: Fixed where Validate sometimes returns wrong message on error ## 1.4.2 (2018-04-10) diff --git a/vendor/github.com/Masterminds/semver/v3/README.md b/vendor/github.com/Masterminds/semver/v3/README.md index ed5693608..2f56c676a 100644 --- a/vendor/github.com/Masterminds/semver/v3/README.md +++ b/vendor/github.com/Masterminds/semver/v3/README.md @@ -50,6 +50,18 @@ other versions, convert the version back into a string, and get the original string. Getting the original string is useful if the semantic version was coerced into a valid form. +There are package level variables that affect how `NewVersion` handles parsing. + +- `CoerceNewVersion` is `true` by default. When set to `true` it coerces non-compliant + versions into SemVer. For example, allowing a leading 0 in a major, minor, or patch + part. This enables the use of CalVer in versions even when not compliant with SemVer. + When set to `false` less coercion work is done. +- `DetailedNewVersionErrors` provides more detailed errors. It only has an affect when + `CoerceNewVersion` is set to `false`. When `DetailedNewVersionErrors` is set to `true` + it can provide some more insight into why a version is invalid. Setting + `DetailedNewVersionErrors` to `false` is faster on performance but provides less + detailed error messages if a version fails to parse. + ## Sorting Semantic Versions A set of versions can be sorted using the `sort` package from the standard library. @@ -160,6 +172,10 @@ means `>=1.2.3-BETA` will return `1.2.3-alpha`. What you might expect from case sensitivity doesn't apply here. This is due to ASCII sort ordering which is what the spec specifies. +The `Constraints` instance returned from `semver.NewConstraint()` has a property +`IncludePrerelease` that, when set to true, will return prerelease versions when calls +to `Check()` and `Validate()` are made. + ### Hyphen Range Comparisons There are multiple methods to handle ranges and the first is hyphens ranges. @@ -250,7 +266,7 @@ or [create a pull request](https://github.com/Masterminds/semver/pulls). Security is an important consideration for this project. The project currently uses the following tools to help discover security issues: -* [CodeQL](https://github.com/Masterminds/semver) +* [CodeQL](https://codeql.github.com) * [gosec](https://github.com/securego/gosec) * Daily Fuzz testing diff --git a/vendor/github.com/Masterminds/semver/v3/constraints.go b/vendor/github.com/Masterminds/semver/v3/constraints.go index 8461c7ed9..8b7a10f83 100644 --- a/vendor/github.com/Masterminds/semver/v3/constraints.go +++ b/vendor/github.com/Masterminds/semver/v3/constraints.go @@ -12,6 +12,13 @@ import ( // checked against. type Constraints struct { constraints [][]*constraint + containsPre []bool + + // IncludePrerelease specifies if pre-releases should be included in + // the results. Note, if a constraint range has a prerelease than + // prereleases will be included for that AND group even if this is + // set to false. + IncludePrerelease bool } // NewConstraint returns a Constraints instance that a Version instance can @@ -22,11 +29,10 @@ func NewConstraint(c string) (*Constraints, error) { c = rewriteRange(c) ors := strings.Split(c, "||") - or := make([][]*constraint, len(ors)) + lenors := len(ors) + or := make([][]*constraint, lenors) + hasPre := make([]bool, lenors) for k, v := range ors { - - // TODO: Find a way to validate and fetch all the constraints in a simpler form - // Validate the segment if !validConstraintRegex.MatchString(v) { return nil, fmt.Errorf("improper constraint: %s", v) @@ -43,12 +49,22 @@ func NewConstraint(c string) (*Constraints, error) { return nil, err } + // If one of the constraints has a prerelease record this. + // This information is used when checking all in an "and" + // group to ensure they all check for prereleases. + if pc.con.pre != "" { + hasPre[k] = true + } + result[i] = pc } or[k] = result } - o := &Constraints{constraints: or} + o := &Constraints{ + constraints: or, + containsPre: hasPre, + } return o, nil } @@ -57,10 +73,10 @@ func (cs Constraints) Check(v *Version) bool { // TODO(mattfarina): For v4 of this library consolidate the Check and Validate // functions as the underlying functions make that possible now. // loop over the ORs and check the inner ANDs - for _, o := range cs.constraints { + for i, o := range cs.constraints { joy := true for _, c := range o { - if check, _ := c.check(v); !check { + if check, _ := c.check(v, (cs.IncludePrerelease || cs.containsPre[i])); !check { joy = false break } @@ -83,12 +99,12 @@ func (cs Constraints) Validate(v *Version) (bool, []error) { // Capture the prerelease message only once. When it happens the first time // this var is marked var prerelesase bool - for _, o := range cs.constraints { + for i, o := range cs.constraints { joy := true for _, c := range o { // Before running the check handle the case there the version is // a prerelease and the check is not searching for prereleases. - if c.con.pre == "" && v.pre != "" { + if !(cs.IncludePrerelease || cs.containsPre[i]) && v.pre != "" { if !prerelesase { em := fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) e = append(e, em) @@ -98,7 +114,7 @@ func (cs Constraints) Validate(v *Version) (bool, []error) { } else { - if _, err := c.check(v); err != nil { + if _, err := c.check(v, (cs.IncludePrerelease || cs.containsPre[i])); err != nil { e = append(e, err) joy = false } @@ -227,8 +243,8 @@ type constraint struct { } // Check if a version meets the constraint -func (c *constraint) check(v *Version) (bool, error) { - return constraintOps[c.origfunc](v, c) +func (c *constraint) check(v *Version, includePre bool) (bool, error) { + return constraintOps[c.origfunc](v, c, includePre) } // String prints an individual constraint into a string @@ -236,7 +252,7 @@ func (c *constraint) string() string { return c.origfunc + c.orig } -type cfunc func(v *Version, c *constraint) (bool, error) +type cfunc func(v *Version, c *constraint, includePre bool) (bool, error) func parseConstraint(c string) (*constraint, error) { if len(c) > 0 { @@ -272,7 +288,7 @@ func parseConstraint(c string) (*constraint, error) { // The constraintRegex should catch any regex parsing errors. So, // we should never get here. - return nil, errors.New("constraint Parser Error") + return nil, errors.New("constraint parser error") } cs.con = con @@ -290,7 +306,7 @@ func parseConstraint(c string) (*constraint, error) { // The constraintRegex should catch any regex parsing errors. So, // we should never get here. - return nil, errors.New("constraint Parser Error") + return nil, errors.New("constraint parser error") } cs := &constraint{ @@ -305,16 +321,14 @@ func parseConstraint(c string) (*constraint, error) { } // Constraint functions -func constraintNotEqual(v *Version, c *constraint) (bool, error) { - if c.dirty { - - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { - return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) - } +func constraintNotEqual(v *Version, c *constraint, includePre bool) (bool, error) { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { + return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) + } + if c.dirty { if c.con.Major() != v.Major() { return true, nil } @@ -345,12 +359,11 @@ func constraintNotEqual(v *Version, c *constraint) (bool, error) { return true, nil } -func constraintGreaterThan(v *Version, c *constraint) (bool, error) { +func constraintGreaterThan(v *Version, c *constraint, includePre bool) (bool, error) { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) } @@ -391,11 +404,10 @@ func constraintGreaterThan(v *Version, c *constraint) (bool, error) { return false, fmt.Errorf("%s is less than or equal to %s", v, c.orig) } -func constraintLessThan(v *Version, c *constraint) (bool, error) { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { +func constraintLessThan(v *Version, c *constraint, includePre bool) (bool, error) { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) } @@ -406,12 +418,11 @@ func constraintLessThan(v *Version, c *constraint) (bool, error) { return false, fmt.Errorf("%s is greater than or equal to %s", v, c.orig) } -func constraintGreaterThanEqual(v *Version, c *constraint) (bool, error) { +func constraintGreaterThanEqual(v *Version, c *constraint, includePre bool) (bool, error) { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) } @@ -422,11 +433,10 @@ func constraintGreaterThanEqual(v *Version, c *constraint) (bool, error) { return false, fmt.Errorf("%s is less than %s", v, c.orig) } -func constraintLessThanEqual(v *Version, c *constraint) (bool, error) { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { +func constraintLessThanEqual(v *Version, c *constraint, includePre bool) (bool, error) { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) } @@ -455,11 +465,10 @@ func constraintLessThanEqual(v *Version, c *constraint) (bool, error) { // ~1.2, ~1.2.x, ~>1.2, ~>1.2.x --> >=1.2.0, <1.3.0 // ~1.2.3, ~>1.2.3 --> >=1.2.3, <1.3.0 // ~1.2.0, ~>1.2.0 --> >=1.2.0, <1.3.0 -func constraintTilde(v *Version, c *constraint) (bool, error) { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { +func constraintTilde(v *Version, c *constraint, includePre bool) (bool, error) { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) } @@ -487,16 +496,15 @@ func constraintTilde(v *Version, c *constraint) (bool, error) { // When there is a .x (dirty) status it automatically opts in to ~. Otherwise // it's a straight = -func constraintTildeOrEqual(v *Version, c *constraint) (bool, error) { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { +func constraintTildeOrEqual(v *Version, c *constraint, includePre bool) (bool, error) { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) } if c.dirty { - return constraintTilde(v, c) + return constraintTilde(v, c, includePre) } eq := v.Equal(c.con) @@ -516,11 +524,10 @@ func constraintTildeOrEqual(v *Version, c *constraint) (bool, error) { // ^0.0.3 --> >=0.0.3 <0.0.4 // ^0.0 --> >=0.0.0 <0.1.0 // ^0 --> >=0.0.0 <1.0.0 -func constraintCaret(v *Version, c *constraint) (bool, error) { - // If there is a pre-release on the version but the constraint isn't looking - // for them assume that pre-releases are not compatible. See issue 21 for - // more details. - if v.Prerelease() != "" && c.con.Prerelease() == "" { +func constraintCaret(v *Version, c *constraint, includePre bool) (bool, error) { + // The existence of prereleases is checked at the group level and passed in. + // Exit early if the version has a prerelease but those are to be ignored. + if v.Prerelease() != "" && !includePre { return false, fmt.Errorf("%s is a prerelease version and the constraint is only looking for release versions", v) } diff --git a/vendor/github.com/Masterminds/semver/v3/version.go b/vendor/github.com/Masterminds/semver/v3/version.go index 304edc342..7a3ba7388 100644 --- a/vendor/github.com/Masterminds/semver/v3/version.go +++ b/vendor/github.com/Masterminds/semver/v3/version.go @@ -14,28 +14,40 @@ import ( // The compiled version of the regex created at init() is cached here so it // only needs to be created once. var versionRegex *regexp.Regexp +var looseVersionRegex *regexp.Regexp + +// CoerceNewVersion sets if leading 0's are allowd in the version part. Leading 0's are +// not allowed in a valid semantic version. When set to true, NewVersion will coerce +// leading 0's into a valid version. +var CoerceNewVersion = true + +// DetailedNewVersionErrors specifies if detailed errors are returned from the NewVersion +// function. This is used when CoerceNewVersion is set to false. If set to false +// ErrInvalidSemVer is returned for an invalid version. This does not apply to +// StrictNewVersion. Setting this function to false returns errors more quickly. +var DetailedNewVersionErrors = true var ( // ErrInvalidSemVer is returned a version is found to be invalid when // being parsed. - ErrInvalidSemVer = errors.New("Invalid Semantic Version") + ErrInvalidSemVer = errors.New("invalid semantic version") // ErrEmptyString is returned when an empty string is passed in for parsing. - ErrEmptyString = errors.New("Version string empty") + ErrEmptyString = errors.New("version string empty") // ErrInvalidCharacters is returned when invalid characters are found as // part of a version - ErrInvalidCharacters = errors.New("Invalid characters in version") + ErrInvalidCharacters = errors.New("invalid characters in version") // ErrSegmentStartsZero is returned when a version segment starts with 0. // This is invalid in SemVer. - ErrSegmentStartsZero = errors.New("Version segment starts with 0") + ErrSegmentStartsZero = errors.New("version segment starts with 0") // ErrInvalidMetadata is returned when the metadata is an invalid format - ErrInvalidMetadata = errors.New("Invalid Metadata string") + ErrInvalidMetadata = errors.New("invalid metadata string") // ErrInvalidPrerelease is returned when the pre-release is an invalid format - ErrInvalidPrerelease = errors.New("Invalid Prerelease string") + ErrInvalidPrerelease = errors.New("invalid prerelease string") ) // semVerRegex is the regular expression used to parse a semantic version. @@ -45,6 +57,12 @@ const semVerRegex string = `v?(0|[1-9]\d*)(?:\.(0|[1-9]\d*))?(?:\.(0|[1-9]\d*))? `(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?` + `(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?` +// looseSemVerRegex is a regular expression that lets invalid semver expressions through +// with enough detail that certain errors can be checked for. +const looseSemVerRegex string = `v?([0-9]+)(\.[0-9]+)?(\.[0-9]+)?` + + `(-([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` + + `(\+([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` + // Version represents a single semantic version. type Version struct { major, minor, patch uint64 @@ -55,6 +73,7 @@ type Version struct { func init() { versionRegex = regexp.MustCompile("^" + semVerRegex + "$") + looseVersionRegex = regexp.MustCompile("^" + looseSemVerRegex + "$") } const ( @@ -142,8 +161,27 @@ func StrictNewVersion(v string) (*Version, error) { // attempts to convert it to SemVer. If you want to validate it was a strict // semantic version at parse time see StrictNewVersion(). func NewVersion(v string) (*Version, error) { + if CoerceNewVersion { + return coerceNewVersion(v) + } m := versionRegex.FindStringSubmatch(v) if m == nil { + + // Disabling detailed errors is first so that it is in the fast path. + if !DetailedNewVersionErrors { + return nil, ErrInvalidSemVer + } + + // Check for specific errors with the semver string and return a more detailed + // error. + m = looseVersionRegex.FindStringSubmatch(v) + if m == nil { + return nil, ErrInvalidSemVer + } + err := validateVersion(m) + if err != nil { + return nil, err + } return nil, ErrInvalidSemVer } @@ -156,13 +194,13 @@ func NewVersion(v string) (*Version, error) { var err error sv.major, err = strconv.ParseUint(m[1], 10, 64) if err != nil { - return nil, fmt.Errorf("Error parsing version segment: %s", err) + return nil, fmt.Errorf("error parsing version segment: %w", err) } if m[2] != "" { sv.minor, err = strconv.ParseUint(m[2], 10, 64) if err != nil { - return nil, fmt.Errorf("Error parsing version segment: %s", err) + return nil, fmt.Errorf("error parsing version segment: %w", err) } } else { sv.minor = 0 @@ -171,7 +209,61 @@ func NewVersion(v string) (*Version, error) { if m[3] != "" { sv.patch, err = strconv.ParseUint(m[3], 10, 64) if err != nil { - return nil, fmt.Errorf("Error parsing version segment: %s", err) + return nil, fmt.Errorf("error parsing version segment: %w", err) + } + } else { + sv.patch = 0 + } + + // Perform some basic due diligence on the extra parts to ensure they are + // valid. + + if sv.pre != "" { + if err = validatePrerelease(sv.pre); err != nil { + return nil, err + } + } + + if sv.metadata != "" { + if err = validateMetadata(sv.metadata); err != nil { + return nil, err + } + } + + return sv, nil +} + +func coerceNewVersion(v string) (*Version, error) { + m := looseVersionRegex.FindStringSubmatch(v) + if m == nil { + return nil, ErrInvalidSemVer + } + + sv := &Version{ + metadata: m[8], + pre: m[5], + original: v, + } + + var err error + sv.major, err = strconv.ParseUint(m[1], 10, 64) + if err != nil { + return nil, fmt.Errorf("error parsing version segment: %w", err) + } + + if m[2] != "" { + sv.minor, err = strconv.ParseUint(strings.TrimPrefix(m[2], "."), 10, 64) + if err != nil { + return nil, fmt.Errorf("error parsing version segment: %w", err) + } + } else { + sv.minor = 0 + } + + if m[3] != "" { + sv.patch, err = strconv.ParseUint(strings.TrimPrefix(m[3], "."), 10, 64) + if err != nil { + return nil, fmt.Errorf("error parsing version segment: %w", err) } } else { sv.patch = 0 @@ -615,7 +707,7 @@ func validatePrerelease(p string) error { eparts := strings.Split(p, ".") for _, p := range eparts { if p == "" { - return ErrInvalidMetadata + return ErrInvalidPrerelease } else if containsOnly(p, num) { if len(p) > 1 && p[0] == '0' { return ErrSegmentStartsZero @@ -643,3 +735,54 @@ func validateMetadata(m string) error { } return nil } + +// validateVersion checks for common validation issues but may not catch all errors +func validateVersion(m []string) error { + var err error + var v string + if m[1] != "" { + if len(m[1]) > 1 && m[1][0] == '0' { + return ErrSegmentStartsZero + } + _, err = strconv.ParseUint(m[1], 10, 64) + if err != nil { + return fmt.Errorf("error parsing version segment: %w", err) + } + } + + if m[2] != "" { + v = strings.TrimPrefix(m[2], ".") + if len(v) > 1 && v[0] == '0' { + return ErrSegmentStartsZero + } + _, err = strconv.ParseUint(v, 10, 64) + if err != nil { + return fmt.Errorf("error parsing version segment: %w", err) + } + } + + if m[3] != "" { + v = strings.TrimPrefix(m[3], ".") + if len(v) > 1 && v[0] == '0' { + return ErrSegmentStartsZero + } + _, err = strconv.ParseUint(v, 10, 64) + if err != nil { + return fmt.Errorf("error parsing version segment: %w", err) + } + } + + if m[5] != "" { + if err = validatePrerelease(m[5]); err != nil { + return err + } + } + + if m[8] != "" { + if err = validateMetadata(m[8]); err != nil { + return err + } + } + + return nil +} diff --git a/vendor/github.com/go-jose/go-jose/v4/CHANGELOG.md b/vendor/github.com/go-jose/go-jose/v4/CHANGELOG.md deleted file mode 100644 index 6f717dbd8..000000000 --- a/vendor/github.com/go-jose/go-jose/v4/CHANGELOG.md +++ /dev/null @@ -1,96 +0,0 @@ -# v4.0.4 - -## Fixed - - - Reverted "Allow unmarshalling JSONWebKeySets with unsupported key types" as a - breaking change. See #136 / #137. - -# v4.0.3 - -## Changed - - - Allow unmarshalling JSONWebKeySets with unsupported key types (#130) - - Document that OpaqueKeyEncrypter can't be implemented (for now) (#129) - - Dependency updates - -# v4.0.2 - -## Changed - - - Improved documentation of Verify() to note that JSONWebKeySet is a supported - argument type (#104) - - Defined exported error values for missing x5c header and unsupported elliptic - curves error cases (#117) - -# v4.0.1 - -## Fixed - - - An attacker could send a JWE containing compressed data that used large - amounts of memory and CPU when decompressed by `Decrypt` or `DecryptMulti`. - Those functions now return an error if the decompressed data would exceed - 250kB or 10x the compressed size (whichever is larger). Thanks to - Enze Wang@Alioth and Jianjun Chen@Zhongguancun Lab (@zer0yu and @chenjj) - for reporting. - -# v4.0.0 - -This release makes some breaking changes in order to more thoroughly -address the vulnerabilities discussed in [Three New Attacks Against JSON Web -Tokens][1], "Sign/encrypt confusion", "Billion hash attack", and "Polyglot -token". - -## Changed - - - Limit JWT encryption types (exclude password or public key types) (#78) - - Enforce minimum length for HMAC keys (#85) - - jwt: match any audience in a list, rather than requiring all audiences (#81) - - jwt: accept only Compact Serialization (#75) - - jws: Add expected algorithms for signatures (#74) - - Require specifying expected algorithms for ParseEncrypted, - ParseSigned, ParseDetached, jwt.ParseEncrypted, jwt.ParseSigned, - jwt.ParseSignedAndEncrypted (#69, #74) - - Usually there is a small, known set of appropriate algorithms for a program - to use and it's a mistake to allow unexpected algorithms. For instance the - "billion hash attack" relies in part on programs accepting the PBES2 - encryption algorithm and doing the necessary work even if they weren't - specifically configured to allow PBES2. - - Revert "Strip padding off base64 strings" (#82) - - The specs require base64url encoding without padding. - - Minimum supported Go version is now 1.21 - -## Added - - - ParseSignedCompact, ParseSignedJSON, ParseEncryptedCompact, ParseEncryptedJSON. - - These allow parsing a specific serialization, as opposed to ParseSigned and - ParseEncrypted, which try to automatically detect which serialization was - provided. It's common to require a specific serialization for a specific - protocol - for instance JWT requires Compact serialization. - -[1]: https://i.blackhat.com/BH-US-23/Presentations/US-23-Tervoort-Three-New-Attacks-Against-JSON-Web-Tokens.pdf - -# v3.0.2 - -## Fixed - - - DecryptMulti: handle decompression error (#19) - -## Changed - - - jwe/CompactSerialize: improve performance (#67) - - Increase the default number of PBKDF2 iterations to 600k (#48) - - Return the proper algorithm for ECDSA keys (#45) - -## Added - - - Add Thumbprint support for opaque signers (#38) - -# v3.0.1 - -## Fixed - - - Security issue: an attacker specifying a large "p2c" value can cause - JSONWebEncryption.Decrypt and JSONWebEncryption.DecryptMulti to consume large - amounts of CPU, causing a DoS. Thanks to Matt Schwager (@mschwager) for the - disclosure and to Tom Tervoort for originally publishing the category of attack. - https://i.blackhat.com/BH-US-23/Presentations/US-23-Tervoort-Three-New-Attacks-Against-JSON-Web-Tokens.pdf diff --git a/vendor/github.com/go-jose/go-jose/v4/README.md b/vendor/github.com/go-jose/go-jose/v4/README.md index 02b574954..ca5f1d790 100644 --- a/vendor/github.com/go-jose/go-jose/v4/README.md +++ b/vendor/github.com/go-jose/go-jose/v4/README.md @@ -3,7 +3,6 @@ [![godoc](https://pkg.go.dev/badge/github.com/go-jose/go-jose/v4.svg)](https://pkg.go.dev/github.com/go-jose/go-jose/v4) [![godoc](https://pkg.go.dev/badge/github.com/go-jose/go-jose/v4/jwt.svg)](https://pkg.go.dev/github.com/go-jose/go-jose/v4/jwt) [![license](https://img.shields.io/badge/license-apache_2.0-blue.svg?style=flat)](https://raw.githubusercontent.com/go-jose/go-jose/master/LICENSE) -[![test](https://img.shields.io/github/checks-status/go-jose/go-jose/v4)](https://github.com/go-jose/go-jose/actions) Package jose aims to provide an implementation of the Javascript Object Signing and Encryption set of standards. This includes support for JSON Web Encryption, @@ -29,17 +28,20 @@ libraries in other languages. ### Versions -[Version 4](https://github.com/go-jose/go-jose) -([branch](https://github.com/go-jose/go-jose/tree/main), -[doc](https://pkg.go.dev/github.com/go-jose/go-jose/v4), [releases](https://github.com/go-jose/go-jose/releases)) is the current stable version: +The forthcoming Version 5 will be released with several breaking API changes, +and will require Golang's `encoding/json/v2`, which is currently requires +Go 1.25 built with GOEXPERIMENT=jsonv2. + +Version 4 is the current stable version: import "github.com/go-jose/go-jose/v4" -The old [square/go-jose](https://github.com/square/go-jose) repo contains the prior v1 and v2 versions, which -are still useable but not actively developed anymore. +It supports at least the current and previous Golang release. Currently it +requires Golang 1.23. + +Version 3 is only receiving critical security updates. Migration to Version 4 is recommended. -Version 3, in this repo, is still receiving security fixes but not functionality -updates. +Versions 1 and 2 are obsolete, but can be found in the old repository, [square/go-jose](https://github.com/square/go-jose). ### Supported algorithms @@ -47,36 +49,36 @@ See below for a table of supported algorithms. Algorithm identifiers match the names in the [JSON Web Algorithms](https://dx.doi.org/10.17487/RFC7518) standard where possible. The Godoc reference has a list of constants. - Key encryption | Algorithm identifier(s) - :------------------------- | :------------------------------ - RSA-PKCS#1v1.5 | RSA1_5 - RSA-OAEP | RSA-OAEP, RSA-OAEP-256 - AES key wrap | A128KW, A192KW, A256KW - AES-GCM key wrap | A128GCMKW, A192GCMKW, A256GCMKW - ECDH-ES + AES key wrap | ECDH-ES+A128KW, ECDH-ES+A192KW, ECDH-ES+A256KW - ECDH-ES (direct) | ECDH-ES1 - Direct encryption | dir1 +| Key encryption | Algorithm identifier(s) | +|:-----------------------|:-----------------------------------------------| +| RSA-PKCS#1v1.5 | RSA1_5 | +| RSA-OAEP | RSA-OAEP, RSA-OAEP-256 | +| AES key wrap | A128KW, A192KW, A256KW | +| AES-GCM key wrap | A128GCMKW, A192GCMKW, A256GCMKW | +| ECDH-ES + AES key wrap | ECDH-ES+A128KW, ECDH-ES+A192KW, ECDH-ES+A256KW | +| ECDH-ES (direct) | ECDH-ES1 | +| Direct encryption | dir1 | 1. Not supported in multi-recipient mode - Signing / MAC | Algorithm identifier(s) - :------------------------- | :------------------------------ - RSASSA-PKCS#1v1.5 | RS256, RS384, RS512 - RSASSA-PSS | PS256, PS384, PS512 - HMAC | HS256, HS384, HS512 - ECDSA | ES256, ES384, ES512 - Ed25519 | EdDSA2 +| Signing / MAC | Algorithm identifier(s) | +|:------------------|:------------------------| +| RSASSA-PKCS#1v1.5 | RS256, RS384, RS512 | +| RSASSA-PSS | PS256, PS384, PS512 | +| HMAC | HS256, HS384, HS512 | +| ECDSA | ES256, ES384, ES512 | +| Ed25519 | EdDSA2 | 2. Only available in version 2 of the package - Content encryption | Algorithm identifier(s) - :------------------------- | :------------------------------ - AES-CBC+HMAC | A128CBC-HS256, A192CBC-HS384, A256CBC-HS512 - AES-GCM | A128GCM, A192GCM, A256GCM +| Content encryption | Algorithm identifier(s) | +|:-------------------|:--------------------------------------------| +| AES-CBC+HMAC | A128CBC-HS256, A192CBC-HS384, A256CBC-HS512 | +| AES-GCM | A128GCM, A192GCM, A256GCM | - Compression | Algorithm identifiers(s) - :------------------------- | ------------------------------- - DEFLATE (RFC 1951) | DEF +| Compression | Algorithm identifiers(s) | +|:-------------------|--------------------------| +| DEFLATE (RFC 1951) | DEF | ### Supported key types @@ -85,12 +87,12 @@ library, and can be passed to corresponding functions such as `NewEncrypter` or `NewSigner`. Each of these keys can also be wrapped in a JWK if desired, which allows attaching a key id. - Algorithm(s) | Corresponding types - :------------------------- | ------------------------------- - RSA | *[rsa.PublicKey](https://pkg.go.dev/crypto/rsa/#PublicKey), *[rsa.PrivateKey](https://pkg.go.dev/crypto/rsa/#PrivateKey) - ECDH, ECDSA | *[ecdsa.PublicKey](https://pkg.go.dev/crypto/ecdsa/#PublicKey), *[ecdsa.PrivateKey](https://pkg.go.dev/crypto/ecdsa/#PrivateKey) - EdDSA1 | [ed25519.PublicKey](https://pkg.go.dev/crypto/ed25519#PublicKey), [ed25519.PrivateKey](https://pkg.go.dev/crypto/ed25519#PrivateKey) - AES, HMAC | []byte +| Algorithm(s) | Corresponding types | +|:------------------|--------------------------------------------------------------------------------------------------------------------------------------| +| RSA | *[rsa.PublicKey](https://pkg.go.dev/crypto/rsa/#PublicKey), *[rsa.PrivateKey](https://pkg.go.dev/crypto/rsa/#PrivateKey) | +| ECDH, ECDSA | *[ecdsa.PublicKey](https://pkg.go.dev/crypto/ecdsa/#PublicKey), *[ecdsa.PrivateKey](https://pkg.go.dev/crypto/ecdsa/#PrivateKey) | +| EdDSA1 | [ed25519.PublicKey](https://pkg.go.dev/crypto/ed25519#PublicKey), [ed25519.PrivateKey](https://pkg.go.dev/crypto/ed25519#PrivateKey) | +| AES, HMAC | []byte | 1. Only available in version 2 or later of the package diff --git a/vendor/github.com/go-jose/go-jose/v4/crypter.go b/vendor/github.com/go-jose/go-jose/v4/crypter.go index d81b03b44..ab02a28e2 100644 --- a/vendor/github.com/go-jose/go-jose/v4/crypter.go +++ b/vendor/github.com/go-jose/go-jose/v4/crypter.go @@ -286,6 +286,10 @@ func makeJWERecipient(alg KeyAlgorithm, encryptionKey interface{}) (recipientKey return newSymmetricRecipient(alg, encryptionKey) case string: return newSymmetricRecipient(alg, []byte(encryptionKey)) + case JSONWebKey: + recipient, err := makeJWERecipient(alg, encryptionKey.Key) + recipient.keyID = encryptionKey.KeyID + return recipient, err case *JSONWebKey: recipient, err := makeJWERecipient(alg, encryptionKey.Key) recipient.keyID = encryptionKey.KeyID diff --git a/vendor/github.com/go-jose/go-jose/v4/jwe.go b/vendor/github.com/go-jose/go-jose/v4/jwe.go index 9f1322dcc..6102f9100 100644 --- a/vendor/github.com/go-jose/go-jose/v4/jwe.go +++ b/vendor/github.com/go-jose/go-jose/v4/jwe.go @@ -274,7 +274,7 @@ func validateAlgEnc(headers rawHeader, keyAlgorithms []KeyAlgorithm, contentEncr if alg != "" && !containsKeyAlgorithm(keyAlgorithms, alg) { return fmt.Errorf("unexpected key algorithm %q; expected %q", alg, keyAlgorithms) } - if alg != "" && !containsContentEncryption(contentEncryption, enc) { + if enc != "" && !containsContentEncryption(contentEncryption, enc) { return fmt.Errorf("unexpected content encryption algorithm %q; expected %q", enc, contentEncryption) } return nil @@ -288,11 +288,20 @@ func ParseEncryptedCompact( keyAlgorithms []KeyAlgorithm, contentEncryption []ContentEncryption, ) (*JSONWebEncryption, error) { - // Five parts is four separators - if strings.Count(input, ".") != 4 { - return nil, fmt.Errorf("go-jose/go-jose: compact JWE format must have five parts") + var parts [5]string + var ok bool + + for i := range 4 { + parts[i], input, ok = strings.Cut(input, ".") + if !ok { + return nil, errors.New("go-jose/go-jose: compact JWE format must have five parts") + } + } + // Validate that the last part does not contain more dots + if strings.ContainsRune(input, '.') { + return nil, errors.New("go-jose/go-jose: compact JWE format must have five parts") } - parts := strings.SplitN(input, ".", 5) + parts[4] = input rawProtected, err := base64.RawURLEncoding.DecodeString(parts[0]) if err != nil { diff --git a/vendor/github.com/go-jose/go-jose/v4/jwk.go b/vendor/github.com/go-jose/go-jose/v4/jwk.go index 9e57e93ba..164d6a161 100644 --- a/vendor/github.com/go-jose/go-jose/v4/jwk.go +++ b/vendor/github.com/go-jose/go-jose/v4/jwk.go @@ -175,6 +175,8 @@ func (k JSONWebKey) MarshalJSON() ([]byte, error) { } // UnmarshalJSON reads a key from its JSON representation. +// +// Returns ErrUnsupportedKeyType for unrecognized or unsupported "kty" header values. func (k *JSONWebKey) UnmarshalJSON(data []byte) (err error) { var raw rawJSONWebKey err = json.Unmarshal(data, &raw) @@ -228,7 +230,7 @@ func (k *JSONWebKey) UnmarshalJSON(data []byte) (err error) { } key, err = raw.symmetricKey() case "OKP": - if raw.Crv == "Ed25519" && raw.X != nil { + if raw.Crv == "Ed25519" { if raw.D != nil { key, err = raw.edPrivateKey() if err == nil { @@ -238,17 +240,27 @@ func (k *JSONWebKey) UnmarshalJSON(data []byte) (err error) { key, err = raw.edPublicKey() keyPub = key } - } else { - return fmt.Errorf("go-jose/go-jose: unknown curve %s'", raw.Crv) } - default: - return fmt.Errorf("go-jose/go-jose: unknown json web key type '%s'", raw.Kty) + case "": + // kty MUST be present + err = fmt.Errorf("go-jose/go-jose: missing json web key type") } if err != nil { return } + if key == nil { + // RFC 7517: + // 5. JWK Set Format + // ... + // Implementations SHOULD ignore JWKs within a JWK Set that use "kty" + // (key type) values that are not understood by them, that are missing + // required members, or for which values are out of the supported + // ranges. + return ErrUnsupportedKeyType + } + if certPub != nil && keyPub != nil { if !reflect.DeepEqual(certPub, keyPub) { return errors.New("go-jose/go-jose: invalid JWK, public keys in key and x5c fields do not match") @@ -581,10 +593,10 @@ func fromEcPublicKey(pub *ecdsa.PublicKey) (*rawJSONWebKey, error) { func (key rawJSONWebKey) edPrivateKey() (ed25519.PrivateKey, error) { var missing []string - switch { - case key.D == nil: + if key.D == nil { missing = append(missing, "D") - case key.X == nil: + } + if key.X == nil { missing = append(missing, "X") } @@ -611,19 +623,21 @@ func (key rawJSONWebKey) edPublicKey() (ed25519.PublicKey, error) { func (key rawJSONWebKey) rsaPrivateKey() (*rsa.PrivateKey, error) { var missing []string - switch { - case key.N == nil: + if key.N == nil { missing = append(missing, "N") - case key.E == nil: + } + if key.E == nil { missing = append(missing, "E") - case key.D == nil: + } + if key.D == nil { missing = append(missing, "D") - case key.P == nil: + } + if key.P == nil { missing = append(missing, "P") - case key.Q == nil: + } + if key.Q == nil { missing = append(missing, "Q") } - if len(missing) > 0 { return nil, fmt.Errorf("go-jose/go-jose: invalid RSA private key, missing %s value(s)", strings.Join(missing, ", ")) } @@ -698,8 +712,19 @@ func (key rawJSONWebKey) ecPrivateKey() (*ecdsa.PrivateKey, error) { return nil, fmt.Errorf("go-jose/go-jose: unsupported elliptic curve '%s'", key.Crv) } - if key.X == nil || key.Y == nil || key.D == nil { - return nil, fmt.Errorf("go-jose/go-jose: invalid EC private key, missing x/y/d values") + var missing []string + if key.X == nil { + missing = append(missing, "X") + } + if key.Y == nil { + missing = append(missing, "Y") + } + if key.D == nil { + missing = append(missing, "D") + } + + if len(missing) > 0 { + return nil, fmt.Errorf("go-jose/go-jose: invalid EC private key, missing %s value(s)", strings.Join(missing, ", ")) } // The length of this octet string MUST be the full size of a coordinate for diff --git a/vendor/github.com/go-jose/go-jose/v4/jws.go b/vendor/github.com/go-jose/go-jose/v4/jws.go index d09d8ba50..c40bd3ec1 100644 --- a/vendor/github.com/go-jose/go-jose/v4/jws.go +++ b/vendor/github.com/go-jose/go-jose/v4/jws.go @@ -75,7 +75,14 @@ type Signature struct { original *rawSignatureInfo } -// ParseSigned parses a signed message in JWS Compact or JWS JSON Serialization. +// ParseSigned parses a signed message in JWS Compact or JWS JSON Serialization. Validation fails if +// the JWS is signed with an algorithm that isn't in the provided list of signature algorithms. +// Applications should decide for themselves which signature algorithms are acceptable. If you're +// not sure which signature algorithms your application might receive, consult the documentation of +// the program which provides them or the protocol that you are implementing. You can also try +// getting an example JWS and decoding it with a tool like https://jwt.io to see what its "alg" +// header parameter indicates. The signature on the JWS does not get validated during parsing. Call +// Verify() after parsing to validate the signature and obtain the payload. // // https://datatracker.ietf.org/doc/html/rfc7515#section-7 func ParseSigned( @@ -90,7 +97,14 @@ func ParseSigned( return parseSignedCompact(signature, nil, signatureAlgorithms) } -// ParseSignedCompact parses a message in JWS Compact Serialization. +// ParseSignedCompact parses a message in JWS Compact Serialization. Validation fails if the JWS is +// signed with an algorithm that isn't in the provided list of signature algorithms. Applications +// should decide for themselves which signature algorithms are acceptable.If you're not sure which +// signature algorithms your application might receive, consult the documentation of the program +// which provides them or the protocol that you are implementing. You can also try getting an +// example JWS and decoding it with a tool like https://jwt.io to see what its "alg" header +// parameter indicates. The signature on the JWS does not get validated during parsing. Call +// Verify() after parsing to validate the signature and obtain the payload. // // https://datatracker.ietf.org/doc/html/rfc7515#section-7.1 func ParseSignedCompact( @@ -101,6 +115,15 @@ func ParseSignedCompact( } // ParseDetached parses a signed message in compact serialization format with detached payload. +// Validation fails if the JWS is signed with an algorithm that isn't in the provided list of +// signature algorithms. Applications should decide for themselves which signature algorithms are +// acceptable. If you're not sure which signature algorithms your application might receive, consult +// the documentation of the program which provides them or the protocol that you are implementing. +// You can also try getting an example JWS and decoding it with a tool like https://jwt.io to see +// what its "alg" header parameter indicates. The signature on the JWS does not get validated during +// parsing. Call Verify() after parsing to validate the signature and obtain the payload. +// +// https://datatracker.ietf.org/doc/html/rfc7515#appendix-F func ParseDetached( signature string, payload []byte, @@ -181,6 +204,25 @@ func containsSignatureAlgorithm(haystack []SignatureAlgorithm, needle SignatureA return false } +// ErrUnexpectedSignatureAlgorithm is returned when the signature algorithm in +// the JWS header does not match one of the expected algorithms. +type ErrUnexpectedSignatureAlgorithm struct { + // Got is the signature algorithm found in the JWS header. + Got SignatureAlgorithm + expected []SignatureAlgorithm +} + +func (e *ErrUnexpectedSignatureAlgorithm) Error() string { + return fmt.Sprintf("unexpected signature algorithm %q; expected %q", e.Got, e.expected) +} + +func newErrUnexpectedSignatureAlgorithm(got SignatureAlgorithm, expected []SignatureAlgorithm) error { + return &ErrUnexpectedSignatureAlgorithm{ + Got: got, + expected: expected, + } +} + // sanitized produces a cleaned-up JWS object from the raw JSON. func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgorithm) (*JSONWebSignature, error) { if len(signatureAlgorithms) == 0 { @@ -236,8 +278,7 @@ func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgo alg := SignatureAlgorithm(signature.Header.Algorithm) if !containsSignatureAlgorithm(signatureAlgorithms, alg) { - return nil, fmt.Errorf("go-jose/go-jose: unexpected signature algorithm %q; expected %q", - alg, signatureAlgorithms) + return nil, newErrUnexpectedSignatureAlgorithm(alg, signatureAlgorithms) } if signature.header != nil { @@ -285,8 +326,7 @@ func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgo alg := SignatureAlgorithm(obj.Signatures[i].Header.Algorithm) if !containsSignatureAlgorithm(signatureAlgorithms, alg) { - return nil, fmt.Errorf("go-jose/go-jose: unexpected signature algorithm %q; expected %q", - alg, signatureAlgorithms) + return nil, newErrUnexpectedSignatureAlgorithm(alg, signatureAlgorithms) } if obj.Signatures[i].header != nil { @@ -321,35 +361,43 @@ func (parsed *rawJSONWebSignature) sanitized(signatureAlgorithms []SignatureAlgo return obj, nil } +const tokenDelim = "." + // parseSignedCompact parses a message in compact format. func parseSignedCompact( input string, payload []byte, signatureAlgorithms []SignatureAlgorithm, ) (*JSONWebSignature, error) { - // Three parts is two separators - if strings.Count(input, ".") != 2 { + protected, s, ok := strings.Cut(input, tokenDelim) + if !ok { // no period found + return nil, fmt.Errorf("go-jose/go-jose: compact JWS format must have three parts") + } + claims, sig, ok := strings.Cut(s, tokenDelim) + if !ok { // only one period found + return nil, fmt.Errorf("go-jose/go-jose: compact JWS format must have three parts") + } + if strings.ContainsRune(sig, '.') { // too many periods found return nil, fmt.Errorf("go-jose/go-jose: compact JWS format must have three parts") } - parts := strings.SplitN(input, ".", 3) - if parts[1] != "" && payload != nil { + if claims != "" && payload != nil { return nil, fmt.Errorf("go-jose/go-jose: payload is not detached") } - rawProtected, err := base64.RawURLEncoding.DecodeString(parts[0]) + rawProtected, err := base64.RawURLEncoding.DecodeString(protected) if err != nil { return nil, err } if payload == nil { - payload, err = base64.RawURLEncoding.DecodeString(parts[1]) + payload, err = base64.RawURLEncoding.DecodeString(claims) if err != nil { return nil, err } } - signature, err := base64.RawURLEncoding.DecodeString(parts[2]) + signature, err := base64.RawURLEncoding.DecodeString(sig) if err != nil { return nil, err } diff --git a/vendor/github.com/go-jose/go-jose/v4/shared.go b/vendor/github.com/go-jose/go-jose/v4/shared.go index 1ec339612..56a81b258 100644 --- a/vendor/github.com/go-jose/go-jose/v4/shared.go +++ b/vendor/github.com/go-jose/go-jose/v4/shared.go @@ -22,7 +22,6 @@ import ( "encoding/base64" "errors" "fmt" - "github.com/go-jose/go-jose/v4/json" ) diff --git a/vendor/github.com/go-jose/go-jose/v4/symmetric.go b/vendor/github.com/go-jose/go-jose/v4/symmetric.go index a69103b08..6176e0607 100644 --- a/vendor/github.com/go-jose/go-jose/v4/symmetric.go +++ b/vendor/github.com/go-jose/go-jose/v4/symmetric.go @@ -30,8 +30,6 @@ import ( "hash" "io" - "golang.org/x/crypto/pbkdf2" - josecipher "github.com/go-jose/go-jose/v4/cipher" ) @@ -330,7 +328,10 @@ func (ctx *symmetricKeyCipher) encryptKey(cek []byte, alg KeyAlgorithm) (recipie // derive key keyLen, h := getPbkdf2Params(alg) - key := pbkdf2.Key(ctx.key, salt, ctx.p2c, keyLen, h) + key, err := pbkdf2Key(h, string(ctx.key), salt, ctx.p2c, keyLen) + if err != nil { + return recipientInfo{}, nil + } // use AES cipher with derived key block, err := aes.NewCipher(key) @@ -432,7 +433,10 @@ func (ctx *symmetricKeyCipher) decryptKey(headers rawHeader, recipient *recipien // derive key keyLen, h := getPbkdf2Params(alg) - key := pbkdf2.Key(ctx.key, salt, p2c, keyLen, h) + key, err := pbkdf2Key(h, string(ctx.key), salt, p2c, keyLen) + if err != nil { + return nil, err + } // use AES cipher with derived key block, err := aes.NewCipher(key) diff --git a/vendor/github.com/go-jose/go-jose/v4/symmetric_go124.go b/vendor/github.com/go-jose/go-jose/v4/symmetric_go124.go new file mode 100644 index 000000000..6c5a4e7f2 --- /dev/null +++ b/vendor/github.com/go-jose/go-jose/v4/symmetric_go124.go @@ -0,0 +1,28 @@ +//go:build go1.24 + +/*- + * Copyright 2014 Square Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package jose + +import ( + "crypto/pbkdf2" + "hash" +) + +func pbkdf2Key(h func() hash.Hash, password string, salt []byte, iter, keyLen int) ([]byte, error) { + return pbkdf2.Key(h, password, salt, iter, keyLen) +} diff --git a/vendor/github.com/go-jose/go-jose/v4/symmetric_legacy.go b/vendor/github.com/go-jose/go-jose/v4/symmetric_legacy.go new file mode 100644 index 000000000..bdfc3d766 --- /dev/null +++ b/vendor/github.com/go-jose/go-jose/v4/symmetric_legacy.go @@ -0,0 +1,29 @@ +//go:build !go1.24 + +/*- + * Copyright 2014 Square Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package jose + +import ( + "hash" + + "golang.org/x/crypto/pbkdf2" +) + +func pbkdf2Key(h func() hash.Hash, password string, salt []byte, iter, keyLen int) ([]byte, error) { + return pbkdf2.Key([]byte(password), salt, iter, keyLen, h), nil +} diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 465f4b77c..accd7abaf 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -16,10 +16,23 @@ Package home: https://github.com/klauspost/cpuid ## installing -`go get -u github.com/klauspost/cpuid/v2` using modules. - +`go get -u github.com/klauspost/cpuid/v2` using modules. Drop `v2` for others. +Installing binary: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +Or download binaries from release page: https://github.com/klauspost/cpuid/releases + +### Homebrew + +For macOS/Linux users, you can install via [brew](https://brew.sh/) + +```sh +$ brew install cpuid +``` + ## example ```Go @@ -39,10 +52,10 @@ func main() { fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore) fmt.Println("LogicalCores:", CPU.LogicalCores) fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID) - fmt.Println("Features:", fmt.Sprintf(strings.Join(CPU.FeatureSet(), ","))) + fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ",")) fmt.Println("Cacheline bytes:", CPU.CacheLine) fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes") - fmt.Println("L1 Instruction Cache:", CPU.Cache.L1D, "bytes") + fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes") fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes") fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes") fmt.Println("Frequency", CPU.Hz, "hz") @@ -77,10 +90,14 @@ We have Streaming SIMD 2 Extensions The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. +To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc. +This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported. + Note that for some cpu/os combinations some features will not be detected. `amd64` has rather good support and should work reliably on all platforms. -Note that hypervisors may not pass through all CPU features. +Note that hypervisors may not pass through all CPU features through to the guest OS, +so even if your host supports a feature it may not be visible on guests. ## arm64 feature detection @@ -132,6 +149,345 @@ func main() { } ``` +## commandline + +Download as binary from: https://github.com/klauspost/cpuid/releases + +Install from source: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +### Example + +``` +λ cpuid +Name: AMD Ryzen 9 3950X 16-Core Processor +Vendor String: AuthenticAMD +Vendor ID: AMD +PhysicalCores: 16 +Threads Per Core: 2 +Logical Cores: 32 +CPU Family 23 Model: 113 +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE +Microarchitecture level: 3 +Cacheline bytes: 64 +L1 Instruction Cache: 32768 bytes +L1 Data Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes + +``` +### JSON Output: + +``` +λ cpuid --json +{ + "BrandName": "AMD Ryzen 9 3950X 16-Core Processor", + "VendorID": 2, + "VendorString": "AuthenticAMD", + "PhysicalCores": 16, + "ThreadsPerCore": 2, + "LogicalCores": 32, + "Family": 23, + "Model": 113, + "CacheLine": 64, + "Hz": 0, + "BoostFreq": 0, + "Cache": { + "L1I": 32768, + "L1D": 32768, + "L2": 524288, + "L3": 16777216 + }, + "SGX": { + "Available": false, + "LaunchControl": false, + "SGX1Supported": false, + "SGX2Supported": false, + "MaxEnclaveSizeNot64": 0, + "MaxEnclaveSize64": 0, + "EPCSections": null + }, + "Features": [ + "ADX", + "AESNI", + "AVX", + "AVX2", + "BMI1", + "BMI2", + "CLMUL", + "CLZERO", + "CMOV", + "CMPXCHG8", + "CPBOOST", + "CX16", + "F16C", + "FMA3", + "FXSR", + "FXSROPT", + "HTT", + "HYPERVISOR", + "LAHF", + "LZCNT", + "MCAOVERFLOW", + "MMX", + "MMXEXT", + "MOVBE", + "NX", + "OSXSAVE", + "POPCNT", + "RDRAND", + "RDSEED", + "RDTSCP", + "SCE", + "SHA", + "SSE", + "SSE2", + "SSE3", + "SSE4", + "SSE42", + "SSE4A", + "SSSE3", + "SUCCOR", + "X87", + "XSAVE" + ], + "X64Level": 3 +} +``` + +### Check CPU microarch level + +``` +λ cpuid --check-level=3 +2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3. +Exit Code 0 + +λ cpuid --check-level=4 +2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3. +Exit Code 1 +``` + + +## Available flags + +### x86 & amd64 + +| Feature Flag | Description | +|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) | +| AESNI | Advanced Encryption Standard New Instructions | +| AMD3DNOW | AMD 3DNOW | +| AMD3DNOWEXT | AMD 3DNowExt | +| AMXBF16 | Tile computational operations on BFLOAT16 numbers | +| AMXINT8 | Tile computational operations on 8-bit integers | +| AMXFP16 | Tile computational operations on FP16 numbers | +| AMXTILE | Tile architecture | +| AVX | AVX functions | +| AVX2 | AVX2 functions | +| AVX512BF16 | AVX-512 BFLOAT16 Instructions | +| AVX512BITALG | AVX-512 Bit Algorithms | +| AVX512BW | AVX-512 Byte and Word Instructions | +| AVX512CD | AVX-512 Conflict Detection Instructions | +| AVX512DQ | AVX-512 Doubleword and Quadword Instructions | +| AVX512ER | AVX-512 Exponential and Reciprocal Instructions | +| AVX512F | AVX-512 Foundation | +| AVX512FP16 | AVX-512 FP16 Instructions | +| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions | +| AVX512PF | AVX-512 Prefetch Instructions | +| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions | +| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 | +| AVX512VL | AVX-512 Vector Length Extensions | +| AVX512VNNI | AVX-512 Vector Neural Network Instructions | +| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q | +| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword | +| AVXIFMA | AVX-IFMA instructions | +| AVXNECONVERT | AVX-NE-CONVERT instructions | +| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | +| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | +| AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 | +| BMI1 | Bit Manipulation Instruction Set 1 | +| BMI2 | Bit Manipulation Instruction Set 2 | +| CETIBT | Intel CET Indirect Branch Tracking | +| CETSS | Intel CET Shadow Stack | +| CLDEMOTE | Cache Line Demote | +| CLMUL | Carry-less Multiplication | +| CLZERO | CLZERO instruction supported | +| CMOV | i686 CMOV | +| CMPCCXADD | CMPCCXADD instructions | +| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB | +| CMPXCHG8 | CMPXCHG8 instruction | +| CPBOOST | Core Performance Boost | +| CPPC | AMD: Collaborative Processor Performance Control | +| CX16 | CMPXCHG16B Instruction | +| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ | +| ENQCMD | Enqueue Command | +| ERMS | Enhanced REP MOVSB/STOSB | +| F16C | Half-precision floating-point conversion | +| FLUSH_L1D | Flush L1D cache | +| FMA3 | Intel FMA 3. Does not imply AVX. | +| FMA4 | Bulldozer FMA4 functions | +| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide | +| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide | +| FSRM | Fast Short Rep Mov | +| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 | +| FXSROPT | FXSAVE/FXRSTOR optimizations | +| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. | +| HLE | Hardware Lock Elision | +| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR | +| HTT | Hyperthreading (enabled) | +| HWA | Hardware assert supported. Indicates support for MSRC001_10 | +| HYBRID_CPU | This part has CPUs of more than one type. | +| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors | +| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) | +| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR | +| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) | +| IBRS | AMD: Indirect Branch Restricted Speculation | +| IBRS_PREFERRED | AMD: IBRS is preferred over software solution | +| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection | +| IBS | Instruction Based Sampling (AMD) | +| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) | +| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) | +| IBSFFV | Instruction Based Sampling Feature (AMD) | +| IBSOPCNT | Instruction Based Sampling Feature (AMD) | +| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) | +| IBSOPSAM | Instruction Based Sampling Feature (AMD) | +| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) | +| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) | +| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported | +| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported | +| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse | +| IBS_PREVENTHOST | Disallowing IBS use by the host supported | +| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 | +| IDPRED_CTRL | IPRED_DIS | +| INT_WBINVD | WBINVD/WBNOINVD are interruptible. | +| INVLPGB | NVLPGB and TLBSYNC instruction supported | +| LAHF | LAHF/SAHF in long mode | +| LAM | If set, CPU supports Linear Address Masking | +| LBRVIRT | LBR virtualization | +| LZCNT | LZCNT instruction | +| MCAOVERFLOW | MCA overflow recovery support. | +| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. | +| MCOMMIT | MCOMMIT instruction supported | +| MD_CLEAR | VERW clears CPU buffers | +| MMX | standard MMX | +| MMXEXT | SSE integer functions or AMD MMX ext | +| MOVBE | MOVBE instruction (big-endian) | +| MOVDIR64B | Move 64 Bytes as Direct Store | +| MOVDIRI | Move Doubleword as Direct Store | +| MOVSB_ZL | Fast Zero-Length MOVSB | +| MPX | Intel MPX (Memory Protection Extensions) | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MSRIRC | Instruction Retired Counter MSR available | +| MSRLIST | Read/Write List of Model Specific Registers | +| MSR_PAGEFLUSH | Page Flush MSR available | +| NRIPS | Indicates support for NRIP save on VMEXIT | +| NX | NX (No-Execute) bit | +| OSXSAVE | XSAVE enabled by OS | +| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption | +| POPCNT | POPCNT instruction | +| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled | +| PREFETCHI | PREFETCHIT0/1 instructions | +| PSFD | Predictive Store Forward Disable | +| RDPRU | RDPRU instruction supported | +| RDRAND | RDRAND instruction is available | +| RDSEED | RDSEED instruction is available | +| RDTSCP | RDTSCP Instruction | +| RRSBA_CTRL | Restricted RSB Alternate | +| RTM | Restricted Transactional Memory | +| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. | +| SERIALIZE | Serialize Instruction Execution | +| SEV | AMD Secure Encrypted Virtualization supported | +| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host | +| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported | +| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests | +| SEV_ES | AMD SEV Encrypted State supported | +| SEV_RESTRICTED | AMD SEV Restricted Injection supported | +| SEV_SNP | AMD SEV Secure Nested Paging supported | +| SGX | Software Guard Extensions | +| SGXLC | Software Guard Extensions Launch Control | +| SHA | Intel SHA Extensions | +| SME | AMD Secure Memory Encryption supported | +| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | +| SPEC_CTRL_SSBD | Speculative Store Bypass Disable | +| SRBDS_CTRL | SRBDS mitigation MSR available | +| SSE | SSE functions | +| SSE2 | P4 SSE functions | +| SSE3 | Prescott SSE3 functions | +| SSE4 | Penryn SSE4.1 functions | +| SSE42 | Nehalem SSE4.2 functions | +| SSE4A | AMD Barcelona microarchitecture SSE4a instructions | +| SSSE3 | Conroe SSSE3 functions | +| STIBP | Single Thread Indirect Branch Predictors | +| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On | +| STOSB_SHORT | Fast short STOSB | +| SUCCOR | Software uncorrectable error containment and recovery capability. | +| SVM | AMD Secure Virtual Machine | +| SVMDA | Indicates support for the SVM decode assists. | +| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control | +| SVML | AMD SVM lock. Indicates support for SVM-Lock. | +| SVMNP | AMD SVM nested paging | +| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter | +| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold | +| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. | +| SYSEE | SYSENTER and SYSEXIT instructions | +| TBM | AMD Trailing Bit Manipulation | +| TDX_GUEST | Intel Trust Domain Extensions Guest | +| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | +| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | +| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | +| TSXLDTRK | Intel TSX Suspend Load Address Tracking | +| VAES | Vector AES. AVX(512) versions requires additional checks. | +| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. | +| VMPL | AMD VM Permission Levels supported | +| VMSA_REGPROT | AMD VMSA Register Protection supported | +| VMX | Virtual Machine Extensions | +| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. | +| VTE | AMD Virtual Transparent Encryption supported | +| WAITPKG | TPAUSE, UMONITOR, UMWAIT | +| WBNOINVD | Write Back and Do Not Invalidate Cache | +| WRMSRNS | Non-Serializing Write to Model Specific Register | +| X87 | FPU | +| XGETBV1 | Supports XGETBV with ECX = 1 | +| XOP | Bulldozer XOP functions | +| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV | +| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. | +| XSAVEOPT | XSAVEOPT available | +| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS | + +# ARM features: + +| Feature Flag | Description | +|--------------|------------------------------------------------------------------| +| AESARM | AES instructions | +| ARMCPUID | Some CPU ID registers readable at user-level | +| ASIMD | Advanced SIMD | +| ASIMDDP | SIMD Dot Product | +| ASIMDHP | Advanced SIMD half-precision floating point | +| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) | +| ATOMICS | Large System Extensions (LSE) | +| CRC32 | CRC32/CRC32C instructions | +| DCPOP | Data cache clean to Point of Persistence (DC CVAP) | +| EVTSTRM | Generic timer | +| FCMA | Floatin point complex number addition and multiplication | +| FP | Single-precision and double-precision floating point | +| FPHP | Half-precision floating point | +| GPA | Generic Pointer Authentication | +| JSCVT | Javascript-style double->int convert (FJCVTZS) | +| LRCPC | Weaker release consistency (LDAPR, etc) | +| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) | +| SHA1 | SHA-1 instructions (SHA1C, etc) | +| SHA2 | SHA-2 instructions (SHA256H, etc) | +| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) | +| SHA512 | SHA512 instructions | +| SM3 | SM3 instructions | +| SM4 | SM4 instructions | +| SVE | Scalable Vector Extension | + # license This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 1d88736b6..d015c744e 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -14,6 +14,7 @@ import ( "flag" "fmt" "math" + "math/bits" "os" "runtime" "strings" @@ -72,6 +73,7 @@ const ( AMD3DNOW // AMD 3DNOW AMD3DNOWEXT // AMD 3DNowExt AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers AMXTILE // Tile architecture AVX // AVX functions @@ -92,26 +94,51 @@ const ( AVX512VNNI // AVX-512 Vector Neural Network Instructions AVX512VP2INTERSECT // AVX-512 Intersect for D/Q AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one. + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 BMI1 // Bit Manipulation Instruction Set 1 BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack CLDEMOTE // Cache Line Demote CLMUL // Carry-less Multiplication CLZERO // CLZERO instruction supported CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ ENQCMD // Enqueue Command ERMS // Enhanced REP MOVSB/STOSB F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache FMA3 // Intel FMA 3. Does not imply AVX. FMA4 // Bulldozer FMA4 functions - GFNI // Galois Field New Instructions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR HTT // Hyperthreading (enabled) HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection IBS // Instruction Based Sampling (AMD) IBSBRNTRGT // Instruction Based Sampling Feature (AMD) IBSFETCHSAM // Instruction Based Sampling Feature (AMD) @@ -121,29 +148,63 @@ const ( IBSOPSAM // Instruction Based Sampling Feature (AMD) IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS INT_WBINVD // WBINVD/WBNOINVD are interruptible. INVLPGB // NVLPGB and TLBSYNC instruction supported + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization LZCNT // LZCNT instruction MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers MMX // standard MMX MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) MOVDIR64B // Move 64 Bytes as Direct Store MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD MPX // Intel MPX (Memory Protection Extensions) MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable RDPRU // RDPRU instruction supported RDRAND // RDRAND instruction is available RDSEED // RDSEED instruction is available RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate RTM // Restricted Transactional Memory RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported SGX // Software Guard Extensions SGXLC // Software Guard Extensions Launch Control SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available SSE // SSE functions SSE2 // P4 SSE functions SSE3 // Prescott SSE3 functions @@ -152,15 +213,42 @@ const ( SSE4A // AMD Barcelona microarchitecture SSE4a instructions SSSE3 // Conroe SSSE3 functions STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 TSXLDTRK // Intel TSX Suspend Load Address Tracking - VAES // Vector AES + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported VMX // Virtual Machine Extensions - VPCLMULQDQ // Carry-Less Multiplication Quadword + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported WAITPKG // TPAUSE, UMONITOR, UMWAIT WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS // ARM features: AESARM // AES instructions @@ -187,7 +275,6 @@ const ( SM3 // SM3 instructions SM4 // SM4 instructions SVE // Scalable Vector Extension - // Keep it last. It automatically defines the size of []flagSet lastID @@ -205,6 +292,7 @@ type CPUInfo struct { LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. Family int // CPU family number Model int // CPU model number + Stepping int // CPU stepping info CacheLine int // Cache line size in bytes. Will be 0 if undetectable. Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. BoostFreq int64 // Max clock speed, if known, 0 otherwise @@ -307,10 +395,66 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool { // Has allows for checking a single feature. // Should be inlined by the compiler. -func (c CPUInfo) Has(id FeatureID) bool { +func (c *CPUInfo) Has(id FeatureID) bool { return c.featureSet.inSet(id) } +// AnyOf returns whether the CPU supports one or more of the requested features. +func (c CPUInfo) AnyOf(ids ...FeatureID) bool { + for _, id := range ids { + if c.featureSet.inSet(id) { + return true + } + } + return false +} + +// Features contains several features combined for a fast check using +// CpuInfo.HasAll +type Features *flagSet + +// CombineFeatures allows to combine several features for a close to constant time lookup. +func CombineFeatures(ids ...FeatureID) Features { + var v flagSet + for _, id := range ids { + v.set(id) + } + return &v +} + +func (c *CPUInfo) HasAll(f Features) bool { + return c.featureSet.hasSetP(f) +} + +// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +var oneOfLevel = CombineFeatures(SYSEE, SYSCALL) +var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2) +var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) +var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) +var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) + +// X64Level returns the microarchitecture level detected on the CPU. +// If features are lacking or non x64 mode, 0 is returned. +// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +func (c CPUInfo) X64Level() int { + if !c.featureSet.hasOneOf(oneOfLevel) { + return 0 + } + if c.featureSet.hasSetP(level4Features) { + return 4 + } + if c.featureSet.hasSetP(level3Features) { + return 3 + } + if c.featureSet.hasSetP(level2Features) { + return 2 + } + if c.featureSet.hasSetP(level1Features) { + return 1 + } + return 0 +} + // Disable will disable one or several features. func (c *CPUInfo) Disable(ids ...FeatureID) bool { for _, id := range ids { @@ -333,11 +477,10 @@ func (c CPUInfo) IsVendor(v Vendor) bool { return c.VendorID == v } +// FeatureSet returns all available features as strings. func (c CPUInfo) FeatureSet() []string { - s := make([]string, 0) - for _, f := range c.featureSet.Strings() { - s = append(s, f) - } + s := make([]string, 0, c.featureSet.nEnabled()) + s = append(s, c.featureSet.Strings()...) return s } @@ -470,7 +613,7 @@ const flagMask = flagBits - 1 // flagSet contains detected cpu features and characteristics in an array of flags type flagSet [(lastID + flagMask) / flagBits]flags -func (s flagSet) inSet(feat FeatureID) bool { +func (s *flagSet) inSet(feat FeatureID) bool { return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 } @@ -499,6 +642,52 @@ func (s *flagSet) or(other flagSet) { } } +// hasSet returns whether all features are present. +func (s *flagSet) hasSet(other flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSetP(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasOneOf returns whether one or more features are present. +func (s *flagSet) hasOneOf(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != 0 { + return true + } + } + return false +} + +// nEnabled will return the number of enabled flags. +func (s *flagSet) nEnabled() (n int) { + for _, v := range s[:] { + n += bits.OnesCount64(uint64(v)) + } + return n +} + +func flagSetWith(feat ...FeatureID) flagSet { + var res flagSet + for _, f := range feat { + res.set(f) + } + return res +} + // ParseFeature will parse the string and return the ID of the matching feature. // Will return UNKNOWN if not found. func ParseFeature(s string) FeatureID { @@ -579,7 +768,7 @@ func threadsPerCore() int { if vend == AMD { // Workaround for AMD returning 0, assume 2 if >= Zen 2 // It will be more correct than not. - fam, _ := familyModel() + fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { return 2 @@ -617,14 +806,27 @@ func logicalCores() int { } } -func familyModel() (int, int) { +func familyModel() (family, model, stepping int) { if maxFunctionID() < 0x1 { - return 0, 0 + return 0, 0, 0 } eax, _, _, _ := cpuid(1) - family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff) - model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0) - return int(family), int(model) + // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0]. + family = int((eax >> 8) & 0xf) + extFam := family == 0x6 // Intel is 0x6, needs extended model. + if family == 0xf { + // Add ExtFamily + family += int((eax >> 20) & 0xff) + extFam = true + } + // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0]. + model = int((eax >> 4) & 0xf) + if extFam { + // Add ExtModel + model += int((eax >> 12) & 0xf0) + } + stepping = int(eax & 0xf) + return family, model, stepping } func physicalCores() int { @@ -708,6 +910,7 @@ func (c *CPUInfo) cacheSize() { if maxFunctionID() < 4 { return } + c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0 for i := uint32(0); ; i++ { eax, ebx, ecx, _ := cpuidex(4, i) cacheType := eax & 15 @@ -758,9 +961,14 @@ func (c *CPUInfo) cacheSize() { c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties - if maxExtendedFunction() < 0x8000001D { + if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) { return } + + // Xen Hypervisor is buggy and returns the same entry no matter ECX value. + // Hack: When we encounter the same entry 100 times we break. + nSame := 0 + var last uint32 for i := uint32(0); i < math.MaxUint32; i++ { eax, ebx, ecx, _ := cpuidex(0x8000001D, i) @@ -776,6 +984,16 @@ func (c *CPUInfo) cacheSize() { return } + // Check for the same value repeated. + comb := eax ^ ebx ^ ecx + if comb == last { + nSame++ + if nSame == 100 { + return + } + } + last = comb + switch level { case 1: switch typ { @@ -800,8 +1018,6 @@ func (c *CPUInfo) cacheSize() { } } } - - return } type SGXEPCSection struct { @@ -862,21 +1078,26 @@ func support() flagSet { if mfi < 0x1 { return fs } - family, model := familyModel() + family, model, _ := familyModel() _, _, c, d := cpuid(1) + fs.setIf((d&(1<<0)) != 0, X87) + fs.setIf((d&(1<<8)) != 0, CMPXCHG8) + fs.setIf((d&(1<<11)) != 0, SYSEE) fs.setIf((d&(1<<15)) != 0, CMOV) fs.setIf((d&(1<<23)) != 0, MMX) - fs.setIf((d&(1<<25)) != 0, MMXEXT) + fs.setIf((d&(1<<24)) != 0, FXSR) + fs.setIf((d&(1<<25)) != 0, FXSROPT) fs.setIf((d&(1<<25)) != 0, SSE) fs.setIf((d&(1<<26)) != 0, SSE2) fs.setIf((c&1) != 0, SSE3) fs.setIf((c&(1<<5)) != 0, VMX) - fs.setIf((c&0x00000200) != 0, SSSE3) - fs.setIf((c&0x00080000) != 0, SSE4) - fs.setIf((c&0x00100000) != 0, SSE42) + fs.setIf((c&(1<<9)) != 0, SSSE3) + fs.setIf((c&(1<<19)) != 0, SSE4) + fs.setIf((c&(1<<20)) != 0, SSE42) fs.setIf((c&(1<<25)) != 0, AESNI) fs.setIf((c&(1<<1)) != 0, CLMUL) + fs.setIf(c&(1<<22) != 0, MOVBE) fs.setIf(c&(1<<23) != 0, POPCNT) fs.setIf(c&(1<<30) != 0, RDRAND) @@ -892,6 +1113,8 @@ func support() flagSet { if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 { fs.setIf(threadsPerCore() > 1, HTT) } + fs.setIf(c&1<<26 != 0, XSAVE) + fs.setIf(c&1<<27 != 0, OSXSAVE) // Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits const avxCheck = 1<<26 | 1<<27 | 1<<28 if c&avxCheck == avxCheck { @@ -917,7 +1140,6 @@ func support() flagSet { // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. if mfi >= 7 { _, ebx, ecx, edx := cpuidex(7, 0) - eax1, _, _, _ := cpuidex(7, 1) if fs.inSet(AVX) && (ebx&0x00000020) != 0 { fs.set(AVX2) } @@ -934,19 +1156,52 @@ func support() flagSet { fs.setIf(ebx&(1<<18) != 0, RDSEED) fs.setIf(ebx&(1<<19) != 0, ADX) fs.setIf(ebx&(1<<29) != 0, SHA) + // CPUID.(EAX=7, ECX=0).ECX fs.setIf(ecx&(1<<5) != 0, WAITPKG) + fs.setIf(ecx&(1<<7) != 0, CETSS) + fs.setIf(ecx&(1<<8) != 0, GFNI) + fs.setIf(ecx&(1<<9) != 0, VAES) + fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) + fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<29) != 0, ENQCMD) fs.setIf(ecx&(1<<30) != 0, SGXLC) + // CPUID.(EAX=7, ECX=0).EDX + fs.setIf(edx&(1<<4) != 0, FSRM) + fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL) + fs.setIf(edx&(1<<10) != 0, MD_CLEAR) fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT) fs.setIf(edx&(1<<14) != 0, SERIALIZE) + fs.setIf(edx&(1<<15) != 0, HYBRID_CPU) fs.setIf(edx&(1<<16) != 0, TSXLDTRK) + fs.setIf(edx&(1<<18) != 0, PCONFIG) + fs.setIf(edx&(1<<20) != 0, CETIBT) fs.setIf(edx&(1<<26) != 0, IBPB) fs.setIf(edx&(1<<27) != 0, STIBP) + fs.setIf(edx&(1<<28) != 0, FLUSH_L1D) + fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP) + fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) + fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) + + // CPUID.(EAX=7, ECX=1).EAX + eax1, _, _, edx1 := cpuidex(7, 1) + fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) + fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) + fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) + fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) + fs.setIf(eax1&(1<<22) != 0, HRESET) + fs.setIf(eax1&(1<<23) != 0, AVXIFMA) + fs.setIf(eax1&(1<<26) != 0, LAM) + + // CPUID.(EAX=7, ECX=1).EDX + fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) + fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<14) != 0, PREFETCHI) // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { @@ -972,9 +1227,6 @@ func support() flagSet { // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) - fs.setIf(ecx&(1<<8) != 0, GFNI) - fs.setIf(ecx&(1<<9) != 0, VAES) - fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ) @@ -986,30 +1238,73 @@ func support() flagSet { fs.setIf(edx&(1<<25) != 0, AMXINT8) // eax1 = CPUID.(EAX=7, ECX=1).EAX fs.setIf(eax1&(1<<5) != 0, AVX512BF16) + fs.setIf(eax1&(1<<19) != 0, WRMSRNS) + fs.setIf(eax1&(1<<21) != 0, AMXFP16) + fs.setIf(eax1&(1<<27) != 0, MSRLIST) } } + + // CPUID.(EAX=7, ECX=2) + _, _, _, edx = cpuidex(7, 2) + fs.setIf(edx&(1<<0) != 0, PSFD) + fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL) + fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL) + fs.setIf(edx&(1<<4) != 0, BHI_CTRL) + fs.setIf(edx&(1<<5) != 0, MCDT_NO) + } + // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) + // EAX + // Bit 00: XSAVEOPT is available. + // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set. + // Bit 02: Supports XGETBV with ECX = 1 if set. + // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set. + // Bits 31 - 04: Reserved. + // EBX + // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS. + // ECX + // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1. + // EDX? + // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved. + if mfi >= 0xd { + if fs.inSet(XSAVE) { + eax, _, _, _ := cpuidex(0xd, 1) + fs.setIf(eax&(1<<0) != 0, XSAVEOPT) + fs.setIf(eax&(1<<1) != 0, XSAVEC) + fs.setIf(eax&(1<<2) != 0, XGETBV1) + fs.setIf(eax&(1<<3) != 0, XSAVES) + } + } if maxExtendedFunction() >= 0x80000001 { _, _, c, d := cpuid(0x80000001) if (c & (1 << 5)) != 0 { fs.set(LZCNT) fs.set(POPCNT) } - fs.setIf((c&(1<<10)) != 0, IBS) - fs.setIf((d&(1<<31)) != 0, AMD3DNOW) - fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT) - fs.setIf((d&(1<<23)) != 0, MMX) - fs.setIf((d&(1<<22)) != 0, MMXEXT) + // ECX + fs.setIf((c&(1<<0)) != 0, LAHF) + fs.setIf((c&(1<<2)) != 0, SVM) fs.setIf((c&(1<<6)) != 0, SSE4A) + fs.setIf((c&(1<<10)) != 0, IBS) + fs.setIf((c&(1<<22)) != 0, TOPEXT) + + // EDX + fs.setIf(d&(1<<11) != 0, SYSCALL) fs.setIf(d&(1<<20) != 0, NX) + fs.setIf(d&(1<<22) != 0, MMXEXT) + fs.setIf(d&(1<<23) != 0, MMX) + fs.setIf(d&(1<<24) != 0, FXSR) + fs.setIf(d&(1<<25) != 0, FXSROPT) fs.setIf(d&(1<<27) != 0, RDTSCP) + fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT) + fs.setIf(d&(1<<31) != 0, AMD3DNOW) /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be * used unless the OS has AVX support. */ if fs.inSet(AVX) { - fs.setIf((c&0x00000800) != 0, XOP) - fs.setIf((c&0x00010000) != 0, FMA4) + fs.setIf((c&(1<<11)) != 0, XOP) + fs.setIf((c&(1<<16)) != 0, FMA4) } } @@ -1023,15 +1318,48 @@ func support() flagSet { if maxExtendedFunction() >= 0x80000008 { _, b, _, _ := cpuid(0x80000008) + fs.setIf(b&(1<<28) != 0, PSFD) + fs.setIf(b&(1<<27) != 0, CPPC) + fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD) + fs.setIf(b&(1<<23) != 0, PPIN) + fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED) + fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS) + fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP) + fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED) + fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON) + fs.setIf(b&(1<<15) != 0, STIBP) + fs.setIf(b&(1<<14) != 0, IBRS) + fs.setIf((b&(1<<13)) != 0, INT_WBINVD) + fs.setIf(b&(1<<12) != 0, IBPB) fs.setIf((b&(1<<9)) != 0, WBNOINVD) fs.setIf((b&(1<<8)) != 0, MCOMMIT) - fs.setIf((b&(1<<13)) != 0, INT_WBINVD) fs.setIf((b&(1<<4)) != 0, RDPRU) fs.setIf((b&(1<<3)) != 0, INVLPGB) fs.setIf((b&(1<<1)) != 0, MSRIRC) fs.setIf((b&(1<<0)) != 0, CLZERO) } + if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A { + _, _, _, edx := cpuid(0x8000000A) + fs.setIf((edx>>0)&1 == 1, SVMNP) + fs.setIf((edx>>1)&1 == 1, LBRVIRT) + fs.setIf((edx>>2)&1 == 1, SVML) + fs.setIf((edx>>3)&1 == 1, NRIPS) + fs.setIf((edx>>4)&1 == 1, TSCRATEMSR) + fs.setIf((edx>>5)&1 == 1, VMCBCLEAN) + fs.setIf((edx>>6)&1 == 1, SVMFBASID) + fs.setIf((edx>>7)&1 == 1, SVMDA) + fs.setIf((edx>>10)&1 == 1, SVMPF) + fs.setIf((edx>>12)&1 == 1, SVMPFT) + } + + if maxExtendedFunction() >= 0x8000001a { + eax, _, _, _ := cpuid(0x8000001a) + fs.setIf((eax>>0)&1 == 1, FP128) + fs.setIf((eax>>1)&1 == 1, MOVU) + fs.setIf((eax>>2)&1 == 1, FP256) + } + if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { eax, _, _, _ := cpuid(0x8000001b) fs.setIf((eax>>0)&1 == 1, IBSFFV) @@ -1042,6 +1370,35 @@ func support() flagSet { fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) + fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE) + fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX) + fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1. + fs.setIf((eax>>11)&1 == 1, IBS_ZEN4) + } + + if maxExtendedFunction() >= 0x8000001f && vend == AMD { + a, _, _, _ := cpuid(0x8000001f) + fs.setIf((a>>0)&1 == 1, SME) + fs.setIf((a>>1)&1 == 1, SEV) + fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH) + fs.setIf((a>>3)&1 == 1, SEV_ES) + fs.setIf((a>>4)&1 == 1, SEV_SNP) + fs.setIf((a>>5)&1 == 1, VMPL) + fs.setIf((a>>10)&1 == 1, SME_COHERENT) + fs.setIf((a>>11)&1 == 1, SEV_64BIT) + fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED) + fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE) + fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP) + fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST) + fs.setIf((a>>16)&1 == 1, VTE) + fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) + } + + if mfi >= 0x21 { + // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). + _, ebx, ecx, edx := cpuid(0x21) + identity := string(valAsString(ebx, edx, ecx)) + fs.setIf(identity == "IntelTDX ", TDX_GUEST) } return fs diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 9bf9f77f3..9a53504a0 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build arm64,!gccgo,!noasm,!appengine +//go:build arm64 && !gccgo && !noasm && !appengine +// +build arm64,!gccgo,!noasm,!appengine package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index e9c8606ab..9636c2bc1 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build !amd64,!386,!arm64 gccgo noasm appengine +//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine +// +build !amd64,!386,!arm64 gccgo noasm appengine package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 367c35c88..c946824ec 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -1,6 +1,7 @@ // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. -//+build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine +//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine) +// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine package cpuid @@ -23,7 +24,7 @@ func addInfo(c *CPUInfo, safe bool) { c.maxExFunc = maxExtendedFunction() c.BrandName = brandName() c.CacheLine = cacheLine() - c.Family, c.Model = familyModel() + c.Family, c.Model, c.Stepping = familyModel() c.featureSet = support() c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) c.ThreadsPerCore = threadsPerCore() diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index b1fe42e46..024c706af 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -13,126 +13,213 @@ func _() { _ = x[AMD3DNOW-3] _ = x[AMD3DNOWEXT-4] _ = x[AMXBF16-5] - _ = x[AMXINT8-6] - _ = x[AMXTILE-7] - _ = x[AVX-8] - _ = x[AVX2-9] - _ = x[AVX512BF16-10] - _ = x[AVX512BITALG-11] - _ = x[AVX512BW-12] - _ = x[AVX512CD-13] - _ = x[AVX512DQ-14] - _ = x[AVX512ER-15] - _ = x[AVX512F-16] - _ = x[AVX512FP16-17] - _ = x[AVX512IFMA-18] - _ = x[AVX512PF-19] - _ = x[AVX512VBMI-20] - _ = x[AVX512VBMI2-21] - _ = x[AVX512VL-22] - _ = x[AVX512VNNI-23] - _ = x[AVX512VP2INTERSECT-24] - _ = x[AVX512VPOPCNTDQ-25] - _ = x[AVXSLOW-26] - _ = x[BMI1-27] - _ = x[BMI2-28] - _ = x[CLDEMOTE-29] - _ = x[CLMUL-30] - _ = x[CLZERO-31] - _ = x[CMOV-32] - _ = x[CPBOOST-33] - _ = x[CX16-34] - _ = x[ENQCMD-35] - _ = x[ERMS-36] - _ = x[F16C-37] - _ = x[FMA3-38] - _ = x[FMA4-39] - _ = x[GFNI-40] - _ = x[HLE-41] - _ = x[HTT-42] - _ = x[HWA-43] - _ = x[HYPERVISOR-44] - _ = x[IBPB-45] - _ = x[IBS-46] - _ = x[IBSBRNTRGT-47] - _ = x[IBSFETCHSAM-48] - _ = x[IBSFFV-49] - _ = x[IBSOPCNT-50] - _ = x[IBSOPCNTEXT-51] - _ = x[IBSOPSAM-52] - _ = x[IBSRDWROPCNT-53] - _ = x[IBSRIPINVALIDCHK-54] - _ = x[INT_WBINVD-55] - _ = x[INVLPGB-56] - _ = x[LZCNT-57] - _ = x[MCAOVERFLOW-58] - _ = x[MCOMMIT-59] - _ = x[MMX-60] - _ = x[MMXEXT-61] - _ = x[MOVDIR64B-62] - _ = x[MOVDIRI-63] - _ = x[MPX-64] - _ = x[MSRIRC-65] - _ = x[NX-66] - _ = x[POPCNT-67] - _ = x[RDPRU-68] - _ = x[RDRAND-69] - _ = x[RDSEED-70] - _ = x[RDTSCP-71] - _ = x[RTM-72] - _ = x[RTM_ALWAYS_ABORT-73] - _ = x[SERIALIZE-74] - _ = x[SGX-75] - _ = x[SGXLC-76] - _ = x[SHA-77] - _ = x[SSE-78] - _ = x[SSE2-79] - _ = x[SSE3-80] - _ = x[SSE4-81] - _ = x[SSE42-82] - _ = x[SSE4A-83] - _ = x[SSSE3-84] - _ = x[STIBP-85] - _ = x[SUCCOR-86] - _ = x[TBM-87] - _ = x[TSXLDTRK-88] - _ = x[VAES-89] - _ = x[VMX-90] - _ = x[VPCLMULQDQ-91] - _ = x[WAITPKG-92] - _ = x[WBNOINVD-93] - _ = x[XOP-94] - _ = x[AESARM-95] - _ = x[ARMCPUID-96] - _ = x[ASIMD-97] - _ = x[ASIMDDP-98] - _ = x[ASIMDHP-99] - _ = x[ASIMDRDM-100] - _ = x[ATOMICS-101] - _ = x[CRC32-102] - _ = x[DCPOP-103] - _ = x[EVTSTRM-104] - _ = x[FCMA-105] - _ = x[FP-106] - _ = x[FPHP-107] - _ = x[GPA-108] - _ = x[JSCVT-109] - _ = x[LRCPC-110] - _ = x[PMULL-111] - _ = x[SHA1-112] - _ = x[SHA2-113] - _ = x[SHA3-114] - _ = x[SHA512-115] - _ = x[SM3-116] - _ = x[SM4-117] - _ = x[SVE-118] - _ = x[lastID-119] + _ = x[AMXFP16-6] + _ = x[AMXINT8-7] + _ = x[AMXTILE-8] + _ = x[AVX-9] + _ = x[AVX2-10] + _ = x[AVX512BF16-11] + _ = x[AVX512BITALG-12] + _ = x[AVX512BW-13] + _ = x[AVX512CD-14] + _ = x[AVX512DQ-15] + _ = x[AVX512ER-16] + _ = x[AVX512F-17] + _ = x[AVX512FP16-18] + _ = x[AVX512IFMA-19] + _ = x[AVX512PF-20] + _ = x[AVX512VBMI-21] + _ = x[AVX512VBMI2-22] + _ = x[AVX512VL-23] + _ = x[AVX512VNNI-24] + _ = x[AVX512VP2INTERSECT-25] + _ = x[AVX512VPOPCNTDQ-26] + _ = x[AVXIFMA-27] + _ = x[AVXNECONVERT-28] + _ = x[AVXSLOW-29] + _ = x[AVXVNNI-30] + _ = x[AVXVNNIINT8-31] + _ = x[BHI_CTRL-32] + _ = x[BMI1-33] + _ = x[BMI2-34] + _ = x[CETIBT-35] + _ = x[CETSS-36] + _ = x[CLDEMOTE-37] + _ = x[CLMUL-38] + _ = x[CLZERO-39] + _ = x[CMOV-40] + _ = x[CMPCCXADD-41] + _ = x[CMPSB_SCADBS_SHORT-42] + _ = x[CMPXCHG8-43] + _ = x[CPBOOST-44] + _ = x[CPPC-45] + _ = x[CX16-46] + _ = x[EFER_LMSLE_UNS-47] + _ = x[ENQCMD-48] + _ = x[ERMS-49] + _ = x[F16C-50] + _ = x[FLUSH_L1D-51] + _ = x[FMA3-52] + _ = x[FMA4-53] + _ = x[FP128-54] + _ = x[FP256-55] + _ = x[FSRM-56] + _ = x[FXSR-57] + _ = x[FXSROPT-58] + _ = x[GFNI-59] + _ = x[HLE-60] + _ = x[HRESET-61] + _ = x[HTT-62] + _ = x[HWA-63] + _ = x[HYBRID_CPU-64] + _ = x[HYPERVISOR-65] + _ = x[IA32_ARCH_CAP-66] + _ = x[IA32_CORE_CAP-67] + _ = x[IBPB-68] + _ = x[IBRS-69] + _ = x[IBRS_PREFERRED-70] + _ = x[IBRS_PROVIDES_SMP-71] + _ = x[IBS-72] + _ = x[IBSBRNTRGT-73] + _ = x[IBSFETCHSAM-74] + _ = x[IBSFFV-75] + _ = x[IBSOPCNT-76] + _ = x[IBSOPCNTEXT-77] + _ = x[IBSOPSAM-78] + _ = x[IBSRDWROPCNT-79] + _ = x[IBSRIPINVALIDCHK-80] + _ = x[IBS_FETCH_CTLX-81] + _ = x[IBS_OPDATA4-82] + _ = x[IBS_OPFUSE-83] + _ = x[IBS_PREVENTHOST-84] + _ = x[IBS_ZEN4-85] + _ = x[IDPRED_CTRL-86] + _ = x[INT_WBINVD-87] + _ = x[INVLPGB-88] + _ = x[LAHF-89] + _ = x[LAM-90] + _ = x[LBRVIRT-91] + _ = x[LZCNT-92] + _ = x[MCAOVERFLOW-93] + _ = x[MCDT_NO-94] + _ = x[MCOMMIT-95] + _ = x[MD_CLEAR-96] + _ = x[MMX-97] + _ = x[MMXEXT-98] + _ = x[MOVBE-99] + _ = x[MOVDIR64B-100] + _ = x[MOVDIRI-101] + _ = x[MOVSB_ZL-102] + _ = x[MOVU-103] + _ = x[MPX-104] + _ = x[MSRIRC-105] + _ = x[MSRLIST-106] + _ = x[MSR_PAGEFLUSH-107] + _ = x[NRIPS-108] + _ = x[NX-109] + _ = x[OSXSAVE-110] + _ = x[PCONFIG-111] + _ = x[POPCNT-112] + _ = x[PPIN-113] + _ = x[PREFETCHI-114] + _ = x[PSFD-115] + _ = x[RDPRU-116] + _ = x[RDRAND-117] + _ = x[RDSEED-118] + _ = x[RDTSCP-119] + _ = x[RRSBA_CTRL-120] + _ = x[RTM-121] + _ = x[RTM_ALWAYS_ABORT-122] + _ = x[SERIALIZE-123] + _ = x[SEV-124] + _ = x[SEV_64BIT-125] + _ = x[SEV_ALTERNATIVE-126] + _ = x[SEV_DEBUGSWAP-127] + _ = x[SEV_ES-128] + _ = x[SEV_RESTRICTED-129] + _ = x[SEV_SNP-130] + _ = x[SGX-131] + _ = x[SGXLC-132] + _ = x[SHA-133] + _ = x[SME-134] + _ = x[SME_COHERENT-135] + _ = x[SPEC_CTRL_SSBD-136] + _ = x[SRBDS_CTRL-137] + _ = x[SSE-138] + _ = x[SSE2-139] + _ = x[SSE3-140] + _ = x[SSE4-141] + _ = x[SSE42-142] + _ = x[SSE4A-143] + _ = x[SSSE3-144] + _ = x[STIBP-145] + _ = x[STIBP_ALWAYSON-146] + _ = x[STOSB_SHORT-147] + _ = x[SUCCOR-148] + _ = x[SVM-149] + _ = x[SVMDA-150] + _ = x[SVMFBASID-151] + _ = x[SVML-152] + _ = x[SVMNP-153] + _ = x[SVMPF-154] + _ = x[SVMPFT-155] + _ = x[SYSCALL-156] + _ = x[SYSEE-157] + _ = x[TBM-158] + _ = x[TDX_GUEST-159] + _ = x[TLB_FLUSH_NESTED-160] + _ = x[TME-161] + _ = x[TOPEXT-162] + _ = x[TSCRATEMSR-163] + _ = x[TSXLDTRK-164] + _ = x[VAES-165] + _ = x[VMCBCLEAN-166] + _ = x[VMPL-167] + _ = x[VMSA_REGPROT-168] + _ = x[VMX-169] + _ = x[VPCLMULQDQ-170] + _ = x[VTE-171] + _ = x[WAITPKG-172] + _ = x[WBNOINVD-173] + _ = x[WRMSRNS-174] + _ = x[X87-175] + _ = x[XGETBV1-176] + _ = x[XOP-177] + _ = x[XSAVE-178] + _ = x[XSAVEC-179] + _ = x[XSAVEOPT-180] + _ = x[XSAVES-181] + _ = x[AESARM-182] + _ = x[ARMCPUID-183] + _ = x[ASIMD-184] + _ = x[ASIMDDP-185] + _ = x[ASIMDHP-186] + _ = x[ASIMDRDM-187] + _ = x[ATOMICS-188] + _ = x[CRC32-189] + _ = x[DCPOP-190] + _ = x[EVTSTRM-191] + _ = x[FCMA-192] + _ = x[FP-193] + _ = x[FPHP-194] + _ = x[GPA-195] + _ = x[JSCVT-196] + _ = x[LRCPC-197] + _ = x[PMULL-198] + _ = x[SHA1-199] + _ = x[SHA2-200] + _ = x[SHA3-201] + _ = x[SHA512-202] + _ = x[SM3-203] + _ = x[SM4-204] + _ = x[SVE-205] + _ = x[lastID-206] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CLDEMOTECLMULCLZEROCMOVCPBOOSTCX16ENQCMDERMSF16CFMA3FMA4GFNIHLEHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKINT_WBINVDINVLPGBLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVDIR64BMOVDIRIMPXMSRIRCNXPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSUCCORTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDXOPAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 234, 238, 246, 251, 257, 261, 268, 272, 278, 282, 286, 290, 294, 298, 301, 304, 307, 317, 321, 324, 334, 345, 351, 359, 370, 378, 390, 406, 416, 423, 428, 439, 446, 449, 455, 464, 471, 474, 480, 482, 488, 493, 499, 505, 511, 514, 530, 539, 542, 547, 550, 553, 557, 561, 565, 570, 575, 580, 585, 591, 594, 602, 606, 609, 619, 626, 634, 637, 643, 651, 656, 663, 670, 678, 685, 690, 695, 702, 706, 708, 712, 715, 720, 725, 730, 734, 738, 742, 748, 751, 754, 757, 763} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go index 8d2cb0368..84b1acd21 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -2,18 +2,120 @@ package cpuid -import "runtime" +import ( + "runtime" + "strings" + + "golang.org/x/sys/unix" +) func detectOS(c *CPUInfo) bool { + if runtime.GOOS != "ios" { + tryToFillCPUInfoFomSysctl(c) + } // There are no hw.optional sysctl values for the below features on Mac OS 11.0 // to detect their supported state dynamically. Assume the CPU features that // Apple Silicon M1 supports to be available as a minimal set of features // to all Go programs running on darwin/arm64. // TODO: Add more if we know them. c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2) - c.PhysicalCores = runtime.NumCPU() - // For now assuming 1 thread per core... - c.ThreadsPerCore = 1 - c.LogicalCores = c.PhysicalCores + return true } + +func sysctlGetBool(name string) bool { + value, err := unix.SysctlUint32(name) + if err != nil { + return false + } + return value != 0 +} + +func sysctlGetString(name string) string { + value, err := unix.Sysctl(name) + if err != nil { + return "" + } + return value +} + +func sysctlGetInt(unknown int, names ...string) int { + for _, name := range names { + value, err := unix.SysctlUint32(name) + if err != nil { + continue + } + if value != 0 { + return int(value) + } + } + return unknown +} + +func sysctlGetInt64(unknown int, names ...string) int { + for _, name := range names { + value64, err := unix.SysctlUint64(name) + if err != nil { + continue + } + if int(value64) != unknown { + return int(value64) + } + } + return unknown +} + +func setFeature(c *CPUInfo, name string, feature FeatureID) { + c.featureSet.setIf(sysctlGetBool(name), feature) +} +func tryToFillCPUInfoFomSysctl(c *CPUInfo) { + c.BrandName = sysctlGetString("machdep.cpu.brand_string") + + if len(c.BrandName) != 0 { + c.VendorString = strings.Fields(c.BrandName)[0] + } + + c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu") + c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") / + sysctlGetInt(1, "hw.physicalcpu") + c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count") + c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily") + c.Model = sysctlGetInt(0, "machdep.cpu.model") + c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") + c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize") + c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") + c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") + + // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile + setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) + setFeature(c, "hw.optional.AdvSIMD", ASIMD) + setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) + setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) + setFeature(c, "hw.optional.FEAT_CRC32", CRC32) + setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) + // setFeature(c, "", EVTSTRM) + setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FP", FP) + setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) + setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) + setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) + setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) + setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) + setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) + setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) + setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + // setFeature(c, "", SM3) + // setFeature(c, "", SM4) + setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) + + // from empirical observation + setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) + setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) + setFeature(c, "hw.optional.floatingpoint", FP) + setFeature(c, "hw.optional.armv8_2_sha3", SHA3) + setFeature(c, "hw.optional.armv8_2_sha512", SHA512) + setFeature(c, "hw.optional.armv8_3_compnum", FCMA) + setFeature(c, "hw.optional.armv8_crc32", CRC32) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go index 1a951e6ca..8733ba343 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go @@ -1,8 +1,7 @@ // Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. -// +build arm64 -// +build !linux -// +build !darwin +//go:build arm64 && !linux && !darwin +// +build arm64,!linux,!darwin package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go index 4d0b8b465..f8f201b5f 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go @@ -1,6 +1,7 @@ // Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. -//+build nounsafe +//go:build nounsafe +// +build nounsafe package cpuid diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go index 329800286..92af622eb 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go @@ -1,6 +1,7 @@ // Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. -//+build !nounsafe +//go:build !nounsafe +// +build !nounsafe package cpuid diff --git a/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go b/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go index 2a9f2dc3b..4f7b42488 100644 --- a/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go +++ b/vendor/github.com/sergi/go-diff/diffmatchpatch/diff.go @@ -1313,17 +1313,17 @@ func (dmp *DiffMatchPatch) diffLinesToStrings(text1, text2 string) (string, stri // '\x00' is a valid character, but various debuggers don't like it. So we'll insert a junk entry to avoid generating a null character. lineArray := []string{""} // e.g. lineArray[4] == 'Hello\n' + lineHash := make(map[string]int) //Each string has the index of lineArray which it points to - strIndexArray1 := dmp.diffLinesToStringsMunge(text1, &lineArray) - strIndexArray2 := dmp.diffLinesToStringsMunge(text2, &lineArray) + strIndexArray1 := dmp.diffLinesToStringsMunge(text1, &lineArray, lineHash) + strIndexArray2 := dmp.diffLinesToStringsMunge(text2, &lineArray, lineHash) return intArrayToString(strIndexArray1), intArrayToString(strIndexArray2), lineArray } // diffLinesToStringsMunge splits a text into an array of strings, and reduces the texts to a []string. -func (dmp *DiffMatchPatch) diffLinesToStringsMunge(text string, lineArray *[]string) []uint32 { +func (dmp *DiffMatchPatch) diffLinesToStringsMunge(text string, lineArray *[]string, lineHash map[string]int) []uint32 { // Walk the text, pulling out a substring for each line. text.split('\n') would would temporarily double our memory footprint. Modifying text would create many large strings to garbage collect. - lineHash := map[string]int{} // e.g. lineHash['Hello\n'] == 4 lineStart := 0 lineEnd := -1 strs := []uint32{} diff --git a/vendor/github.com/spf13/pflag/flag.go b/vendor/github.com/spf13/pflag/flag.go index eeed1e92b..2fd3c5759 100644 --- a/vendor/github.com/spf13/pflag/flag.go +++ b/vendor/github.com/spf13/pflag/flag.go @@ -143,8 +143,9 @@ type ParseErrorsAllowlist struct { UnknownFlags bool } -// DEPRECATED: please use ParseErrorsAllowlist instead -// This type will be removed in a future release +// ParseErrorsWhitelist defines the parsing errors that can be ignored. +// +// Deprecated: use [ParseErrorsAllowlist] instead. This type will be removed in a future release. type ParseErrorsWhitelist = ParseErrorsAllowlist // NormalizedName is a flag name that has been normalized according to rules @@ -165,8 +166,9 @@ type FlagSet struct { // ParseErrorsAllowlist is used to configure an allowlist of errors ParseErrorsAllowlist ParseErrorsAllowlist - // DEPRECATED: please use ParseErrorsAllowlist instead - // This field will be removed in a future release + // ParseErrorsAllowlist is used to configure an allowlist of errors. + // + // Deprecated: use [FlagSet.ParseErrorsAllowlist] instead. This field will be removed in a future release. ParseErrorsWhitelist ParseErrorsAllowlist name string @@ -1185,7 +1187,7 @@ func (f *FlagSet) Parse(arguments []string) error { case ContinueOnError: return err case ExitOnError: - if errors.Is(err, ErrHelp) { + if err == ErrHelp { os.Exit(0) } fmt.Fprintln(f.Output(), err) @@ -1214,7 +1216,7 @@ func (f *FlagSet) ParseAll(arguments []string, fn func(flag *Flag, value string) case ContinueOnError: return err case ExitOnError: - if errors.Is(err, ErrHelp) { + if err == ErrHelp { os.Exit(0) } fmt.Fprintln(f.Output(), err) diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go index 9e87fb4bb..296407f38 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/config.go @@ -9,18 +9,12 @@ import ( "go.opentelemetry.io/otel" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/metric" - "go.opentelemetry.io/otel/metric/noop" "go.opentelemetry.io/otel/propagation" - semconv "go.opentelemetry.io/otel/semconv/v1.17.0" "go.opentelemetry.io/otel/trace" ) -const ( - // ScopeName is the instrumentation scope name. - ScopeName = "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc" - // GRPCStatusCodeKey is convention for numeric status code of a gRPC request. - GRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code") -) +// ScopeName is the instrumentation scope name. +const ScopeName = "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc" // InterceptorFilter is a predicate used to determine whether a given request in // interceptor info should be instrumented. A InterceptorFilter must return true if @@ -47,15 +41,6 @@ type config struct { ReceivedEvent bool SentEvent bool - - tracer trace.Tracer - meter metric.Meter - - rpcDuration metric.Float64Histogram - rpcInBytes metric.Int64Histogram - rpcOutBytes metric.Int64Histogram - rpcInMessages metric.Int64Histogram - rpcOutMessages metric.Int64Histogram } // Option applies an option value for a config. @@ -64,7 +49,7 @@ type Option interface { } // newConfig returns a config configured with all the passed Options. -func newConfig(opts []Option, role string) *config { +func newConfig(opts []Option) *config { c := &config{ Propagators: otel.GetTextMapPropagator(), TracerProvider: otel.GetTracerProvider(), @@ -73,87 +58,6 @@ func newConfig(opts []Option, role string) *config { for _, o := range opts { o.apply(c) } - - c.tracer = c.TracerProvider.Tracer( - ScopeName, - trace.WithInstrumentationVersion(SemVersion()), - ) - - c.meter = c.MeterProvider.Meter( - ScopeName, - metric.WithInstrumentationVersion(Version()), - metric.WithSchemaURL(semconv.SchemaURL), - ) - - var err error - c.rpcDuration, err = c.meter.Float64Histogram("rpc."+role+".duration", - metric.WithDescription("Measures the duration of inbound RPC."), - metric.WithUnit("ms")) - if err != nil { - otel.Handle(err) - if c.rpcDuration == nil { - c.rpcDuration = noop.Float64Histogram{} - } - } - - rpcRequestSize, err := c.meter.Int64Histogram("rpc."+role+".request.size", - metric.WithDescription("Measures size of RPC request messages (uncompressed)."), - metric.WithUnit("By")) - if err != nil { - otel.Handle(err) - if rpcRequestSize == nil { - rpcRequestSize = noop.Int64Histogram{} - } - } - - rpcResponseSize, err := c.meter.Int64Histogram("rpc."+role+".response.size", - metric.WithDescription("Measures size of RPC response messages (uncompressed)."), - metric.WithUnit("By")) - if err != nil { - otel.Handle(err) - if rpcResponseSize == nil { - rpcResponseSize = noop.Int64Histogram{} - } - } - - rpcRequestsPerRPC, err := c.meter.Int64Histogram("rpc."+role+".requests_per_rpc", - metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."), - metric.WithUnit("{count}")) - if err != nil { - otel.Handle(err) - if rpcRequestsPerRPC == nil { - rpcRequestsPerRPC = noop.Int64Histogram{} - } - } - - rpcResponsesPerRPC, err := c.meter.Int64Histogram("rpc."+role+".responses_per_rpc", - metric.WithDescription("Measures the number of messages received per RPC. Should be 1 for all non-streaming RPCs."), - metric.WithUnit("{count}")) - if err != nil { - otel.Handle(err) - if rpcResponsesPerRPC == nil { - rpcResponsesPerRPC = noop.Int64Histogram{} - } - } - - switch role { - case "client": - c.rpcInBytes = rpcResponseSize - c.rpcInMessages = rpcResponsesPerRPC - c.rpcOutBytes = rpcRequestSize - c.rpcOutMessages = rpcRequestsPerRPC - case "server": - c.rpcInBytes = rpcRequestSize - c.rpcInMessages = rpcRequestsPerRPC - c.rpcOutBytes = rpcResponseSize - c.rpcOutMessages = rpcResponsesPerRPC - default: - c.rpcInBytes = noop.Int64Histogram{} - c.rpcInMessages = noop.Int64Histogram{} - c.rpcOutBytes = noop.Int64Histogram{} - c.rpcOutMessages = noop.Int64Histogram{} - } - return c } diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go index 7d5ed0580..f63513d45 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/interceptor.go @@ -11,7 +11,6 @@ import ( "io" "net" "strconv" - "time" "google.golang.org/grpc" grpc_codes "google.golang.org/grpc/codes" @@ -23,8 +22,7 @@ import ( "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" - "go.opentelemetry.io/otel/metric" - semconv "go.opentelemetry.io/otel/semconv/v1.17.0" + semconv "go.opentelemetry.io/otel/semconv/v1.30.0" "go.opentelemetry.io/otel/trace" ) @@ -39,82 +37,15 @@ func (m messageType) Event(ctx context.Context, id int, _ interface{}) { } span.AddEvent("message", trace.WithAttributes( attribute.KeyValue(m), - RPCMessageIDKey.Int(id), + semconv.RPCMessageIDKey.Int(id), )) } var ( - messageSent = messageType(RPCMessageTypeSent) - messageReceived = messageType(RPCMessageTypeReceived) + messageSent = messageType(semconv.RPCMessageTypeSent) + messageReceived = messageType(semconv.RPCMessageTypeReceived) ) -// UnaryClientInterceptor returns a grpc.UnaryClientInterceptor suitable -// for use in a grpc.NewClient call. -// -// Deprecated: Use [NewClientHandler] instead. -func UnaryClientInterceptor(opts ...Option) grpc.UnaryClientInterceptor { - cfg := newConfig(opts, "client") - tracer := cfg.TracerProvider.Tracer( - ScopeName, - trace.WithInstrumentationVersion(Version()), - ) - - return func( - ctx context.Context, - method string, - req, reply interface{}, - cc *grpc.ClientConn, - invoker grpc.UnaryInvoker, - callOpts ...grpc.CallOption, - ) error { - i := &InterceptorInfo{ - Method: method, - Type: UnaryClient, - } - if cfg.InterceptorFilter != nil && !cfg.InterceptorFilter(i) { - return invoker(ctx, method, req, reply, cc, callOpts...) - } - - name, attr, _ := telemetryAttributes(method, cc.Target()) - - startOpts := append([]trace.SpanStartOption{ - trace.WithSpanKind(trace.SpanKindClient), - trace.WithAttributes(attr...), - }, - cfg.SpanStartOptions..., - ) - - ctx, span := tracer.Start( - ctx, - name, - startOpts..., - ) - defer span.End() - - ctx = inject(ctx, cfg.Propagators) - - if cfg.SentEvent { - messageSent.Event(ctx, 1, req) - } - - err := invoker(ctx, method, req, reply, cc, callOpts...) - - if cfg.ReceivedEvent { - messageReceived.Event(ctx, 1, reply) - } - - if err != nil { - s, _ := status.FromError(err) - span.SetStatus(codes.Error, s.Message()) - span.SetAttributes(statusCodeAttr(s.Code())) - } else { - span.SetAttributes(statusCodeAttr(grpc_codes.OK)) - } - - return err - } -} - // clientStream wraps around the embedded grpc.ClientStream, and intercepts the RecvMsg and // SendMsg method call. type clientStream struct { @@ -213,7 +144,7 @@ func (w *clientStream) endSpan(err error) { // // Deprecated: Use [NewClientHandler] instead. func StreamClientInterceptor(opts ...Option) grpc.StreamClientInterceptor { - cfg := newConfig(opts, "client") + cfg := newConfig(opts) tracer := cfg.TracerProvider.Tracer( ScopeName, trace.WithInstrumentationVersion(Version()), @@ -235,7 +166,7 @@ func StreamClientInterceptor(opts ...Option) grpc.StreamClientInterceptor { return streamer(ctx, desc, cc, method, callOpts...) } - name, attr, _ := telemetryAttributes(method, cc.Target()) + name, attr := telemetryAttributes(method, cc.Target()) startOpts := append([]trace.SpanStartOption{ trace.WithSpanKind(trace.SpanKindClient), @@ -265,81 +196,6 @@ func StreamClientInterceptor(opts ...Option) grpc.StreamClientInterceptor { } } -// UnaryServerInterceptor returns a grpc.UnaryServerInterceptor suitable -// for use in a grpc.NewServer call. -// -// Deprecated: Use [NewServerHandler] instead. -func UnaryServerInterceptor(opts ...Option) grpc.UnaryServerInterceptor { - cfg := newConfig(opts, "server") - tracer := cfg.TracerProvider.Tracer( - ScopeName, - trace.WithInstrumentationVersion(Version()), - ) - - return func( - ctx context.Context, - req interface{}, - info *grpc.UnaryServerInfo, - handler grpc.UnaryHandler, - ) (interface{}, error) { - i := &InterceptorInfo{ - UnaryServerInfo: info, - Type: UnaryServer, - } - if cfg.InterceptorFilter != nil && !cfg.InterceptorFilter(i) { - return handler(ctx, req) - } - - ctx = extract(ctx, cfg.Propagators) - name, attr, metricAttrs := telemetryAttributes(info.FullMethod, peerFromCtx(ctx)) - - startOpts := append([]trace.SpanStartOption{ - trace.WithSpanKind(trace.SpanKindServer), - trace.WithAttributes(attr...), - }, - cfg.SpanStartOptions..., - ) - - ctx, span := tracer.Start( - trace.ContextWithRemoteSpanContext(ctx, trace.SpanContextFromContext(ctx)), - name, - startOpts..., - ) - defer span.End() - - if cfg.ReceivedEvent { - messageReceived.Event(ctx, 1, req) - } - - before := time.Now() - - resp, err := handler(ctx, req) - - s, _ := status.FromError(err) - if err != nil { - statusCode, msg := serverStatus(s) - span.SetStatus(statusCode, msg) - if cfg.SentEvent { - messageSent.Event(ctx, 1, s.Proto()) - } - } else { - if cfg.SentEvent { - messageSent.Event(ctx, 1, resp) - } - } - grpcStatusCodeAttr := statusCodeAttr(s.Code()) - span.SetAttributes(grpcStatusCodeAttr) - - // Use floating point division here for higher precision (instead of Millisecond method). - elapsedTime := float64(time.Since(before)) / float64(time.Millisecond) - - metricAttrs = append(metricAttrs, grpcStatusCodeAttr) - cfg.rpcDuration.Record(ctx, elapsedTime, metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) - - return resp, err - } -} - // serverStream wraps around the embedded grpc.ServerStream, and intercepts the RecvMsg and // SendMsg method call. type serverStream struct { @@ -395,7 +251,7 @@ func wrapServerStream(ctx context.Context, ss grpc.ServerStream, cfg *config) *s // // Deprecated: Use [NewServerHandler] instead. func StreamServerInterceptor(opts ...Option) grpc.StreamServerInterceptor { - cfg := newConfig(opts, "server") + cfg := newConfig(opts) tracer := cfg.TracerProvider.Tracer( ScopeName, trace.WithInstrumentationVersion(Version()), @@ -417,7 +273,7 @@ func StreamServerInterceptor(opts ...Option) grpc.StreamServerInterceptor { } ctx = extract(ctx, cfg.Propagators) - name, attr, _ := telemetryAttributes(info.FullMethod, peerFromCtx(ctx)) + name, attr := telemetryAttributes(info.FullMethod, peerFromCtx(ctx)) startOpts := append([]trace.SpanStartOption{ trace.WithSpanKind(trace.SpanKindServer), @@ -449,47 +305,32 @@ func StreamServerInterceptor(opts ...Option) grpc.StreamServerInterceptor { // telemetryAttributes returns a span name and span and metric attributes from // the gRPC method and peer address. -func telemetryAttributes(fullMethod, peerAddress string) (string, []attribute.KeyValue, []attribute.KeyValue) { +func telemetryAttributes(fullMethod, sererAddr string) (string, []attribute.KeyValue) { name, methodAttrs := internal.ParseFullMethod(fullMethod) - peerAttrs := peerAttr(peerAddress) + srvAttrs := serverAddrAttrs(sererAddr) - attrs := make([]attribute.KeyValue, 0, 1+len(methodAttrs)+len(peerAttrs)) - attrs = append(attrs, RPCSystemGRPC) + attrs := make([]attribute.KeyValue, 0, 1+len(methodAttrs)+len(srvAttrs)) + attrs = append(attrs, semconv.RPCSystemGRPC) attrs = append(attrs, methodAttrs...) - metricAttrs := attrs[:1+len(methodAttrs)] - attrs = append(attrs, peerAttrs...) - return name, attrs, metricAttrs + attrs = append(attrs, srvAttrs...) + return name, attrs } -// peerAttr returns attributes about the peer address. -func peerAttr(addr string) []attribute.KeyValue { - host, p, err := net.SplitHostPort(addr) +// serverAddrAttrs returns the server address attributes for the hostport. +func serverAddrAttrs(hostport string) []attribute.KeyValue { + h, pStr, err := net.SplitHostPort(hostport) if err != nil { - return nil + // The server.address attribute is required. + return []attribute.KeyValue{semconv.ServerAddress(hostport)} } - - if host == "" { - host = "127.0.0.1" - } - port, err := strconv.Atoi(p) + p, err := strconv.Atoi(pStr) if err != nil { - return nil + return []attribute.KeyValue{semconv.ServerAddress(h)} } - - var attr []attribute.KeyValue - if ip := net.ParseIP(host); ip != nil { - attr = []attribute.KeyValue{ - semconv.NetSockPeerAddr(host), - semconv.NetSockPeerPort(port), - } - } else { - attr = []attribute.KeyValue{ - semconv.NetPeerName(host), - semconv.NetPeerPort(port), - } + return []attribute.KeyValue{ + semconv.ServerAddress(h), + semconv.ServerPort(p), } - - return attr } // peerFromCtx returns a peer address from a context, if one exists. @@ -503,7 +344,7 @@ func peerFromCtx(ctx context.Context) string { // statusCodeAttr returns status code attribute based on given gRPC code. func statusCodeAttr(c grpc_codes.Code) attribute.KeyValue { - return GRPCStatusCodeKey.Int64(int64(c)) + return semconv.RPCGRPCStatusCodeKey.Int64(int64(c)) } // serverStatus returns a span status code and message for a given gRPC diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go index bef07b7a3..1fa73c2f9 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal/parse.go @@ -1,13 +1,14 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 +// Package internal provides internal functionality for the otelgrpc package. package internal // import "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal" import ( "strings" "go.opentelemetry.io/otel/attribute" - semconv "go.opentelemetry.io/otel/semconv/v1.17.0" + semconv "go.opentelemetry.io/otel/semconv/v1.30.0" ) // ParseFullMethod returns a span name following the OpenTelemetry semantic diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go index 3aa37915d..6e67f0216 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/metadata_supplier.go @@ -45,7 +45,7 @@ func (s *metadataSupplier) Keys() []string { // requests. // Deprecated: Unnecessary public func. func Inject(ctx context.Context, md *metadata.MD, opts ...Option) { - c := newConfig(opts, "") + c := newConfig(opts) c.Propagators.Inject(ctx, &metadataSupplier{ metadata: md, }) @@ -67,7 +67,7 @@ func inject(ctx context.Context, propagators propagation.TextMapPropagator) cont // This function is meant to be used on incoming requests. // Deprecated: Unnecessary public func. func Extract(ctx context.Context, md *metadata.MD, opts ...Option) (baggage.Baggage, trace.SpanContext) { - c := newConfig(opts, "") + c := newConfig(opts) ctx = c.Propagators.Extract(ctx, &metadataSupplier{ metadata: md, }) diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/semconv.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/semconv.go deleted file mode 100644 index 409c621b7..000000000 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/semconv.go +++ /dev/null @@ -1,41 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package otelgrpc // import "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc" - -import ( - "go.opentelemetry.io/otel/attribute" - semconv "go.opentelemetry.io/otel/semconv/v1.17.0" -) - -// Semantic conventions for attribute keys for gRPC. -const ( - // Name of message transmitted or received. - RPCNameKey = attribute.Key("name") - - // Type of message transmitted or received. - RPCMessageTypeKey = attribute.Key("message.type") - - // Identifier of message transmitted or received. - RPCMessageIDKey = attribute.Key("message.id") - - // The compressed size of the message transmitted or received in bytes. - RPCMessageCompressedSizeKey = attribute.Key("message.compressed_size") - - // The uncompressed size of the message transmitted or received in - // bytes. - RPCMessageUncompressedSizeKey = attribute.Key("message.uncompressed_size") -) - -// Semantic conventions for common RPC attributes. -var ( - // Semantic convention for gRPC as the remoting system. - RPCSystemGRPC = semconv.RPCSystemGRPC - - // Semantic convention for a message named message. - RPCNameMessage = RPCNameKey.String("message") - - // Semantic conventions for RPC message types. - RPCMessageTypeSent = RPCMessageTypeKey.String("SENT") - RPCMessageTypeReceived = RPCMessageTypeKey.String("RECEIVED") -) diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go index 216127d6f..9bec51df3 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/stats_handler.go @@ -13,10 +13,12 @@ import ( "google.golang.org/grpc/stats" "google.golang.org/grpc/status" + "go.opentelemetry.io/otel" "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" "go.opentelemetry.io/otel/metric" - semconv "go.opentelemetry.io/otel/semconv/v1.17.0" + "go.opentelemetry.io/otel/metric/noop" + semconv "go.opentelemetry.io/otel/semconv/v1.30.0" "go.opentelemetry.io/otel/trace" "go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal" @@ -33,12 +35,91 @@ type gRPCContext struct { type serverHandler struct { *config + + tracer trace.Tracer + + duration metric.Float64Histogram + inSize metric.Int64Histogram + outSize metric.Int64Histogram + inMsg metric.Int64Histogram + outMsg metric.Int64Histogram } // NewServerHandler creates a stats.Handler for a gRPC server. func NewServerHandler(opts ...Option) stats.Handler { - h := &serverHandler{ - config: newConfig(opts, "server"), + c := newConfig(opts) + h := &serverHandler{config: c} + + h.tracer = c.TracerProvider.Tracer( + ScopeName, + trace.WithInstrumentationVersion(Version()), + ) + + meter := c.MeterProvider.Meter( + ScopeName, + metric.WithInstrumentationVersion(Version()), + metric.WithSchemaURL(semconv.SchemaURL), + ) + + var err error + h.duration, err = meter.Float64Histogram( + semconv.RPCServerDurationName, + metric.WithDescription(semconv.RPCServerDurationDescription), + metric.WithUnit(semconv.RPCServerDurationUnit), + ) + if err != nil { + otel.Handle(err) + if h.duration == nil { + h.duration = noop.Float64Histogram{} + } + } + + h.inSize, err = meter.Int64Histogram( + semconv.RPCServerRequestSizeName, + metric.WithDescription(semconv.RPCServerRequestSizeDescription), + metric.WithUnit(semconv.RPCServerRequestSizeUnit), + ) + if err != nil { + otel.Handle(err) + if h.inSize == nil { + h.inSize = noop.Int64Histogram{} + } + } + + h.outSize, err = meter.Int64Histogram( + semconv.RPCServerResponseSizeName, + metric.WithDescription(semconv.RPCServerResponseSizeDescription), + metric.WithUnit(semconv.RPCServerResponseSizeUnit), + ) + if err != nil { + otel.Handle(err) + if h.outSize == nil { + h.outSize = noop.Int64Histogram{} + } + } + + h.inMsg, err = meter.Int64Histogram( + semconv.RPCServerRequestsPerRPCName, + metric.WithDescription(semconv.RPCServerRequestsPerRPCDescription), + metric.WithUnit(semconv.RPCServerRequestsPerRPCUnit), + ) + if err != nil { + otel.Handle(err) + if h.inMsg == nil { + h.inMsg = noop.Int64Histogram{} + } + } + + h.outMsg, err = meter.Int64Histogram( + semconv.RPCServerResponsesPerRPCName, + metric.WithDescription(semconv.RPCServerResponsesPerRPCDescription), + metric.WithUnit(semconv.RPCServerResponsesPerRPCUnit), + ) + if err != nil { + otel.Handle(err) + if h.outMsg == nil { + h.outMsg = noop.Int64Histogram{} + } } return h @@ -55,14 +136,14 @@ func (h *serverHandler) HandleConn(ctx context.Context, info stats.ConnStats) { // TagRPC can attach some information to the given context. func (h *serverHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) context.Context { - ctx = extract(ctx, h.config.Propagators) + ctx = extract(ctx, h.Propagators) name, attrs := internal.ParseFullMethod(info.FullMethodName) - attrs = append(attrs, RPCSystemGRPC) + attrs = append(attrs, semconv.RPCSystemGRPC) record := true - if h.config.Filter != nil { - record = h.config.Filter(info) + if h.Filter != nil { + record = h.Filter(info) } if record { @@ -70,12 +151,12 @@ func (h *serverHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) cont trace.ContextWithRemoteSpanContext(ctx, trace.SpanContextFromContext(ctx)), name, trace.WithSpanKind(trace.SpanKindServer), - trace.WithAttributes(append(attrs, h.config.SpanAttributes...)...), + trace.WithAttributes(append(attrs, h.SpanAttributes...)...), ) } gctx := gRPCContext{ - metricAttrs: append(attrs, h.config.MetricAttributes...), + metricAttrs: append(attrs, h.MetricAttributes...), record: record, } @@ -84,18 +165,96 @@ func (h *serverHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) cont // HandleRPC processes the RPC stats. func (h *serverHandler) HandleRPC(ctx context.Context, rs stats.RPCStats) { - isServer := true - h.handleRPC(ctx, rs, isServer) + h.handleRPC(ctx, rs, h.duration, h.inSize, h.outSize, h.inMsg, h.outMsg, serverStatus) } type clientHandler struct { *config + + tracer trace.Tracer + + duration metric.Float64Histogram + inSize metric.Int64Histogram + outSize metric.Int64Histogram + inMsg metric.Int64Histogram + outMsg metric.Int64Histogram } // NewClientHandler creates a stats.Handler for a gRPC client. func NewClientHandler(opts ...Option) stats.Handler { - h := &clientHandler{ - config: newConfig(opts, "client"), + c := newConfig(opts) + h := &clientHandler{config: c} + + h.tracer = c.TracerProvider.Tracer( + ScopeName, + trace.WithInstrumentationVersion(Version()), + ) + + meter := c.MeterProvider.Meter( + ScopeName, + metric.WithInstrumentationVersion(Version()), + metric.WithSchemaURL(semconv.SchemaURL), + ) + + var err error + h.duration, err = meter.Float64Histogram( + semconv.RPCClientDurationName, + metric.WithDescription(semconv.RPCClientDurationDescription), + metric.WithUnit(semconv.RPCClientDurationUnit), + ) + if err != nil { + otel.Handle(err) + if h.duration == nil { + h.duration = noop.Float64Histogram{} + } + } + + h.outSize, err = meter.Int64Histogram( + semconv.RPCClientRequestSizeName, + metric.WithDescription(semconv.RPCClientRequestSizeDescription), + metric.WithUnit(semconv.RPCClientRequestSizeUnit), + ) + if err != nil { + otel.Handle(err) + if h.outSize == nil { + h.outSize = noop.Int64Histogram{} + } + } + + h.inSize, err = meter.Int64Histogram( + semconv.RPCClientResponseSizeName, + metric.WithDescription(semconv.RPCClientResponseSizeDescription), + metric.WithUnit(semconv.RPCClientResponseSizeUnit), + ) + if err != nil { + otel.Handle(err) + if h.inSize == nil { + h.inSize = noop.Int64Histogram{} + } + } + + h.outMsg, err = meter.Int64Histogram( + semconv.RPCClientRequestsPerRPCName, + metric.WithDescription(semconv.RPCClientRequestsPerRPCDescription), + metric.WithUnit(semconv.RPCClientRequestsPerRPCUnit), + ) + if err != nil { + otel.Handle(err) + if h.outMsg == nil { + h.outMsg = noop.Int64Histogram{} + } + } + + h.inMsg, err = meter.Int64Histogram( + semconv.RPCClientResponsesPerRPCName, + metric.WithDescription(semconv.RPCClientResponsesPerRPCDescription), + metric.WithUnit(semconv.RPCClientResponsesPerRPCUnit), + ) + if err != nil { + otel.Handle(err) + if h.inMsg == nil { + h.inMsg = noop.Int64Histogram{} + } } return h @@ -104,11 +263,11 @@ func NewClientHandler(opts ...Option) stats.Handler { // TagRPC can attach some information to the given context. func (h *clientHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) context.Context { name, attrs := internal.ParseFullMethod(info.FullMethodName) - attrs = append(attrs, RPCSystemGRPC) + attrs = append(attrs, semconv.RPCSystemGRPC) record := true - if h.config.Filter != nil { - record = h.config.Filter(info) + if h.Filter != nil { + record = h.Filter(info) } if record { @@ -116,22 +275,26 @@ func (h *clientHandler) TagRPC(ctx context.Context, info *stats.RPCTagInfo) cont ctx, name, trace.WithSpanKind(trace.SpanKindClient), - trace.WithAttributes(append(attrs, h.config.SpanAttributes...)...), + trace.WithAttributes(append(attrs, h.SpanAttributes...)...), ) } gctx := gRPCContext{ - metricAttrs: append(attrs, h.config.MetricAttributes...), + metricAttrs: append(attrs, h.MetricAttributes...), record: record, } - return inject(context.WithValue(ctx, gRPCContextKey{}, &gctx), h.config.Propagators) + return inject(context.WithValue(ctx, gRPCContextKey{}, &gctx), h.Propagators) } // HandleRPC processes the RPC stats. func (h *clientHandler) HandleRPC(ctx context.Context, rs stats.RPCStats) { - isServer := false - h.handleRPC(ctx, rs, isServer) + h.handleRPC( + ctx, rs, h.duration, h.inSize, h.outSize, h.inMsg, h.outMsg, + func(s *status.Status) (codes.Code, string) { + return codes.Error, s.Message() + }, + ) } // TagConn can attach some information to the given context. @@ -144,77 +307,86 @@ func (h *clientHandler) HandleConn(context.Context, stats.ConnStats) { // no-op } -func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool) { // nolint: revive // isServer is not a control flag. - span := trace.SpanFromContext(ctx) - var metricAttrs []attribute.KeyValue - var messageId int64 - +func (c *config) handleRPC( + ctx context.Context, + rs stats.RPCStats, + duration metric.Float64Histogram, + inSize, outSize, inMsg, outMsg metric.Int64Histogram, + recordStatus func(*status.Status) (codes.Code, string), +) { gctx, _ := ctx.Value(gRPCContextKey{}).(*gRPCContext) - if gctx != nil { - if !gctx.record { - return - } - metricAttrs = make([]attribute.KeyValue, 0, len(gctx.metricAttrs)+1) - metricAttrs = append(metricAttrs, gctx.metricAttrs...) + if gctx != nil && !gctx.record { + return } + span := trace.SpanFromContext(ctx) + var messageId int64 + switch rs := rs.(type) { case *stats.Begin: case *stats.InPayload: if gctx != nil { messageId = atomic.AddInt64(&gctx.inMessages, 1) - c.rpcInBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) + inSize.Record(ctx, int64(rs.Length), metric.WithAttributes(gctx.metricAttrs...)) } - if c.ReceivedEvent { + if c.ReceivedEvent && span.IsRecording() { span.AddEvent("message", trace.WithAttributes( - semconv.MessageTypeReceived, - semconv.MessageIDKey.Int64(messageId), - semconv.MessageCompressedSizeKey.Int(rs.CompressedLength), - semconv.MessageUncompressedSizeKey.Int(rs.Length), + semconv.RPCMessageTypeReceived, + semconv.RPCMessageIDKey.Int64(messageId), + semconv.RPCMessageCompressedSizeKey.Int(rs.CompressedLength), + semconv.RPCMessageUncompressedSizeKey.Int(rs.Length), ), ) } case *stats.OutPayload: if gctx != nil { messageId = atomic.AddInt64(&gctx.outMessages, 1) - c.rpcOutBytes.Record(ctx, int64(rs.Length), metric.WithAttributeSet(attribute.NewSet(metricAttrs...))) + outSize.Record(ctx, int64(rs.Length), metric.WithAttributes(gctx.metricAttrs...)) } - if c.SentEvent { + if c.SentEvent && span.IsRecording() { span.AddEvent("message", trace.WithAttributes( - semconv.MessageTypeSent, - semconv.MessageIDKey.Int64(messageId), - semconv.MessageCompressedSizeKey.Int(rs.CompressedLength), - semconv.MessageUncompressedSizeKey.Int(rs.Length), + semconv.RPCMessageTypeSent, + semconv.RPCMessageIDKey.Int64(messageId), + semconv.RPCMessageCompressedSizeKey.Int(rs.CompressedLength), + semconv.RPCMessageUncompressedSizeKey.Int(rs.Length), ), ) } case *stats.OutTrailer: case *stats.OutHeader: - if p, ok := peer.FromContext(ctx); ok { - span.SetAttributes(peerAttr(p.Addr.String())...) + if span.IsRecording() { + if p, ok := peer.FromContext(ctx); ok { + span.SetAttributes(serverAddrAttrs(p.Addr.String())...) + } } case *stats.End: var rpcStatusAttr attribute.KeyValue + var s *status.Status if rs.Error != nil { - s, _ := status.FromError(rs.Error) - if isServer { - statusCode, msg := serverStatus(s) - span.SetStatus(statusCode, msg) - } else { - span.SetStatus(codes.Error, s.Message()) - } + s, _ = status.FromError(rs.Error) rpcStatusAttr = semconv.RPCGRPCStatusCodeKey.Int(int(s.Code())) } else { rpcStatusAttr = semconv.RPCGRPCStatusCodeKey.Int(int(grpc_codes.OK)) } - span.SetAttributes(rpcStatusAttr) - span.End() + if span.IsRecording() { + if s != nil { + c, m := recordStatus(s) + span.SetStatus(c, m) + } + span.SetAttributes(rpcStatusAttr) + span.End() + } + var metricAttrs []attribute.KeyValue + if gctx != nil { + metricAttrs = make([]attribute.KeyValue, 0, len(gctx.metricAttrs)+1) + metricAttrs = append(metricAttrs, gctx.metricAttrs...) + } metricAttrs = append(metricAttrs, rpcStatusAttr) // Allocate vararg slice once. recordOpts := []metric.RecordOption{metric.WithAttributeSet(attribute.NewSet(metricAttrs...))} @@ -223,10 +395,10 @@ func (c *config) handleRPC(ctx context.Context, rs stats.RPCStats, isServer bool // Measure right before calling Record() to capture as much elapsed time as possible. elapsedTime := float64(rs.EndTime.Sub(rs.BeginTime)) / float64(time.Millisecond) - c.rpcDuration.Record(ctx, elapsedTime, recordOpts...) + duration.Record(ctx, elapsedTime, recordOpts...) if gctx != nil { - c.rpcInMessages.Record(ctx, atomic.LoadInt64(&gctx.inMessages), recordOpts...) - c.rpcOutMessages.Record(ctx, atomic.LoadInt64(&gctx.outMessages), recordOpts...) + inMsg.Record(ctx, atomic.LoadInt64(&gctx.inMessages), recordOpts...) + outMsg.Record(ctx, atomic.LoadInt64(&gctx.outMessages), recordOpts...) } default: return diff --git a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go index 442e8a838..b1feeca49 100644 --- a/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go +++ b/vendor/go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/version.go @@ -5,13 +5,6 @@ package otelgrpc // import "go.opentelemetry.io/contrib/instrumentation/google.g // Version is the current release version of the gRPC instrumentation. func Version() string { - return "0.60.0" + return "0.61.0" // This string is updated by the pre_release.sh script during release } - -// SemVersion is the semantic version to be supplied to tracer/meter creation. -// -// Deprecated: Use [Version] instead. -func SemVersion() string { - return Version() -} diff --git a/vendor/go.opentelemetry.io/otel/.clomonitor.yml b/vendor/go.opentelemetry.io/otel/.clomonitor.yml new file mode 100644 index 000000000..128d61a22 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/.clomonitor.yml @@ -0,0 +1,3 @@ +exemptions: + - check: artifacthub_badge + reason: "Artifact Hub doesn't support Go packages" diff --git a/vendor/go.opentelemetry.io/otel/.golangci.yml b/vendor/go.opentelemetry.io/otel/.golangci.yml index 888e5da80..5f69cc027 100644 --- a/vendor/go.opentelemetry.io/otel/.golangci.yml +++ b/vendor/go.opentelemetry.io/otel/.golangci.yml @@ -66,8 +66,6 @@ linters: desc: Do not use cross-module internal packages. - pkg: go.opentelemetry.io/otel/internal/internaltest desc: Do not use cross-module internal packages. - - pkg: go.opentelemetry.io/otel/internal/matchers - desc: Do not use cross-module internal packages. otlp-internal: files: - '!**/exporters/otlp/internal/**/*.go' @@ -190,6 +188,10 @@ linters: - legacy - std-error-handling rules: + - linters: + - revive + path: schema/v.*/types/.* + text: avoid meaningless package names # TODO: Having appropriate comments for exported objects helps development, # even for objects in internal packages. Appropriate comments for all # exported objects should be added and this exclusion removed. diff --git a/vendor/go.opentelemetry.io/otel/CHANGELOG.md b/vendor/go.opentelemetry.io/otel/CHANGELOG.md index 648e4abab..4acc75701 100644 --- a/vendor/go.opentelemetry.io/otel/CHANGELOG.md +++ b/vendor/go.opentelemetry.io/otel/CHANGELOG.md @@ -11,6 +11,61 @@ This project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.htm +## [1.37.0/0.59.0/0.13.0] 2025-06-25 + +### Added + +- The `go.opentelemetry.io/otel/semconv/v1.33.0` package. + The package contains semantic conventions from the `v1.33.0` version of the OpenTelemetry Semantic Conventions. + See the [migration documentation](./semconv/v1.33.0/MIGRATION.md) for information on how to upgrade from `go.opentelemetry.io/otel/semconv/v1.32.0.`(#6799) +- The `go.opentelemetry.io/otel/semconv/v1.34.0` package. + The package contains semantic conventions from the `v1.34.0` version of the OpenTelemetry Semantic Conventions. (#6812) +- Add metric's schema URL as `otel_scope_schema_url` label in `go.opentelemetry.io/otel/exporters/prometheus`. (#5947) +- Add metric's scope attributes as `otel_scope_[attribute]` labels in `go.opentelemetry.io/otel/exporters/prometheus`. (#5947) +- Add `EventName` to `EnabledParameters` in `go.opentelemetry.io/otel/log`. (#6825) +- Add `EventName` to `EnabledParameters` in `go.opentelemetry.io/otel/sdk/log`. (#6825) +- Changed handling of `go.opentelemetry.io/otel/exporters/prometheus` metric renaming to add unit suffixes when it doesn't match one of the pre-defined values in the unit suffix map. (#6839) + +### Changed + +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/bridge/opentracing`. (#6827) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/exporters/zipkin`. (#6829) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/metric`. (#6832) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/sdk/resource`. (#6834) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/sdk/trace`. (#6835) +- The semantic conventions have been upgraded from `v1.26.0` to `v1.34.0` in `go.opentelemetry.io/otel/trace`. (#6836) +- `Record.Resource` now returns `*resource.Resource` instead of `resource.Resource` in `go.opentelemetry.io/otel/sdk/log`. (#6864) +- Retry now shows error cause for context timeout in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc`, `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp`, `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp`, `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp`. (#6898) + +### Fixed + +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc`. (#6710) +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracehttp`. (#6710) +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc`. (#6710) +- Stop stripping trailing slashes from configured endpoint URL in `go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp`. (#6710) +- Validate exponential histogram scale range for Prometheus compatibility in `go.opentelemetry.io/otel/exporters/prometheus`. (#6822) +- Context cancellation during metric pipeline produce does not corrupt data in `go.opentelemetry.io/otel/sdk/metric`. (#6914) + +### Removed + +- `go.opentelemetry.io/otel/exporters/prometheus` no longer exports `otel_scope_info` metric. (#6770) + +## [0.12.2] 2025-05-22 + +### Fixed + +- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc` module that contains invalid dependencies. (#6804) +- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp` module that contains invalid dependencies. (#6804) +- Retract `v0.12.0` release of `go.opentelemetry.io/otel/exporters/stdout/stdoutlog` module that contains invalid dependencies. (#6804) + +## [0.12.1] 2025-05-21 + +### Fixes + +- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc`. (#6800) +- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp`. (#6800) +- Use the proper dependency version of `go.opentelemetry.io/otel/sdk/log/logtest` in `go.opentelemetry.io/otel/exporters/stdout/stdoutlog`. (#6800) + ## [1.36.0/0.58.0/0.12.0] 2025-05-20 ### Added @@ -3288,7 +3343,10 @@ It contains api and sdk for trace and meter. - CircleCI build CI manifest files. - CODEOWNERS file to track owners of this project. -[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.36.0...HEAD +[Unreleased]: https://github.com/open-telemetry/opentelemetry-go/compare/v1.37.0...HEAD +[1.37.0/0.59.0/0.13.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.37.0 +[0.12.2]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/log/v0.12.2 +[0.12.1]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/log/v0.12.1 [1.36.0/0.58.0/0.12.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.36.0 [1.35.0/0.57.0/0.11.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.35.0 [1.34.0/0.56.0/0.10.0]: https://github.com/open-telemetry/opentelemetry-go/releases/tag/v1.34.0 diff --git a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md index 1902dac05..f9ddc281f 100644 --- a/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md +++ b/vendor/go.opentelemetry.io/otel/CONTRIBUTING.md @@ -109,10 +109,9 @@ A PR is considered **ready to merge** when: This is not enforced through automation, but needs to be validated by the maintainer merging. - * The qualified approvals need to be from [Approver]s/[Maintainer]s - affiliated with different companies. Two qualified approvals from - [Approver]s or [Maintainer]s affiliated with the same company counts as a - single qualified approval. + * At least one of the qualified approvals need to be from an + [Approver]/[Maintainer] affiliated with a different company than the author + of the PR. * PRs introducing changes that have already been discussed and consensus reached only need one qualified approval. The discussion and resolution needs to be linked to the PR. @@ -650,11 +649,11 @@ should be canceled. ### Maintainers -- [Damien Mathieu](https://github.com/dmathieu), Elastic -- [David Ashpole](https://github.com/dashpole), Google -- [Robert Pająk](https://github.com/pellared), Splunk -- [Sam Xie](https://github.com/XSAM), Cisco/AppDynamics -- [Tyler Yahn](https://github.com/MrAlias), Splunk +- [Damien Mathieu](https://github.com/dmathieu), Elastic ([GPG](https://keys.openpgp.org/search?q=5A126B972A81A6CE443E5E1B408B8E44F0873832)) +- [David Ashpole](https://github.com/dashpole), Google ([GPG](https://keys.openpgp.org/search?q=C0D1BDDCAAEAE573673085F176327DA4D864DC70)) +- [Robert Pająk](https://github.com/pellared), Splunk ([GPG](https://keys.openpgp.org/search?q=CDAD3A60476A3DE599AA5092E5F7C35A4DBE90C2)) +- [Sam Xie](https://github.com/XSAM), Splunk ([GPG](https://keys.openpgp.org/search?q=AEA033782371ABB18EE39188B8044925D6FEEBEA)) +- [Tyler Yahn](https://github.com/MrAlias), Splunk ([GPG](https://keys.openpgp.org/search?q=0x46B0F3E1A8B1BA5A)) ### Emeritus diff --git a/vendor/go.opentelemetry.io/otel/Makefile b/vendor/go.opentelemetry.io/otel/Makefile index 62a56f4d3..4fa423ca0 100644 --- a/vendor/go.opentelemetry.io/otel/Makefile +++ b/vendor/go.opentelemetry.io/otel/Makefile @@ -293,7 +293,7 @@ semconv-generate: $(SEMCONVKIT) --param tag=$(TAG) \ go \ /home/weaver/target - $(SEMCONVKIT) -output "$(SEMCONVPKG)/$(TAG)" -tag "$(TAG)" + $(SEMCONVKIT) -semconv "$(SEMCONVPKG)" -tag "$(TAG)" .PHONY: gorelease gorelease: $(OTEL_GO_MOD_DIRS:%=gorelease/%) diff --git a/vendor/go.opentelemetry.io/otel/README.md b/vendor/go.opentelemetry.io/otel/README.md index b60078812..5fa1b75c6 100644 --- a/vendor/go.opentelemetry.io/otel/README.md +++ b/vendor/go.opentelemetry.io/otel/README.md @@ -7,6 +7,7 @@ [![OpenSSF Scorecard](https://api.scorecard.dev/projects/github.com/open-telemetry/opentelemetry-go/badge)](https://scorecard.dev/viewer/?uri=github.com/open-telemetry/opentelemetry-go) [![OpenSSF Best Practices](https://www.bestpractices.dev/projects/9996/badge)](https://www.bestpractices.dev/projects/9996) [![Fuzzing Status](https://oss-fuzz-build-logs.storage.googleapis.com/badges/opentelemetry-go.svg)](https://issues.oss-fuzz.com/issues?q=project:opentelemetry-go) +[![FOSSA Status](https://app.fossa.com/api/projects/custom%2B162%2Fgithub.com%2Fopen-telemetry%2Fopentelemetry-go.svg?type=shield&issueType=license)](https://app.fossa.com/projects/custom%2B162%2Fgithub.com%2Fopen-telemetry%2Fopentelemetry-go?ref=badge_shield&issueType=license) [![Slack](https://img.shields.io/badge/slack-@cncf/otel--go-brightgreen.svg?logo=slack)](https://cloud-native.slack.com/archives/C01NPAXACKT) OpenTelemetry-Go is the [Go](https://golang.org/) implementation of [OpenTelemetry](https://opentelemetry.io/). diff --git a/vendor/go.opentelemetry.io/otel/RELEASING.md b/vendor/go.opentelemetry.io/otel/RELEASING.md index 7c1a9119d..1ddcdef03 100644 --- a/vendor/go.opentelemetry.io/otel/RELEASING.md +++ b/vendor/go.opentelemetry.io/otel/RELEASING.md @@ -112,6 +112,29 @@ It is critical you make sure the version you push upstream is correct. Finally create a Release for the new `` on GitHub. The release body should include all the release notes from the Changelog for this release. +### Sign the Release Artifact + +To ensure we comply with CNCF best practices, we need to sign the release artifact. +The tarball attached to the GitHub release needs to be signed with your GPG key. + +Follow [these steps] to sign the release artifact and upload it to GitHub. +You can use [this script] to verify the contents of the tarball before signing it. + +Be sure to use the correct GPG key when signing the release artifact. + +```terminal +gpg --local-user --armor --detach-sign opentelemetry-go-.tar.gz +``` + +You can verify the signature with: + +```terminal +gpg --verify opentelemetry-go-.tar.gz.asc opentelemetry-go-.tar.gz +``` + +[these steps]: https://wiki.debian.org/Creating%20signed%20GitHub%20releases +[this script]: https://github.com/MrAlias/attest-sh + ## Post-Release ### Contrib Repository diff --git a/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile b/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile index 51fb76b30..935bd4876 100644 --- a/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile +++ b/vendor/go.opentelemetry.io/otel/dependencies.Dockerfile @@ -1,4 +1,4 @@ # This is a renovate-friendly source of Docker images. -FROM python:3.13.3-slim-bullseye@sha256:9e3f9243e06fd68eb9519074b49878eda20ad39a855fac51aaffb741de20726e AS python -FROM otel/weaver:v0.15.0@sha256:1cf1c72eaed57dad813c2e359133b8a15bd4facf305aae5b13bdca6d3eccff56 AS weaver +FROM python:3.13.5-slim-bullseye@sha256:5b9fc0d8ef79cfb5f300e61cb516e0c668067bbf77646762c38c94107e230dbc AS python +FROM otel/weaver:v0.15.2@sha256:b13acea09f721774daba36344861f689ac4bb8d6ecd94c4600b4d590c8fb34b9 AS weaver FROM avtodev/markdown-lint:v1@sha256:6aeedc2f49138ce7a1cd0adffc1b1c0321b841dc2102408967d9301c031949ee AS markdown diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/README.md b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/README.md deleted file mode 100644 index 87b842c5d..000000000 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/README.md +++ /dev/null @@ -1,3 +0,0 @@ -# Semconv v1.17.0 - -[![PkgGoDev](https://pkg.go.dev/badge/go.opentelemetry.io/otel/semconv/v1.17.0)](https://pkg.go.dev/go.opentelemetry.io/otel/semconv/v1.17.0) diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/event.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/event.go deleted file mode 100644 index c7b804bbe..000000000 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/event.go +++ /dev/null @@ -1,188 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -// Code generated from semantic convention specification. DO NOT EDIT. - -package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0" - -import "go.opentelemetry.io/otel/attribute" - -// This semantic convention defines the attributes used to represent a feature -// flag evaluation as an event. -const ( - // FeatureFlagKeyKey is the attribute Key conforming to the - // "feature_flag.key" semantic conventions. It represents the unique - // identifier of the feature flag. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'logo-color' - FeatureFlagKeyKey = attribute.Key("feature_flag.key") - - // FeatureFlagProviderNameKey is the attribute Key conforming to the - // "feature_flag.provider_name" semantic conventions. It represents the - // name of the service provider that performs the flag evaluation. - // - // Type: string - // RequirementLevel: Recommended - // Stability: stable - // Examples: 'Flag Manager' - FeatureFlagProviderNameKey = attribute.Key("feature_flag.provider_name") - - // FeatureFlagVariantKey is the attribute Key conforming to the - // "feature_flag.variant" semantic conventions. It represents the sHOULD be - // a semantic identifier for a value. If one is unavailable, a stringified - // version of the value can be used. - // - // Type: string - // RequirementLevel: Recommended - // Stability: stable - // Examples: 'red', 'true', 'on' - // Note: A semantic identifier, commonly referred to as a variant, provides - // a means - // for referring to a value without including the value itself. This can - // provide additional context for understanding the meaning behind a value. - // For example, the variant `red` maybe be used for the value `#c05543`. - // - // A stringified version of the value can be used in situations where a - // semantic identifier is unavailable. String representation of the value - // should be determined by the implementer. - FeatureFlagVariantKey = attribute.Key("feature_flag.variant") -) - -// FeatureFlagKey returns an attribute KeyValue conforming to the -// "feature_flag.key" semantic conventions. It represents the unique identifier -// of the feature flag. -func FeatureFlagKey(val string) attribute.KeyValue { - return FeatureFlagKeyKey.String(val) -} - -// FeatureFlagProviderName returns an attribute KeyValue conforming to the -// "feature_flag.provider_name" semantic conventions. It represents the name of -// the service provider that performs the flag evaluation. -func FeatureFlagProviderName(val string) attribute.KeyValue { - return FeatureFlagProviderNameKey.String(val) -} - -// FeatureFlagVariant returns an attribute KeyValue conforming to the -// "feature_flag.variant" semantic conventions. It represents the sHOULD be a -// semantic identifier for a value. If one is unavailable, a stringified -// version of the value can be used. -func FeatureFlagVariant(val string) attribute.KeyValue { - return FeatureFlagVariantKey.String(val) -} - -// RPC received/sent message. -const ( - // MessageTypeKey is the attribute Key conforming to the "message.type" - // semantic conventions. It represents the whether this is a received or - // sent message. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - MessageTypeKey = attribute.Key("message.type") - - // MessageIDKey is the attribute Key conforming to the "message.id" - // semantic conventions. It represents the mUST be calculated as two - // different counters starting from `1` one for sent messages and one for - // received message. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Note: This way we guarantee that the values will be consistent between - // different implementations. - MessageIDKey = attribute.Key("message.id") - - // MessageCompressedSizeKey is the attribute Key conforming to the - // "message.compressed_size" semantic conventions. It represents the - // compressed size of the message in bytes. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - MessageCompressedSizeKey = attribute.Key("message.compressed_size") - - // MessageUncompressedSizeKey is the attribute Key conforming to the - // "message.uncompressed_size" semantic conventions. It represents the - // uncompressed size of the message in bytes. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - MessageUncompressedSizeKey = attribute.Key("message.uncompressed_size") -) - -var ( - // sent - MessageTypeSent = MessageTypeKey.String("SENT") - // received - MessageTypeReceived = MessageTypeKey.String("RECEIVED") -) - -// MessageID returns an attribute KeyValue conforming to the "message.id" -// semantic conventions. It represents the mUST be calculated as two different -// counters starting from `1` one for sent messages and one for received -// message. -func MessageID(val int) attribute.KeyValue { - return MessageIDKey.Int(val) -} - -// MessageCompressedSize returns an attribute KeyValue conforming to the -// "message.compressed_size" semantic conventions. It represents the compressed -// size of the message in bytes. -func MessageCompressedSize(val int) attribute.KeyValue { - return MessageCompressedSizeKey.Int(val) -} - -// MessageUncompressedSize returns an attribute KeyValue conforming to the -// "message.uncompressed_size" semantic conventions. It represents the -// uncompressed size of the message in bytes. -func MessageUncompressedSize(val int) attribute.KeyValue { - return MessageUncompressedSizeKey.Int(val) -} - -// The attributes used to report a single exception associated with a span. -const ( - // ExceptionEscapedKey is the attribute Key conforming to the - // "exception.escaped" semantic conventions. It represents the sHOULD be - // set to true if the exception event is recorded at a point where it is - // known that the exception is escaping the scope of the span. - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - // Note: An exception is considered to have escaped (or left) the scope of - // a span, - // if that span is ended while the exception is still logically "in - // flight". - // This may be actually "in flight" in some languages (e.g. if the - // exception - // is passed to a Context manager's `__exit__` method in Python) but will - // usually be caught at the point of recording the exception in most - // languages. - // - // It is usually not possible to determine at the point where an exception - // is thrown - // whether it will escape the scope of a span. - // However, it is trivial to know that an exception - // will escape, if one checks for an active exception just before ending - // the span, - // as done in the [example above](#recording-an-exception). - // - // It follows that an exception may still escape the scope of the span - // even if the `exception.escaped` attribute was not set or set to false, - // since the event might have been recorded at a time where it was not - // clear whether the exception will escape. - ExceptionEscapedKey = attribute.Key("exception.escaped") -) - -// ExceptionEscaped returns an attribute KeyValue conforming to the -// "exception.escaped" semantic conventions. It represents the sHOULD be set to -// true if the exception event is recorded at a point where it is known that -// the exception is escaping the scope of the span. -func ExceptionEscaped(val bool) attribute.KeyValue { - return ExceptionEscapedKey.Bool(val) -} diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/http.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/http.go deleted file mode 100644 index d318221e5..000000000 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/http.go +++ /dev/null @@ -1,10 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0" - -// HTTP scheme attributes. -var ( - HTTPSchemeHTTP = HTTPSchemeKey.String("http") - HTTPSchemeHTTPS = HTTPSchemeKey.String("https") -) diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/resource.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/resource.go deleted file mode 100644 index 7e365e82c..000000000 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/resource.go +++ /dev/null @@ -1,1999 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -// Code generated from semantic convention specification. DO NOT EDIT. - -package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0" - -import "go.opentelemetry.io/otel/attribute" - -// The web browser in which the application represented by the resource is -// running. The `browser.*` attributes MUST be used only for resources that -// represent applications running in a web browser (regardless of whether -// running on a mobile or desktop device). -const ( - // BrowserBrandsKey is the attribute Key conforming to the "browser.brands" - // semantic conventions. It represents the array of brand name and version - // separated by a space - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: ' Not A;Brand 99', 'Chromium 99', 'Chrome 99' - // Note: This value is intended to be taken from the [UA client hints - // API](https://wicg.github.io/ua-client-hints/#interface) - // (`navigator.userAgentData.brands`). - BrowserBrandsKey = attribute.Key("browser.brands") - - // BrowserPlatformKey is the attribute Key conforming to the - // "browser.platform" semantic conventions. It represents the platform on - // which the browser is running - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Windows', 'macOS', 'Android' - // Note: This value is intended to be taken from the [UA client hints - // API](https://wicg.github.io/ua-client-hints/#interface) - // (`navigator.userAgentData.platform`). If unavailable, the legacy - // `navigator.platform` API SHOULD NOT be used instead and this attribute - // SHOULD be left unset in order for the values to be consistent. - // The list of possible values is defined in the [W3C User-Agent Client - // Hints - // specification](https://wicg.github.io/ua-client-hints/#sec-ch-ua-platform). - // Note that some (but not all) of these values can overlap with values in - // the [`os.type` and `os.name` attributes](./os.md). However, for - // consistency, the values in the `browser.platform` attribute should - // capture the exact value that the user agent provides. - BrowserPlatformKey = attribute.Key("browser.platform") - - // BrowserMobileKey is the attribute Key conforming to the "browser.mobile" - // semantic conventions. It represents a boolean that is true if the - // browser is running on a mobile device - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - // Note: This value is intended to be taken from the [UA client hints - // API](https://wicg.github.io/ua-client-hints/#interface) - // (`navigator.userAgentData.mobile`). If unavailable, this attribute - // SHOULD be left unset. - BrowserMobileKey = attribute.Key("browser.mobile") - - // BrowserUserAgentKey is the attribute Key conforming to the - // "browser.user_agent" semantic conventions. It represents the full - // user-agent string provided by the browser - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Mozilla/5.0 (Macintosh; Intel Mac OS X 10_15_7) - // AppleWebKit/537.36 (KHTML, ' - // 'like Gecko) Chrome/95.0.4638.54 Safari/537.36' - // Note: The user-agent value SHOULD be provided only from browsers that do - // not have a mechanism to retrieve brands and platform individually from - // the User-Agent Client Hints API. To retrieve the value, the legacy - // `navigator.userAgent` API can be used. - BrowserUserAgentKey = attribute.Key("browser.user_agent") - - // BrowserLanguageKey is the attribute Key conforming to the - // "browser.language" semantic conventions. It represents the preferred - // language of the user using the browser - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'en', 'en-US', 'fr', 'fr-FR' - // Note: This value is intended to be taken from the Navigator API - // `navigator.language`. - BrowserLanguageKey = attribute.Key("browser.language") -) - -// BrowserBrands returns an attribute KeyValue conforming to the -// "browser.brands" semantic conventions. It represents the array of brand name -// and version separated by a space -func BrowserBrands(val ...string) attribute.KeyValue { - return BrowserBrandsKey.StringSlice(val) -} - -// BrowserPlatform returns an attribute KeyValue conforming to the -// "browser.platform" semantic conventions. It represents the platform on which -// the browser is running -func BrowserPlatform(val string) attribute.KeyValue { - return BrowserPlatformKey.String(val) -} - -// BrowserMobile returns an attribute KeyValue conforming to the -// "browser.mobile" semantic conventions. It represents a boolean that is true -// if the browser is running on a mobile device -func BrowserMobile(val bool) attribute.KeyValue { - return BrowserMobileKey.Bool(val) -} - -// BrowserUserAgent returns an attribute KeyValue conforming to the -// "browser.user_agent" semantic conventions. It represents the full user-agent -// string provided by the browser -func BrowserUserAgent(val string) attribute.KeyValue { - return BrowserUserAgentKey.String(val) -} - -// BrowserLanguage returns an attribute KeyValue conforming to the -// "browser.language" semantic conventions. It represents the preferred -// language of the user using the browser -func BrowserLanguage(val string) attribute.KeyValue { - return BrowserLanguageKey.String(val) -} - -// A cloud environment (e.g. GCP, Azure, AWS) -const ( - // CloudProviderKey is the attribute Key conforming to the "cloud.provider" - // semantic conventions. It represents the name of the cloud provider. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - CloudProviderKey = attribute.Key("cloud.provider") - - // CloudAccountIDKey is the attribute Key conforming to the - // "cloud.account.id" semantic conventions. It represents the cloud account - // ID the resource is assigned to. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '111111111111', 'opentelemetry' - CloudAccountIDKey = attribute.Key("cloud.account.id") - - // CloudRegionKey is the attribute Key conforming to the "cloud.region" - // semantic conventions. It represents the geographical region the resource - // is running. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'us-central1', 'us-east-1' - // Note: Refer to your provider's docs to see the available regions, for - // example [Alibaba Cloud - // regions](https://www.alibabacloud.com/help/doc-detail/40654.htm), [AWS - // regions](https://aws.amazon.com/about-aws/global-infrastructure/regions_az/), - // [Azure - // regions](https://azure.microsoft.com/en-us/global-infrastructure/geographies/), - // [Google Cloud regions](https://cloud.google.com/about/locations), or - // [Tencent Cloud - // regions](https://intl.cloud.tencent.com/document/product/213/6091). - CloudRegionKey = attribute.Key("cloud.region") - - // CloudAvailabilityZoneKey is the attribute Key conforming to the - // "cloud.availability_zone" semantic conventions. It represents the cloud - // regions often have multiple, isolated locations known as zones to - // increase availability. Availability zone represents the zone where the - // resource is running. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'us-east-1c' - // Note: Availability zones are called "zones" on Alibaba Cloud and Google - // Cloud. - CloudAvailabilityZoneKey = attribute.Key("cloud.availability_zone") - - // CloudPlatformKey is the attribute Key conforming to the "cloud.platform" - // semantic conventions. It represents the cloud platform in use. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - // Note: The prefix of the service SHOULD match the one specified in - // `cloud.provider`. - CloudPlatformKey = attribute.Key("cloud.platform") -) - -var ( - // Alibaba Cloud - CloudProviderAlibabaCloud = CloudProviderKey.String("alibaba_cloud") - // Amazon Web Services - CloudProviderAWS = CloudProviderKey.String("aws") - // Microsoft Azure - CloudProviderAzure = CloudProviderKey.String("azure") - // Google Cloud Platform - CloudProviderGCP = CloudProviderKey.String("gcp") - // IBM Cloud - CloudProviderIbmCloud = CloudProviderKey.String("ibm_cloud") - // Tencent Cloud - CloudProviderTencentCloud = CloudProviderKey.String("tencent_cloud") -) - -var ( - // Alibaba Cloud Elastic Compute Service - CloudPlatformAlibabaCloudECS = CloudPlatformKey.String("alibaba_cloud_ecs") - // Alibaba Cloud Function Compute - CloudPlatformAlibabaCloudFc = CloudPlatformKey.String("alibaba_cloud_fc") - // Red Hat OpenShift on Alibaba Cloud - CloudPlatformAlibabaCloudOpenshift = CloudPlatformKey.String("alibaba_cloud_openshift") - // AWS Elastic Compute Cloud - CloudPlatformAWSEC2 = CloudPlatformKey.String("aws_ec2") - // AWS Elastic Container Service - CloudPlatformAWSECS = CloudPlatformKey.String("aws_ecs") - // AWS Elastic Kubernetes Service - CloudPlatformAWSEKS = CloudPlatformKey.String("aws_eks") - // AWS Lambda - CloudPlatformAWSLambda = CloudPlatformKey.String("aws_lambda") - // AWS Elastic Beanstalk - CloudPlatformAWSElasticBeanstalk = CloudPlatformKey.String("aws_elastic_beanstalk") - // AWS App Runner - CloudPlatformAWSAppRunner = CloudPlatformKey.String("aws_app_runner") - // Red Hat OpenShift on AWS (ROSA) - CloudPlatformAWSOpenshift = CloudPlatformKey.String("aws_openshift") - // Azure Virtual Machines - CloudPlatformAzureVM = CloudPlatformKey.String("azure_vm") - // Azure Container Instances - CloudPlatformAzureContainerInstances = CloudPlatformKey.String("azure_container_instances") - // Azure Kubernetes Service - CloudPlatformAzureAKS = CloudPlatformKey.String("azure_aks") - // Azure Functions - CloudPlatformAzureFunctions = CloudPlatformKey.String("azure_functions") - // Azure App Service - CloudPlatformAzureAppService = CloudPlatformKey.String("azure_app_service") - // Azure Red Hat OpenShift - CloudPlatformAzureOpenshift = CloudPlatformKey.String("azure_openshift") - // Google Cloud Compute Engine (GCE) - CloudPlatformGCPComputeEngine = CloudPlatformKey.String("gcp_compute_engine") - // Google Cloud Run - CloudPlatformGCPCloudRun = CloudPlatformKey.String("gcp_cloud_run") - // Google Cloud Kubernetes Engine (GKE) - CloudPlatformGCPKubernetesEngine = CloudPlatformKey.String("gcp_kubernetes_engine") - // Google Cloud Functions (GCF) - CloudPlatformGCPCloudFunctions = CloudPlatformKey.String("gcp_cloud_functions") - // Google Cloud App Engine (GAE) - CloudPlatformGCPAppEngine = CloudPlatformKey.String("gcp_app_engine") - // Red Hat OpenShift on Google Cloud - CloudPlatformGoogleCloudOpenshift = CloudPlatformKey.String("google_cloud_openshift") - // Red Hat OpenShift on IBM Cloud - CloudPlatformIbmCloudOpenshift = CloudPlatformKey.String("ibm_cloud_openshift") - // Tencent Cloud Cloud Virtual Machine (CVM) - CloudPlatformTencentCloudCvm = CloudPlatformKey.String("tencent_cloud_cvm") - // Tencent Cloud Elastic Kubernetes Service (EKS) - CloudPlatformTencentCloudEKS = CloudPlatformKey.String("tencent_cloud_eks") - // Tencent Cloud Serverless Cloud Function (SCF) - CloudPlatformTencentCloudScf = CloudPlatformKey.String("tencent_cloud_scf") -) - -// CloudAccountID returns an attribute KeyValue conforming to the -// "cloud.account.id" semantic conventions. It represents the cloud account ID -// the resource is assigned to. -func CloudAccountID(val string) attribute.KeyValue { - return CloudAccountIDKey.String(val) -} - -// CloudRegion returns an attribute KeyValue conforming to the -// "cloud.region" semantic conventions. It represents the geographical region -// the resource is running. -func CloudRegion(val string) attribute.KeyValue { - return CloudRegionKey.String(val) -} - -// CloudAvailabilityZone returns an attribute KeyValue conforming to the -// "cloud.availability_zone" semantic conventions. It represents the cloud -// regions often have multiple, isolated locations known as zones to increase -// availability. Availability zone represents the zone where the resource is -// running. -func CloudAvailabilityZone(val string) attribute.KeyValue { - return CloudAvailabilityZoneKey.String(val) -} - -// Resources used by AWS Elastic Container Service (ECS). -const ( - // AWSECSContainerARNKey is the attribute Key conforming to the - // "aws.ecs.container.arn" semantic conventions. It represents the Amazon - // Resource Name (ARN) of an [ECS container - // instance](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: - // 'arn:aws:ecs:us-west-1:123456789123:container/32624152-9086-4f0e-acae-1a75b14fe4d9' - AWSECSContainerARNKey = attribute.Key("aws.ecs.container.arn") - - // AWSECSClusterARNKey is the attribute Key conforming to the - // "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an - // [ECS - // cluster](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster' - AWSECSClusterARNKey = attribute.Key("aws.ecs.cluster.arn") - - // AWSECSLaunchtypeKey is the attribute Key conforming to the - // "aws.ecs.launchtype" semantic conventions. It represents the [launch - // type](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/launch_types.html) - // for an ECS task. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - AWSECSLaunchtypeKey = attribute.Key("aws.ecs.launchtype") - - // AWSECSTaskARNKey is the attribute Key conforming to the - // "aws.ecs.task.arn" semantic conventions. It represents the ARN of an - // [ECS task - // definition](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: - // 'arn:aws:ecs:us-west-1:123456789123:task/10838bed-421f-43ef-870a-f43feacbbb5b' - AWSECSTaskARNKey = attribute.Key("aws.ecs.task.arn") - - // AWSECSTaskFamilyKey is the attribute Key conforming to the - // "aws.ecs.task.family" semantic conventions. It represents the task - // definition family this task definition is a member of. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry-family' - AWSECSTaskFamilyKey = attribute.Key("aws.ecs.task.family") - - // AWSECSTaskRevisionKey is the attribute Key conforming to the - // "aws.ecs.task.revision" semantic conventions. It represents the revision - // for this task definition. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '8', '26' - AWSECSTaskRevisionKey = attribute.Key("aws.ecs.task.revision") -) - -var ( - // ec2 - AWSECSLaunchtypeEC2 = AWSECSLaunchtypeKey.String("ec2") - // fargate - AWSECSLaunchtypeFargate = AWSECSLaunchtypeKey.String("fargate") -) - -// AWSECSContainerARN returns an attribute KeyValue conforming to the -// "aws.ecs.container.arn" semantic conventions. It represents the Amazon -// Resource Name (ARN) of an [ECS container -// instance](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html). -func AWSECSContainerARN(val string) attribute.KeyValue { - return AWSECSContainerARNKey.String(val) -} - -// AWSECSClusterARN returns an attribute KeyValue conforming to the -// "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an [ECS -// cluster](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html). -func AWSECSClusterARN(val string) attribute.KeyValue { - return AWSECSClusterARNKey.String(val) -} - -// AWSECSTaskARN returns an attribute KeyValue conforming to the -// "aws.ecs.task.arn" semantic conventions. It represents the ARN of an [ECS -// task -// definition](https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html). -func AWSECSTaskARN(val string) attribute.KeyValue { - return AWSECSTaskARNKey.String(val) -} - -// AWSECSTaskFamily returns an attribute KeyValue conforming to the -// "aws.ecs.task.family" semantic conventions. It represents the task -// definition family this task definition is a member of. -func AWSECSTaskFamily(val string) attribute.KeyValue { - return AWSECSTaskFamilyKey.String(val) -} - -// AWSECSTaskRevision returns an attribute KeyValue conforming to the -// "aws.ecs.task.revision" semantic conventions. It represents the revision for -// this task definition. -func AWSECSTaskRevision(val string) attribute.KeyValue { - return AWSECSTaskRevisionKey.String(val) -} - -// Resources used by AWS Elastic Kubernetes Service (EKS). -const ( - // AWSEKSClusterARNKey is the attribute Key conforming to the - // "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an - // EKS cluster. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster' - AWSEKSClusterARNKey = attribute.Key("aws.eks.cluster.arn") -) - -// AWSEKSClusterARN returns an attribute KeyValue conforming to the -// "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS -// cluster. -func AWSEKSClusterARN(val string) attribute.KeyValue { - return AWSEKSClusterARNKey.String(val) -} - -// Resources specific to Amazon Web Services. -const ( - // AWSLogGroupNamesKey is the attribute Key conforming to the - // "aws.log.group.names" semantic conventions. It represents the name(s) of - // the AWS log group(s) an application is writing to. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: '/aws/lambda/my-function', 'opentelemetry-service' - // Note: Multiple log groups must be supported for cases like - // multi-container applications, where a single application has sidecar - // containers, and each write to their own log group. - AWSLogGroupNamesKey = attribute.Key("aws.log.group.names") - - // AWSLogGroupARNsKey is the attribute Key conforming to the - // "aws.log.group.arns" semantic conventions. It represents the Amazon - // Resource Name(s) (ARN) of the AWS log group(s). - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: - // 'arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:*' - // Note: See the [log group ARN format - // documentation](https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format). - AWSLogGroupARNsKey = attribute.Key("aws.log.group.arns") - - // AWSLogStreamNamesKey is the attribute Key conforming to the - // "aws.log.stream.names" semantic conventions. It represents the name(s) - // of the AWS log stream(s) an application is writing to. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: 'logs/main/10838bed-421f-43ef-870a-f43feacbbb5b' - AWSLogStreamNamesKey = attribute.Key("aws.log.stream.names") - - // AWSLogStreamARNsKey is the attribute Key conforming to the - // "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of - // the AWS log stream(s). - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: - // 'arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:log-stream:logs/main/10838bed-421f-43ef-870a-f43feacbbb5b' - // Note: See the [log stream ARN format - // documentation](https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format). - // One log group can contain several log streams, so these ARNs necessarily - // identify both a log group and a log stream. - AWSLogStreamARNsKey = attribute.Key("aws.log.stream.arns") -) - -// AWSLogGroupNames returns an attribute KeyValue conforming to the -// "aws.log.group.names" semantic conventions. It represents the name(s) of the -// AWS log group(s) an application is writing to. -func AWSLogGroupNames(val ...string) attribute.KeyValue { - return AWSLogGroupNamesKey.StringSlice(val) -} - -// AWSLogGroupARNs returns an attribute KeyValue conforming to the -// "aws.log.group.arns" semantic conventions. It represents the Amazon Resource -// Name(s) (ARN) of the AWS log group(s). -func AWSLogGroupARNs(val ...string) attribute.KeyValue { - return AWSLogGroupARNsKey.StringSlice(val) -} - -// AWSLogStreamNames returns an attribute KeyValue conforming to the -// "aws.log.stream.names" semantic conventions. It represents the name(s) of -// the AWS log stream(s) an application is writing to. -func AWSLogStreamNames(val ...string) attribute.KeyValue { - return AWSLogStreamNamesKey.StringSlice(val) -} - -// AWSLogStreamARNs returns an attribute KeyValue conforming to the -// "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the -// AWS log stream(s). -func AWSLogStreamARNs(val ...string) attribute.KeyValue { - return AWSLogStreamARNsKey.StringSlice(val) -} - -// A container instance. -const ( - // ContainerNameKey is the attribute Key conforming to the "container.name" - // semantic conventions. It represents the container name used by container - // runtime. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry-autoconf' - ContainerNameKey = attribute.Key("container.name") - - // ContainerIDKey is the attribute Key conforming to the "container.id" - // semantic conventions. It represents the container ID. Usually a UUID, as - // for example used to [identify Docker - // containers](https://docs.docker.com/engine/reference/run/#container-identification). - // The UUID might be abbreviated. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'a3bf90e006b2' - ContainerIDKey = attribute.Key("container.id") - - // ContainerRuntimeKey is the attribute Key conforming to the - // "container.runtime" semantic conventions. It represents the container - // runtime managing this container. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'docker', 'containerd', 'rkt' - ContainerRuntimeKey = attribute.Key("container.runtime") - - // ContainerImageNameKey is the attribute Key conforming to the - // "container.image.name" semantic conventions. It represents the name of - // the image the container was built on. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'gcr.io/opentelemetry/operator' - ContainerImageNameKey = attribute.Key("container.image.name") - - // ContainerImageTagKey is the attribute Key conforming to the - // "container.image.tag" semantic conventions. It represents the container - // image tag. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '0.1' - ContainerImageTagKey = attribute.Key("container.image.tag") -) - -// ContainerName returns an attribute KeyValue conforming to the -// "container.name" semantic conventions. It represents the container name used -// by container runtime. -func ContainerName(val string) attribute.KeyValue { - return ContainerNameKey.String(val) -} - -// ContainerID returns an attribute KeyValue conforming to the -// "container.id" semantic conventions. It represents the container ID. Usually -// a UUID, as for example used to [identify Docker -// containers](https://docs.docker.com/engine/reference/run/#container-identification). -// The UUID might be abbreviated. -func ContainerID(val string) attribute.KeyValue { - return ContainerIDKey.String(val) -} - -// ContainerRuntime returns an attribute KeyValue conforming to the -// "container.runtime" semantic conventions. It represents the container -// runtime managing this container. -func ContainerRuntime(val string) attribute.KeyValue { - return ContainerRuntimeKey.String(val) -} - -// ContainerImageName returns an attribute KeyValue conforming to the -// "container.image.name" semantic conventions. It represents the name of the -// image the container was built on. -func ContainerImageName(val string) attribute.KeyValue { - return ContainerImageNameKey.String(val) -} - -// ContainerImageTag returns an attribute KeyValue conforming to the -// "container.image.tag" semantic conventions. It represents the container -// image tag. -func ContainerImageTag(val string) attribute.KeyValue { - return ContainerImageTagKey.String(val) -} - -// The software deployment. -const ( - // DeploymentEnvironmentKey is the attribute Key conforming to the - // "deployment.environment" semantic conventions. It represents the name of - // the [deployment - // environment](https://en.wikipedia.org/wiki/Deployment_environment) (aka - // deployment tier). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'staging', 'production' - DeploymentEnvironmentKey = attribute.Key("deployment.environment") -) - -// DeploymentEnvironment returns an attribute KeyValue conforming to the -// "deployment.environment" semantic conventions. It represents the name of the -// [deployment -// environment](https://en.wikipedia.org/wiki/Deployment_environment) (aka -// deployment tier). -func DeploymentEnvironment(val string) attribute.KeyValue { - return DeploymentEnvironmentKey.String(val) -} - -// The device on which the process represented by this resource is running. -const ( - // DeviceIDKey is the attribute Key conforming to the "device.id" semantic - // conventions. It represents a unique identifier representing the device - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '2ab2916d-a51f-4ac8-80ee-45ac31a28092' - // Note: The device identifier MUST only be defined using the values - // outlined below. This value is not an advertising identifier and MUST NOT - // be used as such. On iOS (Swift or Objective-C), this value MUST be equal - // to the [vendor - // identifier](https://developer.apple.com/documentation/uikit/uidevice/1620059-identifierforvendor). - // On Android (Java or Kotlin), this value MUST be equal to the Firebase - // Installation ID or a globally unique UUID which is persisted across - // sessions in your application. More information can be found - // [here](https://developer.android.com/training/articles/user-data-ids) on - // best practices and exact implementation details. Caution should be taken - // when storing personal data or anything which can identify a user. GDPR - // and data protection laws may apply, ensure you do your own due - // diligence. - DeviceIDKey = attribute.Key("device.id") - - // DeviceModelIdentifierKey is the attribute Key conforming to the - // "device.model.identifier" semantic conventions. It represents the model - // identifier for the device - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'iPhone3,4', 'SM-G920F' - // Note: It's recommended this value represents a machine readable version - // of the model identifier rather than the market or consumer-friendly name - // of the device. - DeviceModelIdentifierKey = attribute.Key("device.model.identifier") - - // DeviceModelNameKey is the attribute Key conforming to the - // "device.model.name" semantic conventions. It represents the marketing - // name for the device model - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'iPhone 6s Plus', 'Samsung Galaxy S6' - // Note: It's recommended this value represents a human readable version of - // the device model rather than a machine readable alternative. - DeviceModelNameKey = attribute.Key("device.model.name") - - // DeviceManufacturerKey is the attribute Key conforming to the - // "device.manufacturer" semantic conventions. It represents the name of - // the device manufacturer - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Apple', 'Samsung' - // Note: The Android OS provides this field via - // [Build](https://developer.android.com/reference/android/os/Build#MANUFACTURER). - // iOS apps SHOULD hardcode the value `Apple`. - DeviceManufacturerKey = attribute.Key("device.manufacturer") -) - -// DeviceID returns an attribute KeyValue conforming to the "device.id" -// semantic conventions. It represents a unique identifier representing the -// device -func DeviceID(val string) attribute.KeyValue { - return DeviceIDKey.String(val) -} - -// DeviceModelIdentifier returns an attribute KeyValue conforming to the -// "device.model.identifier" semantic conventions. It represents the model -// identifier for the device -func DeviceModelIdentifier(val string) attribute.KeyValue { - return DeviceModelIdentifierKey.String(val) -} - -// DeviceModelName returns an attribute KeyValue conforming to the -// "device.model.name" semantic conventions. It represents the marketing name -// for the device model -func DeviceModelName(val string) attribute.KeyValue { - return DeviceModelNameKey.String(val) -} - -// DeviceManufacturer returns an attribute KeyValue conforming to the -// "device.manufacturer" semantic conventions. It represents the name of the -// device manufacturer -func DeviceManufacturer(val string) attribute.KeyValue { - return DeviceManufacturerKey.String(val) -} - -// A serverless instance. -const ( - // FaaSNameKey is the attribute Key conforming to the "faas.name" semantic - // conventions. It represents the name of the single function that this - // runtime instance executes. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'my-function', 'myazurefunctionapp/some-function-name' - // Note: This is the name of the function as configured/deployed on the - // FaaS - // platform and is usually different from the name of the callback - // function (which may be stored in the - // [`code.namespace`/`code.function`](../../trace/semantic_conventions/span-general.md#source-code-attributes) - // span attributes). - // - // For some cloud providers, the above definition is ambiguous. The - // following - // definition of function name MUST be used for this attribute - // (and consequently the span name) for the listed cloud - // providers/products: - // - // * **Azure:** The full name `/`, i.e., function app name - // followed by a forward slash followed by the function name (this form - // can also be seen in the resource JSON for the function). - // This means that a span attribute MUST be used, as an Azure function - // app can host multiple functions that would usually share - // a TracerProvider (see also the `faas.id` attribute). - FaaSNameKey = attribute.Key("faas.name") - - // FaaSIDKey is the attribute Key conforming to the "faas.id" semantic - // conventions. It represents the unique ID of the single function that - // this runtime instance executes. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'arn:aws:lambda:us-west-2:123456789012:function:my-function' - // Note: On some cloud providers, it may not be possible to determine the - // full ID at startup, - // so consider setting `faas.id` as a span attribute instead. - // - // The exact value to use for `faas.id` depends on the cloud provider: - // - // * **AWS Lambda:** The function - // [ARN](https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html). - // Take care not to use the "invoked ARN" directly but replace any - // [alias - // suffix](https://docs.aws.amazon.com/lambda/latest/dg/configuration-aliases.html) - // with the resolved function version, as the same runtime instance may - // be invokable with - // multiple different aliases. - // * **GCP:** The [URI of the - // resource](https://cloud.google.com/iam/docs/full-resource-names) - // * **Azure:** The [Fully Qualified Resource - // ID](https://docs.microsoft.com/en-us/rest/api/resources/resources/get-by-id) - // of the invoked function, - // *not* the function app, having the form - // `/subscriptions//resourceGroups//providers/Microsoft.Web/sites//functions/`. - // This means that a span attribute MUST be used, as an Azure function - // app can host multiple functions that would usually share - // a TracerProvider. - FaaSIDKey = attribute.Key("faas.id") - - // FaaSVersionKey is the attribute Key conforming to the "faas.version" - // semantic conventions. It represents the immutable version of the - // function being executed. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '26', 'pinkfroid-00002' - // Note: Depending on the cloud provider and platform, use: - // - // * **AWS Lambda:** The [function - // version](https://docs.aws.amazon.com/lambda/latest/dg/configuration-versions.html) - // (an integer represented as a decimal string). - // * **Google Cloud Run:** The - // [revision](https://cloud.google.com/run/docs/managing/revisions) - // (i.e., the function name plus the revision suffix). - // * **Google Cloud Functions:** The value of the - // [`K_REVISION` environment - // variable](https://cloud.google.com/functions/docs/env-var#runtime_environment_variables_set_automatically). - // * **Azure Functions:** Not applicable. Do not set this attribute. - FaaSVersionKey = attribute.Key("faas.version") - - // FaaSInstanceKey is the attribute Key conforming to the "faas.instance" - // semantic conventions. It represents the execution environment ID as a - // string, that will be potentially reused for other invocations to the - // same function/function version. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '2021/06/28/[$LATEST]2f399eb14537447da05ab2a2e39309de' - // Note: * **AWS Lambda:** Use the (full) log stream name. - FaaSInstanceKey = attribute.Key("faas.instance") - - // FaaSMaxMemoryKey is the attribute Key conforming to the - // "faas.max_memory" semantic conventions. It represents the amount of - // memory available to the serverless function in MiB. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 128 - // Note: It's recommended to set this attribute since e.g. too little - // memory can easily stop a Java AWS Lambda function from working - // correctly. On AWS Lambda, the environment variable - // `AWS_LAMBDA_FUNCTION_MEMORY_SIZE` provides this information. - FaaSMaxMemoryKey = attribute.Key("faas.max_memory") -) - -// FaaSName returns an attribute KeyValue conforming to the "faas.name" -// semantic conventions. It represents the name of the single function that -// this runtime instance executes. -func FaaSName(val string) attribute.KeyValue { - return FaaSNameKey.String(val) -} - -// FaaSID returns an attribute KeyValue conforming to the "faas.id" semantic -// conventions. It represents the unique ID of the single function that this -// runtime instance executes. -func FaaSID(val string) attribute.KeyValue { - return FaaSIDKey.String(val) -} - -// FaaSVersion returns an attribute KeyValue conforming to the -// "faas.version" semantic conventions. It represents the immutable version of -// the function being executed. -func FaaSVersion(val string) attribute.KeyValue { - return FaaSVersionKey.String(val) -} - -// FaaSInstance returns an attribute KeyValue conforming to the -// "faas.instance" semantic conventions. It represents the execution -// environment ID as a string, that will be potentially reused for other -// invocations to the same function/function version. -func FaaSInstance(val string) attribute.KeyValue { - return FaaSInstanceKey.String(val) -} - -// FaaSMaxMemory returns an attribute KeyValue conforming to the -// "faas.max_memory" semantic conventions. It represents the amount of memory -// available to the serverless function in MiB. -func FaaSMaxMemory(val int) attribute.KeyValue { - return FaaSMaxMemoryKey.Int(val) -} - -// A host is defined as a general computing instance. -const ( - // HostIDKey is the attribute Key conforming to the "host.id" semantic - // conventions. It represents the unique host ID. For Cloud, this must be - // the instance_id assigned by the cloud provider. For non-containerized - // Linux systems, the `machine-id` located in `/etc/machine-id` or - // `/var/lib/dbus/machine-id` may be used. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'fdbf79e8af94cb7f9e8df36789187052' - HostIDKey = attribute.Key("host.id") - - // HostNameKey is the attribute Key conforming to the "host.name" semantic - // conventions. It represents the name of the host. On Unix systems, it may - // contain what the hostname command returns, or the fully qualified - // hostname, or another name specified by the user. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry-test' - HostNameKey = attribute.Key("host.name") - - // HostTypeKey is the attribute Key conforming to the "host.type" semantic - // conventions. It represents the type of host. For Cloud, this must be the - // machine type. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'n1-standard-1' - HostTypeKey = attribute.Key("host.type") - - // HostArchKey is the attribute Key conforming to the "host.arch" semantic - // conventions. It represents the CPU architecture the host system is - // running on. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - HostArchKey = attribute.Key("host.arch") - - // HostImageNameKey is the attribute Key conforming to the - // "host.image.name" semantic conventions. It represents the name of the VM - // image or OS install the host was instantiated from. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'infra-ami-eks-worker-node-7d4ec78312', 'CentOS-8-x86_64-1905' - HostImageNameKey = attribute.Key("host.image.name") - - // HostImageIDKey is the attribute Key conforming to the "host.image.id" - // semantic conventions. It represents the vM image ID. For Cloud, this - // value is from the provider. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'ami-07b06b442921831e5' - HostImageIDKey = attribute.Key("host.image.id") - - // HostImageVersionKey is the attribute Key conforming to the - // "host.image.version" semantic conventions. It represents the version - // string of the VM image as defined in [Version - // Attributes](README.md#version-attributes). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '0.1' - HostImageVersionKey = attribute.Key("host.image.version") -) - -var ( - // AMD64 - HostArchAMD64 = HostArchKey.String("amd64") - // ARM32 - HostArchARM32 = HostArchKey.String("arm32") - // ARM64 - HostArchARM64 = HostArchKey.String("arm64") - // Itanium - HostArchIA64 = HostArchKey.String("ia64") - // 32-bit PowerPC - HostArchPPC32 = HostArchKey.String("ppc32") - // 64-bit PowerPC - HostArchPPC64 = HostArchKey.String("ppc64") - // IBM z/Architecture - HostArchS390x = HostArchKey.String("s390x") - // 32-bit x86 - HostArchX86 = HostArchKey.String("x86") -) - -// HostID returns an attribute KeyValue conforming to the "host.id" semantic -// conventions. It represents the unique host ID. For Cloud, this must be the -// instance_id assigned by the cloud provider. For non-containerized Linux -// systems, the `machine-id` located in `/etc/machine-id` or -// `/var/lib/dbus/machine-id` may be used. -func HostID(val string) attribute.KeyValue { - return HostIDKey.String(val) -} - -// HostName returns an attribute KeyValue conforming to the "host.name" -// semantic conventions. It represents the name of the host. On Unix systems, -// it may contain what the hostname command returns, or the fully qualified -// hostname, or another name specified by the user. -func HostName(val string) attribute.KeyValue { - return HostNameKey.String(val) -} - -// HostType returns an attribute KeyValue conforming to the "host.type" -// semantic conventions. It represents the type of host. For Cloud, this must -// be the machine type. -func HostType(val string) attribute.KeyValue { - return HostTypeKey.String(val) -} - -// HostImageName returns an attribute KeyValue conforming to the -// "host.image.name" semantic conventions. It represents the name of the VM -// image or OS install the host was instantiated from. -func HostImageName(val string) attribute.KeyValue { - return HostImageNameKey.String(val) -} - -// HostImageID returns an attribute KeyValue conforming to the -// "host.image.id" semantic conventions. It represents the vM image ID. For -// Cloud, this value is from the provider. -func HostImageID(val string) attribute.KeyValue { - return HostImageIDKey.String(val) -} - -// HostImageVersion returns an attribute KeyValue conforming to the -// "host.image.version" semantic conventions. It represents the version string -// of the VM image as defined in [Version -// Attributes](README.md#version-attributes). -func HostImageVersion(val string) attribute.KeyValue { - return HostImageVersionKey.String(val) -} - -// A Kubernetes Cluster. -const ( - // K8SClusterNameKey is the attribute Key conforming to the - // "k8s.cluster.name" semantic conventions. It represents the name of the - // cluster. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry-cluster' - K8SClusterNameKey = attribute.Key("k8s.cluster.name") -) - -// K8SClusterName returns an attribute KeyValue conforming to the -// "k8s.cluster.name" semantic conventions. It represents the name of the -// cluster. -func K8SClusterName(val string) attribute.KeyValue { - return K8SClusterNameKey.String(val) -} - -// A Kubernetes Node object. -const ( - // K8SNodeNameKey is the attribute Key conforming to the "k8s.node.name" - // semantic conventions. It represents the name of the Node. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'node-1' - K8SNodeNameKey = attribute.Key("k8s.node.name") - - // K8SNodeUIDKey is the attribute Key conforming to the "k8s.node.uid" - // semantic conventions. It represents the UID of the Node. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '1eb3a0c6-0477-4080-a9cb-0cb7db65c6a2' - K8SNodeUIDKey = attribute.Key("k8s.node.uid") -) - -// K8SNodeName returns an attribute KeyValue conforming to the -// "k8s.node.name" semantic conventions. It represents the name of the Node. -func K8SNodeName(val string) attribute.KeyValue { - return K8SNodeNameKey.String(val) -} - -// K8SNodeUID returns an attribute KeyValue conforming to the "k8s.node.uid" -// semantic conventions. It represents the UID of the Node. -func K8SNodeUID(val string) attribute.KeyValue { - return K8SNodeUIDKey.String(val) -} - -// A Kubernetes Namespace. -const ( - // K8SNamespaceNameKey is the attribute Key conforming to the - // "k8s.namespace.name" semantic conventions. It represents the name of the - // namespace that the pod is running in. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'default' - K8SNamespaceNameKey = attribute.Key("k8s.namespace.name") -) - -// K8SNamespaceName returns an attribute KeyValue conforming to the -// "k8s.namespace.name" semantic conventions. It represents the name of the -// namespace that the pod is running in. -func K8SNamespaceName(val string) attribute.KeyValue { - return K8SNamespaceNameKey.String(val) -} - -// A Kubernetes Pod object. -const ( - // K8SPodUIDKey is the attribute Key conforming to the "k8s.pod.uid" - // semantic conventions. It represents the UID of the Pod. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff' - K8SPodUIDKey = attribute.Key("k8s.pod.uid") - - // K8SPodNameKey is the attribute Key conforming to the "k8s.pod.name" - // semantic conventions. It represents the name of the Pod. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry-pod-autoconf' - K8SPodNameKey = attribute.Key("k8s.pod.name") -) - -// K8SPodUID returns an attribute KeyValue conforming to the "k8s.pod.uid" -// semantic conventions. It represents the UID of the Pod. -func K8SPodUID(val string) attribute.KeyValue { - return K8SPodUIDKey.String(val) -} - -// K8SPodName returns an attribute KeyValue conforming to the "k8s.pod.name" -// semantic conventions. It represents the name of the Pod. -func K8SPodName(val string) attribute.KeyValue { - return K8SPodNameKey.String(val) -} - -// A container in a -// [PodTemplate](https://kubernetes.io/docs/concepts/workloads/pods/#pod-templates). -const ( - // K8SContainerNameKey is the attribute Key conforming to the - // "k8s.container.name" semantic conventions. It represents the name of the - // Container from Pod specification, must be unique within a Pod. Container - // runtime usually uses different globally unique name (`container.name`). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'redis' - K8SContainerNameKey = attribute.Key("k8s.container.name") - - // K8SContainerRestartCountKey is the attribute Key conforming to the - // "k8s.container.restart_count" semantic conventions. It represents the - // number of times the container was restarted. This attribute can be used - // to identify a particular container (running or stopped) within a - // container spec. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 0, 2 - K8SContainerRestartCountKey = attribute.Key("k8s.container.restart_count") -) - -// K8SContainerName returns an attribute KeyValue conforming to the -// "k8s.container.name" semantic conventions. It represents the name of the -// Container from Pod specification, must be unique within a Pod. Container -// runtime usually uses different globally unique name (`container.name`). -func K8SContainerName(val string) attribute.KeyValue { - return K8SContainerNameKey.String(val) -} - -// K8SContainerRestartCount returns an attribute KeyValue conforming to the -// "k8s.container.restart_count" semantic conventions. It represents the number -// of times the container was restarted. This attribute can be used to identify -// a particular container (running or stopped) within a container spec. -func K8SContainerRestartCount(val int) attribute.KeyValue { - return K8SContainerRestartCountKey.Int(val) -} - -// A Kubernetes ReplicaSet object. -const ( - // K8SReplicaSetUIDKey is the attribute Key conforming to the - // "k8s.replicaset.uid" semantic conventions. It represents the UID of the - // ReplicaSet. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff' - K8SReplicaSetUIDKey = attribute.Key("k8s.replicaset.uid") - - // K8SReplicaSetNameKey is the attribute Key conforming to the - // "k8s.replicaset.name" semantic conventions. It represents the name of - // the ReplicaSet. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry' - K8SReplicaSetNameKey = attribute.Key("k8s.replicaset.name") -) - -// K8SReplicaSetUID returns an attribute KeyValue conforming to the -// "k8s.replicaset.uid" semantic conventions. It represents the UID of the -// ReplicaSet. -func K8SReplicaSetUID(val string) attribute.KeyValue { - return K8SReplicaSetUIDKey.String(val) -} - -// K8SReplicaSetName returns an attribute KeyValue conforming to the -// "k8s.replicaset.name" semantic conventions. It represents the name of the -// ReplicaSet. -func K8SReplicaSetName(val string) attribute.KeyValue { - return K8SReplicaSetNameKey.String(val) -} - -// A Kubernetes Deployment object. -const ( - // K8SDeploymentUIDKey is the attribute Key conforming to the - // "k8s.deployment.uid" semantic conventions. It represents the UID of the - // Deployment. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff' - K8SDeploymentUIDKey = attribute.Key("k8s.deployment.uid") - - // K8SDeploymentNameKey is the attribute Key conforming to the - // "k8s.deployment.name" semantic conventions. It represents the name of - // the Deployment. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry' - K8SDeploymentNameKey = attribute.Key("k8s.deployment.name") -) - -// K8SDeploymentUID returns an attribute KeyValue conforming to the -// "k8s.deployment.uid" semantic conventions. It represents the UID of the -// Deployment. -func K8SDeploymentUID(val string) attribute.KeyValue { - return K8SDeploymentUIDKey.String(val) -} - -// K8SDeploymentName returns an attribute KeyValue conforming to the -// "k8s.deployment.name" semantic conventions. It represents the name of the -// Deployment. -func K8SDeploymentName(val string) attribute.KeyValue { - return K8SDeploymentNameKey.String(val) -} - -// A Kubernetes StatefulSet object. -const ( - // K8SStatefulSetUIDKey is the attribute Key conforming to the - // "k8s.statefulset.uid" semantic conventions. It represents the UID of the - // StatefulSet. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff' - K8SStatefulSetUIDKey = attribute.Key("k8s.statefulset.uid") - - // K8SStatefulSetNameKey is the attribute Key conforming to the - // "k8s.statefulset.name" semantic conventions. It represents the name of - // the StatefulSet. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry' - K8SStatefulSetNameKey = attribute.Key("k8s.statefulset.name") -) - -// K8SStatefulSetUID returns an attribute KeyValue conforming to the -// "k8s.statefulset.uid" semantic conventions. It represents the UID of the -// StatefulSet. -func K8SStatefulSetUID(val string) attribute.KeyValue { - return K8SStatefulSetUIDKey.String(val) -} - -// K8SStatefulSetName returns an attribute KeyValue conforming to the -// "k8s.statefulset.name" semantic conventions. It represents the name of the -// StatefulSet. -func K8SStatefulSetName(val string) attribute.KeyValue { - return K8SStatefulSetNameKey.String(val) -} - -// A Kubernetes DaemonSet object. -const ( - // K8SDaemonSetUIDKey is the attribute Key conforming to the - // "k8s.daemonset.uid" semantic conventions. It represents the UID of the - // DaemonSet. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff' - K8SDaemonSetUIDKey = attribute.Key("k8s.daemonset.uid") - - // K8SDaemonSetNameKey is the attribute Key conforming to the - // "k8s.daemonset.name" semantic conventions. It represents the name of the - // DaemonSet. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry' - K8SDaemonSetNameKey = attribute.Key("k8s.daemonset.name") -) - -// K8SDaemonSetUID returns an attribute KeyValue conforming to the -// "k8s.daemonset.uid" semantic conventions. It represents the UID of the -// DaemonSet. -func K8SDaemonSetUID(val string) attribute.KeyValue { - return K8SDaemonSetUIDKey.String(val) -} - -// K8SDaemonSetName returns an attribute KeyValue conforming to the -// "k8s.daemonset.name" semantic conventions. It represents the name of the -// DaemonSet. -func K8SDaemonSetName(val string) attribute.KeyValue { - return K8SDaemonSetNameKey.String(val) -} - -// A Kubernetes Job object. -const ( - // K8SJobUIDKey is the attribute Key conforming to the "k8s.job.uid" - // semantic conventions. It represents the UID of the Job. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff' - K8SJobUIDKey = attribute.Key("k8s.job.uid") - - // K8SJobNameKey is the attribute Key conforming to the "k8s.job.name" - // semantic conventions. It represents the name of the Job. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry' - K8SJobNameKey = attribute.Key("k8s.job.name") -) - -// K8SJobUID returns an attribute KeyValue conforming to the "k8s.job.uid" -// semantic conventions. It represents the UID of the Job. -func K8SJobUID(val string) attribute.KeyValue { - return K8SJobUIDKey.String(val) -} - -// K8SJobName returns an attribute KeyValue conforming to the "k8s.job.name" -// semantic conventions. It represents the name of the Job. -func K8SJobName(val string) attribute.KeyValue { - return K8SJobNameKey.String(val) -} - -// A Kubernetes CronJob object. -const ( - // K8SCronJobUIDKey is the attribute Key conforming to the - // "k8s.cronjob.uid" semantic conventions. It represents the UID of the - // CronJob. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '275ecb36-5aa8-4c2a-9c47-d8bb681b9aff' - K8SCronJobUIDKey = attribute.Key("k8s.cronjob.uid") - - // K8SCronJobNameKey is the attribute Key conforming to the - // "k8s.cronjob.name" semantic conventions. It represents the name of the - // CronJob. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry' - K8SCronJobNameKey = attribute.Key("k8s.cronjob.name") -) - -// K8SCronJobUID returns an attribute KeyValue conforming to the -// "k8s.cronjob.uid" semantic conventions. It represents the UID of the -// CronJob. -func K8SCronJobUID(val string) attribute.KeyValue { - return K8SCronJobUIDKey.String(val) -} - -// K8SCronJobName returns an attribute KeyValue conforming to the -// "k8s.cronjob.name" semantic conventions. It represents the name of the -// CronJob. -func K8SCronJobName(val string) attribute.KeyValue { - return K8SCronJobNameKey.String(val) -} - -// The operating system (OS) on which the process represented by this resource -// is running. -const ( - // OSTypeKey is the attribute Key conforming to the "os.type" semantic - // conventions. It represents the operating system type. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - OSTypeKey = attribute.Key("os.type") - - // OSDescriptionKey is the attribute Key conforming to the "os.description" - // semantic conventions. It represents the human readable (not intended to - // be parsed) OS version information, like e.g. reported by `ver` or - // `lsb_release -a` commands. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Microsoft Windows [Version 10.0.18363.778]', 'Ubuntu 18.04.1 - // LTS' - OSDescriptionKey = attribute.Key("os.description") - - // OSNameKey is the attribute Key conforming to the "os.name" semantic - // conventions. It represents the human readable operating system name. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'iOS', 'Android', 'Ubuntu' - OSNameKey = attribute.Key("os.name") - - // OSVersionKey is the attribute Key conforming to the "os.version" - // semantic conventions. It represents the version string of the operating - // system as defined in [Version - // Attributes](../../resource/semantic_conventions/README.md#version-attributes). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '14.2.1', '18.04.1' - OSVersionKey = attribute.Key("os.version") -) - -var ( - // Microsoft Windows - OSTypeWindows = OSTypeKey.String("windows") - // Linux - OSTypeLinux = OSTypeKey.String("linux") - // Apple Darwin - OSTypeDarwin = OSTypeKey.String("darwin") - // FreeBSD - OSTypeFreeBSD = OSTypeKey.String("freebsd") - // NetBSD - OSTypeNetBSD = OSTypeKey.String("netbsd") - // OpenBSD - OSTypeOpenBSD = OSTypeKey.String("openbsd") - // DragonFly BSD - OSTypeDragonflyBSD = OSTypeKey.String("dragonflybsd") - // HP-UX (Hewlett Packard Unix) - OSTypeHPUX = OSTypeKey.String("hpux") - // AIX (Advanced Interactive eXecutive) - OSTypeAIX = OSTypeKey.String("aix") - // SunOS, Oracle Solaris - OSTypeSolaris = OSTypeKey.String("solaris") - // IBM z/OS - OSTypeZOS = OSTypeKey.String("z_os") -) - -// OSDescription returns an attribute KeyValue conforming to the -// "os.description" semantic conventions. It represents the human readable (not -// intended to be parsed) OS version information, like e.g. reported by `ver` -// or `lsb_release -a` commands. -func OSDescription(val string) attribute.KeyValue { - return OSDescriptionKey.String(val) -} - -// OSName returns an attribute KeyValue conforming to the "os.name" semantic -// conventions. It represents the human readable operating system name. -func OSName(val string) attribute.KeyValue { - return OSNameKey.String(val) -} - -// OSVersion returns an attribute KeyValue conforming to the "os.version" -// semantic conventions. It represents the version string of the operating -// system as defined in [Version -// Attributes](../../resource/semantic_conventions/README.md#version-attributes). -func OSVersion(val string) attribute.KeyValue { - return OSVersionKey.String(val) -} - -// An operating system process. -const ( - // ProcessPIDKey is the attribute Key conforming to the "process.pid" - // semantic conventions. It represents the process identifier (PID). - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 1234 - ProcessPIDKey = attribute.Key("process.pid") - - // ProcessParentPIDKey is the attribute Key conforming to the - // "process.parent_pid" semantic conventions. It represents the parent - // Process identifier (PID). - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 111 - ProcessParentPIDKey = attribute.Key("process.parent_pid") - - // ProcessExecutableNameKey is the attribute Key conforming to the - // "process.executable.name" semantic conventions. It represents the name - // of the process executable. On Linux based systems, can be set to the - // `Name` in `proc/[pid]/status`. On Windows, can be set to the base name - // of `GetProcessImageFileNameW`. - // - // Type: string - // RequirementLevel: ConditionallyRequired (See alternative attributes - // below.) - // Stability: stable - // Examples: 'otelcol' - ProcessExecutableNameKey = attribute.Key("process.executable.name") - - // ProcessExecutablePathKey is the attribute Key conforming to the - // "process.executable.path" semantic conventions. It represents the full - // path to the process executable. On Linux based systems, can be set to - // the target of `proc/[pid]/exe`. On Windows, can be set to the result of - // `GetProcessImageFileNameW`. - // - // Type: string - // RequirementLevel: ConditionallyRequired (See alternative attributes - // below.) - // Stability: stable - // Examples: '/usr/bin/cmd/otelcol' - ProcessExecutablePathKey = attribute.Key("process.executable.path") - - // ProcessCommandKey is the attribute Key conforming to the - // "process.command" semantic conventions. It represents the command used - // to launch the process (i.e. the command name). On Linux based systems, - // can be set to the zeroth string in `proc/[pid]/cmdline`. On Windows, can - // be set to the first parameter extracted from `GetCommandLineW`. - // - // Type: string - // RequirementLevel: ConditionallyRequired (See alternative attributes - // below.) - // Stability: stable - // Examples: 'cmd/otelcol' - ProcessCommandKey = attribute.Key("process.command") - - // ProcessCommandLineKey is the attribute Key conforming to the - // "process.command_line" semantic conventions. It represents the full - // command used to launch the process as a single string representing the - // full command. On Windows, can be set to the result of `GetCommandLineW`. - // Do not set this if you have to assemble it just for monitoring; use - // `process.command_args` instead. - // - // Type: string - // RequirementLevel: ConditionallyRequired (See alternative attributes - // below.) - // Stability: stable - // Examples: 'C:\\cmd\\otecol --config="my directory\\config.yaml"' - ProcessCommandLineKey = attribute.Key("process.command_line") - - // ProcessCommandArgsKey is the attribute Key conforming to the - // "process.command_args" semantic conventions. It represents the all the - // command arguments (including the command/executable itself) as received - // by the process. On Linux-based systems (and some other Unixoid systems - // supporting procfs), can be set according to the list of null-delimited - // strings extracted from `proc/[pid]/cmdline`. For libc-based executables, - // this would be the full argv vector passed to `main`. - // - // Type: string[] - // RequirementLevel: ConditionallyRequired (See alternative attributes - // below.) - // Stability: stable - // Examples: 'cmd/otecol', '--config=config.yaml' - ProcessCommandArgsKey = attribute.Key("process.command_args") - - // ProcessOwnerKey is the attribute Key conforming to the "process.owner" - // semantic conventions. It represents the username of the user that owns - // the process. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'root' - ProcessOwnerKey = attribute.Key("process.owner") -) - -// ProcessPID returns an attribute KeyValue conforming to the "process.pid" -// semantic conventions. It represents the process identifier (PID). -func ProcessPID(val int) attribute.KeyValue { - return ProcessPIDKey.Int(val) -} - -// ProcessParentPID returns an attribute KeyValue conforming to the -// "process.parent_pid" semantic conventions. It represents the parent Process -// identifier (PID). -func ProcessParentPID(val int) attribute.KeyValue { - return ProcessParentPIDKey.Int(val) -} - -// ProcessExecutableName returns an attribute KeyValue conforming to the -// "process.executable.name" semantic conventions. It represents the name of -// the process executable. On Linux based systems, can be set to the `Name` in -// `proc/[pid]/status`. On Windows, can be set to the base name of -// `GetProcessImageFileNameW`. -func ProcessExecutableName(val string) attribute.KeyValue { - return ProcessExecutableNameKey.String(val) -} - -// ProcessExecutablePath returns an attribute KeyValue conforming to the -// "process.executable.path" semantic conventions. It represents the full path -// to the process executable. On Linux based systems, can be set to the target -// of `proc/[pid]/exe`. On Windows, can be set to the result of -// `GetProcessImageFileNameW`. -func ProcessExecutablePath(val string) attribute.KeyValue { - return ProcessExecutablePathKey.String(val) -} - -// ProcessCommand returns an attribute KeyValue conforming to the -// "process.command" semantic conventions. It represents the command used to -// launch the process (i.e. the command name). On Linux based systems, can be -// set to the zeroth string in `proc/[pid]/cmdline`. On Windows, can be set to -// the first parameter extracted from `GetCommandLineW`. -func ProcessCommand(val string) attribute.KeyValue { - return ProcessCommandKey.String(val) -} - -// ProcessCommandLine returns an attribute KeyValue conforming to the -// "process.command_line" semantic conventions. It represents the full command -// used to launch the process as a single string representing the full command. -// On Windows, can be set to the result of `GetCommandLineW`. Do not set this -// if you have to assemble it just for monitoring; use `process.command_args` -// instead. -func ProcessCommandLine(val string) attribute.KeyValue { - return ProcessCommandLineKey.String(val) -} - -// ProcessCommandArgs returns an attribute KeyValue conforming to the -// "process.command_args" semantic conventions. It represents the all the -// command arguments (including the command/executable itself) as received by -// the process. On Linux-based systems (and some other Unixoid systems -// supporting procfs), can be set according to the list of null-delimited -// strings extracted from `proc/[pid]/cmdline`. For libc-based executables, -// this would be the full argv vector passed to `main`. -func ProcessCommandArgs(val ...string) attribute.KeyValue { - return ProcessCommandArgsKey.StringSlice(val) -} - -// ProcessOwner returns an attribute KeyValue conforming to the -// "process.owner" semantic conventions. It represents the username of the user -// that owns the process. -func ProcessOwner(val string) attribute.KeyValue { - return ProcessOwnerKey.String(val) -} - -// The single (language) runtime instance which is monitored. -const ( - // ProcessRuntimeNameKey is the attribute Key conforming to the - // "process.runtime.name" semantic conventions. It represents the name of - // the runtime of this process. For compiled native binaries, this SHOULD - // be the name of the compiler. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'OpenJDK Runtime Environment' - ProcessRuntimeNameKey = attribute.Key("process.runtime.name") - - // ProcessRuntimeVersionKey is the attribute Key conforming to the - // "process.runtime.version" semantic conventions. It represents the - // version of the runtime of this process, as returned by the runtime - // without modification. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '14.0.2' - ProcessRuntimeVersionKey = attribute.Key("process.runtime.version") - - // ProcessRuntimeDescriptionKey is the attribute Key conforming to the - // "process.runtime.description" semantic conventions. It represents an - // additional description about the runtime of the process, for example a - // specific vendor customization of the runtime environment. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Eclipse OpenJ9 Eclipse OpenJ9 VM openj9-0.21.0' - ProcessRuntimeDescriptionKey = attribute.Key("process.runtime.description") -) - -// ProcessRuntimeName returns an attribute KeyValue conforming to the -// "process.runtime.name" semantic conventions. It represents the name of the -// runtime of this process. For compiled native binaries, this SHOULD be the -// name of the compiler. -func ProcessRuntimeName(val string) attribute.KeyValue { - return ProcessRuntimeNameKey.String(val) -} - -// ProcessRuntimeVersion returns an attribute KeyValue conforming to the -// "process.runtime.version" semantic conventions. It represents the version of -// the runtime of this process, as returned by the runtime without -// modification. -func ProcessRuntimeVersion(val string) attribute.KeyValue { - return ProcessRuntimeVersionKey.String(val) -} - -// ProcessRuntimeDescription returns an attribute KeyValue conforming to the -// "process.runtime.description" semantic conventions. It represents an -// additional description about the runtime of the process, for example a -// specific vendor customization of the runtime environment. -func ProcessRuntimeDescription(val string) attribute.KeyValue { - return ProcessRuntimeDescriptionKey.String(val) -} - -// A service instance. -const ( - // ServiceNameKey is the attribute Key conforming to the "service.name" - // semantic conventions. It represents the logical name of the service. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'shoppingcart' - // Note: MUST be the same for all instances of horizontally scaled - // services. If the value was not specified, SDKs MUST fallback to - // `unknown_service:` concatenated with - // [`process.executable.name`](process.md#process), e.g. - // `unknown_service:bash`. If `process.executable.name` is not available, - // the value MUST be set to `unknown_service`. - ServiceNameKey = attribute.Key("service.name") - - // ServiceNamespaceKey is the attribute Key conforming to the - // "service.namespace" semantic conventions. It represents a namespace for - // `service.name`. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Shop' - // Note: A string value having a meaning that helps to distinguish a group - // of services, for example the team name that owns a group of services. - // `service.name` is expected to be unique within the same namespace. If - // `service.namespace` is not specified in the Resource then `service.name` - // is expected to be unique for all services that have no explicit - // namespace defined (so the empty/unspecified namespace is simply one more - // valid namespace). Zero-length namespace string is assumed equal to - // unspecified namespace. - ServiceNamespaceKey = attribute.Key("service.namespace") - - // ServiceInstanceIDKey is the attribute Key conforming to the - // "service.instance.id" semantic conventions. It represents the string ID - // of the service instance. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '627cc493-f310-47de-96bd-71410b7dec09' - // Note: MUST be unique for each instance of the same - // `service.namespace,service.name` pair (in other words - // `service.namespace,service.name,service.instance.id` triplet MUST be - // globally unique). The ID helps to distinguish instances of the same - // service that exist at the same time (e.g. instances of a horizontally - // scaled service). It is preferable for the ID to be persistent and stay - // the same for the lifetime of the service instance, however it is - // acceptable that the ID is ephemeral and changes during important - // lifetime events for the service (e.g. service restarts). If the service - // has no inherent unique ID that can be used as the value of this - // attribute it is recommended to generate a random Version 1 or Version 4 - // RFC 4122 UUID (services aiming for reproducible UUIDs may also use - // Version 5, see RFC 4122 for more recommendations). - ServiceInstanceIDKey = attribute.Key("service.instance.id") - - // ServiceVersionKey is the attribute Key conforming to the - // "service.version" semantic conventions. It represents the version string - // of the service API or implementation. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '2.0.0' - ServiceVersionKey = attribute.Key("service.version") -) - -// ServiceName returns an attribute KeyValue conforming to the -// "service.name" semantic conventions. It represents the logical name of the -// service. -func ServiceName(val string) attribute.KeyValue { - return ServiceNameKey.String(val) -} - -// ServiceNamespace returns an attribute KeyValue conforming to the -// "service.namespace" semantic conventions. It represents a namespace for -// `service.name`. -func ServiceNamespace(val string) attribute.KeyValue { - return ServiceNamespaceKey.String(val) -} - -// ServiceInstanceID returns an attribute KeyValue conforming to the -// "service.instance.id" semantic conventions. It represents the string ID of -// the service instance. -func ServiceInstanceID(val string) attribute.KeyValue { - return ServiceInstanceIDKey.String(val) -} - -// ServiceVersion returns an attribute KeyValue conforming to the -// "service.version" semantic conventions. It represents the version string of -// the service API or implementation. -func ServiceVersion(val string) attribute.KeyValue { - return ServiceVersionKey.String(val) -} - -// The telemetry SDK used to capture data recorded by the instrumentation -// libraries. -const ( - // TelemetrySDKNameKey is the attribute Key conforming to the - // "telemetry.sdk.name" semantic conventions. It represents the name of the - // telemetry SDK as defined above. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'opentelemetry' - TelemetrySDKNameKey = attribute.Key("telemetry.sdk.name") - - // TelemetrySDKLanguageKey is the attribute Key conforming to the - // "telemetry.sdk.language" semantic conventions. It represents the - // language of the telemetry SDK. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - TelemetrySDKLanguageKey = attribute.Key("telemetry.sdk.language") - - // TelemetrySDKVersionKey is the attribute Key conforming to the - // "telemetry.sdk.version" semantic conventions. It represents the version - // string of the telemetry SDK. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '1.2.3' - TelemetrySDKVersionKey = attribute.Key("telemetry.sdk.version") - - // TelemetryAutoVersionKey is the attribute Key conforming to the - // "telemetry.auto.version" semantic conventions. It represents the version - // string of the auto instrumentation agent, if used. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '1.2.3' - TelemetryAutoVersionKey = attribute.Key("telemetry.auto.version") -) - -var ( - // cpp - TelemetrySDKLanguageCPP = TelemetrySDKLanguageKey.String("cpp") - // dotnet - TelemetrySDKLanguageDotnet = TelemetrySDKLanguageKey.String("dotnet") - // erlang - TelemetrySDKLanguageErlang = TelemetrySDKLanguageKey.String("erlang") - // go - TelemetrySDKLanguageGo = TelemetrySDKLanguageKey.String("go") - // java - TelemetrySDKLanguageJava = TelemetrySDKLanguageKey.String("java") - // nodejs - TelemetrySDKLanguageNodejs = TelemetrySDKLanguageKey.String("nodejs") - // php - TelemetrySDKLanguagePHP = TelemetrySDKLanguageKey.String("php") - // python - TelemetrySDKLanguagePython = TelemetrySDKLanguageKey.String("python") - // ruby - TelemetrySDKLanguageRuby = TelemetrySDKLanguageKey.String("ruby") - // webjs - TelemetrySDKLanguageWebjs = TelemetrySDKLanguageKey.String("webjs") - // swift - TelemetrySDKLanguageSwift = TelemetrySDKLanguageKey.String("swift") -) - -// TelemetrySDKName returns an attribute KeyValue conforming to the -// "telemetry.sdk.name" semantic conventions. It represents the name of the -// telemetry SDK as defined above. -func TelemetrySDKName(val string) attribute.KeyValue { - return TelemetrySDKNameKey.String(val) -} - -// TelemetrySDKVersion returns an attribute KeyValue conforming to the -// "telemetry.sdk.version" semantic conventions. It represents the version -// string of the telemetry SDK. -func TelemetrySDKVersion(val string) attribute.KeyValue { - return TelemetrySDKVersionKey.String(val) -} - -// TelemetryAutoVersion returns an attribute KeyValue conforming to the -// "telemetry.auto.version" semantic conventions. It represents the version -// string of the auto instrumentation agent, if used. -func TelemetryAutoVersion(val string) attribute.KeyValue { - return TelemetryAutoVersionKey.String(val) -} - -// Resource describing the packaged software running the application code. Web -// engines are typically executed using process.runtime. -const ( - // WebEngineNameKey is the attribute Key conforming to the "webengine.name" - // semantic conventions. It represents the name of the web engine. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'WildFly' - WebEngineNameKey = attribute.Key("webengine.name") - - // WebEngineVersionKey is the attribute Key conforming to the - // "webengine.version" semantic conventions. It represents the version of - // the web engine. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '21.0.0' - WebEngineVersionKey = attribute.Key("webengine.version") - - // WebEngineDescriptionKey is the attribute Key conforming to the - // "webengine.description" semantic conventions. It represents the - // additional description of the web engine (e.g. detailed version and - // edition information). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'WildFly Full 21.0.0.Final (WildFly Core 13.0.1.Final) - - // 2.2.2.Final' - WebEngineDescriptionKey = attribute.Key("webengine.description") -) - -// WebEngineName returns an attribute KeyValue conforming to the -// "webengine.name" semantic conventions. It represents the name of the web -// engine. -func WebEngineName(val string) attribute.KeyValue { - return WebEngineNameKey.String(val) -} - -// WebEngineVersion returns an attribute KeyValue conforming to the -// "webengine.version" semantic conventions. It represents the version of the -// web engine. -func WebEngineVersion(val string) attribute.KeyValue { - return WebEngineVersionKey.String(val) -} - -// WebEngineDescription returns an attribute KeyValue conforming to the -// "webengine.description" semantic conventions. It represents the additional -// description of the web engine (e.g. detailed version and edition -// information). -func WebEngineDescription(val string) attribute.KeyValue { - return WebEngineDescriptionKey.String(val) -} - -// Attributes used by non-OTLP exporters to represent OpenTelemetry Scope's -// concepts. -const ( - // OtelScopeNameKey is the attribute Key conforming to the - // "otel.scope.name" semantic conventions. It represents the name of the - // instrumentation scope - (`InstrumentationScope.Name` in OTLP). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'io.opentelemetry.contrib.mongodb' - OtelScopeNameKey = attribute.Key("otel.scope.name") - - // OtelScopeVersionKey is the attribute Key conforming to the - // "otel.scope.version" semantic conventions. It represents the version of - // the instrumentation scope - (`InstrumentationScope.Version` in OTLP). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '1.0.0' - OtelScopeVersionKey = attribute.Key("otel.scope.version") -) - -// OtelScopeName returns an attribute KeyValue conforming to the -// "otel.scope.name" semantic conventions. It represents the name of the -// instrumentation scope - (`InstrumentationScope.Name` in OTLP). -func OtelScopeName(val string) attribute.KeyValue { - return OtelScopeNameKey.String(val) -} - -// OtelScopeVersion returns an attribute KeyValue conforming to the -// "otel.scope.version" semantic conventions. It represents the version of the -// instrumentation scope - (`InstrumentationScope.Version` in OTLP). -func OtelScopeVersion(val string) attribute.KeyValue { - return OtelScopeVersionKey.String(val) -} - -// Span attributes used by non-OTLP exporters to represent OpenTelemetry -// Scope's concepts. -const ( - // OtelLibraryNameKey is the attribute Key conforming to the - // "otel.library.name" semantic conventions. It represents the deprecated, - // use the `otel.scope.name` attribute. - // - // Type: string - // RequirementLevel: Optional - // Stability: deprecated - // Examples: 'io.opentelemetry.contrib.mongodb' - OtelLibraryNameKey = attribute.Key("otel.library.name") - - // OtelLibraryVersionKey is the attribute Key conforming to the - // "otel.library.version" semantic conventions. It represents the - // deprecated, use the `otel.scope.version` attribute. - // - // Type: string - // RequirementLevel: Optional - // Stability: deprecated - // Examples: '1.0.0' - OtelLibraryVersionKey = attribute.Key("otel.library.version") -) - -// OtelLibraryName returns an attribute KeyValue conforming to the -// "otel.library.name" semantic conventions. It represents the deprecated, use -// the `otel.scope.name` attribute. -func OtelLibraryName(val string) attribute.KeyValue { - return OtelLibraryNameKey.String(val) -} - -// OtelLibraryVersion returns an attribute KeyValue conforming to the -// "otel.library.version" semantic conventions. It represents the deprecated, -// use the `otel.scope.version` attribute. -func OtelLibraryVersion(val string) attribute.KeyValue { - return OtelLibraryVersionKey.String(val) -} diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/trace.go b/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/trace.go deleted file mode 100644 index 21497bb6b..000000000 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/trace.go +++ /dev/null @@ -1,3364 +0,0 @@ -// Copyright The OpenTelemetry Authors -// SPDX-License-Identifier: Apache-2.0 - -// Code generated from semantic convention specification. DO NOT EDIT. - -package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0" - -import "go.opentelemetry.io/otel/attribute" - -// The shared attributes used to report a single exception associated with a -// span or log. -const ( - // ExceptionTypeKey is the attribute Key conforming to the "exception.type" - // semantic conventions. It represents the type of the exception (its - // fully-qualified class name, if applicable). The dynamic type of the - // exception should be preferred over the static type in languages that - // support it. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'java.net.ConnectException', 'OSError' - ExceptionTypeKey = attribute.Key("exception.type") - - // ExceptionMessageKey is the attribute Key conforming to the - // "exception.message" semantic conventions. It represents the exception - // message. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Division by zero', "Can't convert 'int' object to str - // implicitly" - ExceptionMessageKey = attribute.Key("exception.message") - - // ExceptionStacktraceKey is the attribute Key conforming to the - // "exception.stacktrace" semantic conventions. It represents a stacktrace - // as a string in the natural representation for the language runtime. The - // representation is to be determined and documented by each language SIG. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Exception in thread "main" java.lang.RuntimeException: Test - // exception\\n at ' - // 'com.example.GenerateTrace.methodB(GenerateTrace.java:13)\\n at ' - // 'com.example.GenerateTrace.methodA(GenerateTrace.java:9)\\n at ' - // 'com.example.GenerateTrace.main(GenerateTrace.java:5)' - ExceptionStacktraceKey = attribute.Key("exception.stacktrace") -) - -// ExceptionType returns an attribute KeyValue conforming to the -// "exception.type" semantic conventions. It represents the type of the -// exception (its fully-qualified class name, if applicable). The dynamic type -// of the exception should be preferred over the static type in languages that -// support it. -func ExceptionType(val string) attribute.KeyValue { - return ExceptionTypeKey.String(val) -} - -// ExceptionMessage returns an attribute KeyValue conforming to the -// "exception.message" semantic conventions. It represents the exception -// message. -func ExceptionMessage(val string) attribute.KeyValue { - return ExceptionMessageKey.String(val) -} - -// ExceptionStacktrace returns an attribute KeyValue conforming to the -// "exception.stacktrace" semantic conventions. It represents a stacktrace as a -// string in the natural representation for the language runtime. The -// representation is to be determined and documented by each language SIG. -func ExceptionStacktrace(val string) attribute.KeyValue { - return ExceptionStacktraceKey.String(val) -} - -// Attributes for Events represented using Log Records. -const ( - // EventNameKey is the attribute Key conforming to the "event.name" - // semantic conventions. It represents the name identifies the event. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'click', 'exception' - EventNameKey = attribute.Key("event.name") - - // EventDomainKey is the attribute Key conforming to the "event.domain" - // semantic conventions. It represents the domain identifies the business - // context for the events. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - // Note: Events across different domains may have same `event.name`, yet be - // unrelated events. - EventDomainKey = attribute.Key("event.domain") -) - -var ( - // Events from browser apps - EventDomainBrowser = EventDomainKey.String("browser") - // Events from mobile apps - EventDomainDevice = EventDomainKey.String("device") - // Events from Kubernetes - EventDomainK8S = EventDomainKey.String("k8s") -) - -// EventName returns an attribute KeyValue conforming to the "event.name" -// semantic conventions. It represents the name identifies the event. -func EventName(val string) attribute.KeyValue { - return EventNameKey.String(val) -} - -// Span attributes used by AWS Lambda (in addition to general `faas` -// attributes). -const ( - // AWSLambdaInvokedARNKey is the attribute Key conforming to the - // "aws.lambda.invoked_arn" semantic conventions. It represents the full - // invoked ARN as provided on the `Context` passed to the function - // (`Lambda-Runtime-Invoked-Function-ARN` header on the - // `/runtime/invocation/next` applicable). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'arn:aws:lambda:us-east-1:123456:function:myfunction:myalias' - // Note: This may be different from `faas.id` if an alias is involved. - AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn") -) - -// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the -// "aws.lambda.invoked_arn" semantic conventions. It represents the full -// invoked ARN as provided on the `Context` passed to the function -// (`Lambda-Runtime-Invoked-Function-ARN` header on the -// `/runtime/invocation/next` applicable). -func AWSLambdaInvokedARN(val string) attribute.KeyValue { - return AWSLambdaInvokedARNKey.String(val) -} - -// Attributes for CloudEvents. CloudEvents is a specification on how to define -// event data in a standard way. These attributes can be attached to spans when -// performing operations with CloudEvents, regardless of the protocol being -// used. -const ( - // CloudeventsEventIDKey is the attribute Key conforming to the - // "cloudevents.event_id" semantic conventions. It represents the - // [event_id](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id) - // uniquely identifies the event. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: '123e4567-e89b-12d3-a456-426614174000', '0001' - CloudeventsEventIDKey = attribute.Key("cloudevents.event_id") - - // CloudeventsEventSourceKey is the attribute Key conforming to the - // "cloudevents.event_source" semantic conventions. It represents the - // [source](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1) - // identifies the context in which an event happened. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'https://github.com/cloudevents', - // '/cloudevents/spec/pull/123', 'my-service' - CloudeventsEventSourceKey = attribute.Key("cloudevents.event_source") - - // CloudeventsEventSpecVersionKey is the attribute Key conforming to the - // "cloudevents.event_spec_version" semantic conventions. It represents the - // [version of the CloudEvents - // specification](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion) - // which the event uses. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '1.0' - CloudeventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version") - - // CloudeventsEventTypeKey is the attribute Key conforming to the - // "cloudevents.event_type" semantic conventions. It represents the - // [event_type](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type) - // contains a value describing the type of event related to the originating - // occurrence. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'com.github.pull_request.opened', - // 'com.example.object.deleted.v2' - CloudeventsEventTypeKey = attribute.Key("cloudevents.event_type") - - // CloudeventsEventSubjectKey is the attribute Key conforming to the - // "cloudevents.event_subject" semantic conventions. It represents the - // [subject](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject) - // of the event in the context of the event producer (identified by - // source). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'mynewfile.jpg' - CloudeventsEventSubjectKey = attribute.Key("cloudevents.event_subject") -) - -// CloudeventsEventID returns an attribute KeyValue conforming to the -// "cloudevents.event_id" semantic conventions. It represents the -// [event_id](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id) -// uniquely identifies the event. -func CloudeventsEventID(val string) attribute.KeyValue { - return CloudeventsEventIDKey.String(val) -} - -// CloudeventsEventSource returns an attribute KeyValue conforming to the -// "cloudevents.event_source" semantic conventions. It represents the -// [source](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1) -// identifies the context in which an event happened. -func CloudeventsEventSource(val string) attribute.KeyValue { - return CloudeventsEventSourceKey.String(val) -} - -// CloudeventsEventSpecVersion returns an attribute KeyValue conforming to -// the "cloudevents.event_spec_version" semantic conventions. It represents the -// [version of the CloudEvents -// specification](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion) -// which the event uses. -func CloudeventsEventSpecVersion(val string) attribute.KeyValue { - return CloudeventsEventSpecVersionKey.String(val) -} - -// CloudeventsEventType returns an attribute KeyValue conforming to the -// "cloudevents.event_type" semantic conventions. It represents the -// [event_type](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type) -// contains a value describing the type of event related to the originating -// occurrence. -func CloudeventsEventType(val string) attribute.KeyValue { - return CloudeventsEventTypeKey.String(val) -} - -// CloudeventsEventSubject returns an attribute KeyValue conforming to the -// "cloudevents.event_subject" semantic conventions. It represents the -// [subject](https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject) -// of the event in the context of the event producer (identified by source). -func CloudeventsEventSubject(val string) attribute.KeyValue { - return CloudeventsEventSubjectKey.String(val) -} - -// Semantic conventions for the OpenTracing Shim -const ( - // OpentracingRefTypeKey is the attribute Key conforming to the - // "opentracing.ref_type" semantic conventions. It represents the - // parent-child Reference type - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - // Note: The causal relationship between a child Span and a parent Span. - OpentracingRefTypeKey = attribute.Key("opentracing.ref_type") -) - -var ( - // The parent Span depends on the child Span in some capacity - OpentracingRefTypeChildOf = OpentracingRefTypeKey.String("child_of") - // The parent Span does not depend in any way on the result of the child Span - OpentracingRefTypeFollowsFrom = OpentracingRefTypeKey.String("follows_from") -) - -// The attributes used to perform database client calls. -const ( - // DBSystemKey is the attribute Key conforming to the "db.system" semantic - // conventions. It represents an identifier for the database management - // system (DBMS) product being used. See below for a list of well-known - // identifiers. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - DBSystemKey = attribute.Key("db.system") - - // DBConnectionStringKey is the attribute Key conforming to the - // "db.connection_string" semantic conventions. It represents the - // connection string used to connect to the database. It is recommended to - // remove embedded credentials. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Server=(localdb)\\v11.0;Integrated Security=true;' - DBConnectionStringKey = attribute.Key("db.connection_string") - - // DBUserKey is the attribute Key conforming to the "db.user" semantic - // conventions. It represents the username for accessing the database. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'readonly_user', 'reporting_user' - DBUserKey = attribute.Key("db.user") - - // DBJDBCDriverClassnameKey is the attribute Key conforming to the - // "db.jdbc.driver_classname" semantic conventions. It represents the - // fully-qualified class name of the [Java Database Connectivity - // (JDBC)](https://docs.oracle.com/javase/8/docs/technotes/guides/jdbc/) - // driver used to connect. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'org.postgresql.Driver', - // 'com.microsoft.sqlserver.jdbc.SQLServerDriver' - DBJDBCDriverClassnameKey = attribute.Key("db.jdbc.driver_classname") - - // DBNameKey is the attribute Key conforming to the "db.name" semantic - // conventions. It represents the this attribute is used to report the name - // of the database being accessed. For commands that switch the database, - // this should be set to the target database (even if the command fails). - // - // Type: string - // RequirementLevel: ConditionallyRequired (If applicable.) - // Stability: stable - // Examples: 'customers', 'main' - // Note: In some SQL databases, the database name to be used is called - // "schema name". In case there are multiple layers that could be - // considered for database name (e.g. Oracle instance name and schema - // name), the database name to be used is the more specific layer (e.g. - // Oracle schema name). - DBNameKey = attribute.Key("db.name") - - // DBStatementKey is the attribute Key conforming to the "db.statement" - // semantic conventions. It represents the database statement being - // executed. - // - // Type: string - // RequirementLevel: ConditionallyRequired (If applicable and not - // explicitly disabled via instrumentation configuration.) - // Stability: stable - // Examples: 'SELECT * FROM wuser_table', 'SET mykey "WuValue"' - // Note: The value may be sanitized to exclude sensitive information. - DBStatementKey = attribute.Key("db.statement") - - // DBOperationKey is the attribute Key conforming to the "db.operation" - // semantic conventions. It represents the name of the operation being - // executed, e.g. the [MongoDB command - // name](https://docs.mongodb.com/manual/reference/command/#database-operations) - // such as `findAndModify`, or the SQL keyword. - // - // Type: string - // RequirementLevel: ConditionallyRequired (If `db.statement` is not - // applicable.) - // Stability: stable - // Examples: 'findAndModify', 'HMSET', 'SELECT' - // Note: When setting this to an SQL keyword, it is not recommended to - // attempt any client-side parsing of `db.statement` just to get this - // property, but it should be set if the operation name is provided by the - // library being instrumented. If the SQL statement has an ambiguous - // operation, or performs more than one operation, this value may be - // omitted. - DBOperationKey = attribute.Key("db.operation") -) - -var ( - // Some other SQL database. Fallback only. See notes - DBSystemOtherSQL = DBSystemKey.String("other_sql") - // Microsoft SQL Server - DBSystemMSSQL = DBSystemKey.String("mssql") - // MySQL - DBSystemMySQL = DBSystemKey.String("mysql") - // Oracle Database - DBSystemOracle = DBSystemKey.String("oracle") - // IBM DB2 - DBSystemDB2 = DBSystemKey.String("db2") - // PostgreSQL - DBSystemPostgreSQL = DBSystemKey.String("postgresql") - // Amazon Redshift - DBSystemRedshift = DBSystemKey.String("redshift") - // Apache Hive - DBSystemHive = DBSystemKey.String("hive") - // Cloudscape - DBSystemCloudscape = DBSystemKey.String("cloudscape") - // HyperSQL DataBase - DBSystemHSQLDB = DBSystemKey.String("hsqldb") - // Progress Database - DBSystemProgress = DBSystemKey.String("progress") - // SAP MaxDB - DBSystemMaxDB = DBSystemKey.String("maxdb") - // SAP HANA - DBSystemHanaDB = DBSystemKey.String("hanadb") - // Ingres - DBSystemIngres = DBSystemKey.String("ingres") - // FirstSQL - DBSystemFirstSQL = DBSystemKey.String("firstsql") - // EnterpriseDB - DBSystemEDB = DBSystemKey.String("edb") - // InterSystems Caché - DBSystemCache = DBSystemKey.String("cache") - // Adabas (Adaptable Database System) - DBSystemAdabas = DBSystemKey.String("adabas") - // Firebird - DBSystemFirebird = DBSystemKey.String("firebird") - // Apache Derby - DBSystemDerby = DBSystemKey.String("derby") - // FileMaker - DBSystemFilemaker = DBSystemKey.String("filemaker") - // Informix - DBSystemInformix = DBSystemKey.String("informix") - // InstantDB - DBSystemInstantDB = DBSystemKey.String("instantdb") - // InterBase - DBSystemInterbase = DBSystemKey.String("interbase") - // MariaDB - DBSystemMariaDB = DBSystemKey.String("mariadb") - // Netezza - DBSystemNetezza = DBSystemKey.String("netezza") - // Pervasive PSQL - DBSystemPervasive = DBSystemKey.String("pervasive") - // PointBase - DBSystemPointbase = DBSystemKey.String("pointbase") - // SQLite - DBSystemSqlite = DBSystemKey.String("sqlite") - // Sybase - DBSystemSybase = DBSystemKey.String("sybase") - // Teradata - DBSystemTeradata = DBSystemKey.String("teradata") - // Vertica - DBSystemVertica = DBSystemKey.String("vertica") - // H2 - DBSystemH2 = DBSystemKey.String("h2") - // ColdFusion IMQ - DBSystemColdfusion = DBSystemKey.String("coldfusion") - // Apache Cassandra - DBSystemCassandra = DBSystemKey.String("cassandra") - // Apache HBase - DBSystemHBase = DBSystemKey.String("hbase") - // MongoDB - DBSystemMongoDB = DBSystemKey.String("mongodb") - // Redis - DBSystemRedis = DBSystemKey.String("redis") - // Couchbase - DBSystemCouchbase = DBSystemKey.String("couchbase") - // CouchDB - DBSystemCouchDB = DBSystemKey.String("couchdb") - // Microsoft Azure Cosmos DB - DBSystemCosmosDB = DBSystemKey.String("cosmosdb") - // Amazon DynamoDB - DBSystemDynamoDB = DBSystemKey.String("dynamodb") - // Neo4j - DBSystemNeo4j = DBSystemKey.String("neo4j") - // Apache Geode - DBSystemGeode = DBSystemKey.String("geode") - // Elasticsearch - DBSystemElasticsearch = DBSystemKey.String("elasticsearch") - // Memcached - DBSystemMemcached = DBSystemKey.String("memcached") - // CockroachDB - DBSystemCockroachdb = DBSystemKey.String("cockroachdb") - // OpenSearch - DBSystemOpensearch = DBSystemKey.String("opensearch") - // ClickHouse - DBSystemClickhouse = DBSystemKey.String("clickhouse") -) - -// DBConnectionString returns an attribute KeyValue conforming to the -// "db.connection_string" semantic conventions. It represents the connection -// string used to connect to the database. It is recommended to remove embedded -// credentials. -func DBConnectionString(val string) attribute.KeyValue { - return DBConnectionStringKey.String(val) -} - -// DBUser returns an attribute KeyValue conforming to the "db.user" semantic -// conventions. It represents the username for accessing the database. -func DBUser(val string) attribute.KeyValue { - return DBUserKey.String(val) -} - -// DBJDBCDriverClassname returns an attribute KeyValue conforming to the -// "db.jdbc.driver_classname" semantic conventions. It represents the -// fully-qualified class name of the [Java Database Connectivity -// (JDBC)](https://docs.oracle.com/javase/8/docs/technotes/guides/jdbc/) driver -// used to connect. -func DBJDBCDriverClassname(val string) attribute.KeyValue { - return DBJDBCDriverClassnameKey.String(val) -} - -// DBName returns an attribute KeyValue conforming to the "db.name" semantic -// conventions. It represents the this attribute is used to report the name of -// the database being accessed. For commands that switch the database, this -// should be set to the target database (even if the command fails). -func DBName(val string) attribute.KeyValue { - return DBNameKey.String(val) -} - -// DBStatement returns an attribute KeyValue conforming to the -// "db.statement" semantic conventions. It represents the database statement -// being executed. -func DBStatement(val string) attribute.KeyValue { - return DBStatementKey.String(val) -} - -// DBOperation returns an attribute KeyValue conforming to the -// "db.operation" semantic conventions. It represents the name of the operation -// being executed, e.g. the [MongoDB command -// name](https://docs.mongodb.com/manual/reference/command/#database-operations) -// such as `findAndModify`, or the SQL keyword. -func DBOperation(val string) attribute.KeyValue { - return DBOperationKey.String(val) -} - -// Connection-level attributes for Microsoft SQL Server -const ( - // DBMSSQLInstanceNameKey is the attribute Key conforming to the - // "db.mssql.instance_name" semantic conventions. It represents the - // Microsoft SQL Server [instance - // name](https://docs.microsoft.com/en-us/sql/connect/jdbc/building-the-connection-url?view=sql-server-ver15) - // connecting to. This name is used to determine the port of a named - // instance. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'MSSQLSERVER' - // Note: If setting a `db.mssql.instance_name`, `net.peer.port` is no - // longer required (but still recommended if non-standard). - DBMSSQLInstanceNameKey = attribute.Key("db.mssql.instance_name") -) - -// DBMSSQLInstanceName returns an attribute KeyValue conforming to the -// "db.mssql.instance_name" semantic conventions. It represents the Microsoft -// SQL Server [instance -// name](https://docs.microsoft.com/en-us/sql/connect/jdbc/building-the-connection-url?view=sql-server-ver15) -// connecting to. This name is used to determine the port of a named instance. -func DBMSSQLInstanceName(val string) attribute.KeyValue { - return DBMSSQLInstanceNameKey.String(val) -} - -// Call-level attributes for Cassandra -const ( - // DBCassandraPageSizeKey is the attribute Key conforming to the - // "db.cassandra.page_size" semantic conventions. It represents the fetch - // size used for paging, i.e. how many rows will be returned at once. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 5000 - DBCassandraPageSizeKey = attribute.Key("db.cassandra.page_size") - - // DBCassandraConsistencyLevelKey is the attribute Key conforming to the - // "db.cassandra.consistency_level" semantic conventions. It represents the - // consistency level of the query. Based on consistency values from - // [CQL](https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html). - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - DBCassandraConsistencyLevelKey = attribute.Key("db.cassandra.consistency_level") - - // DBCassandraTableKey is the attribute Key conforming to the - // "db.cassandra.table" semantic conventions. It represents the name of the - // primary table that the operation is acting upon, including the keyspace - // name (if applicable). - // - // Type: string - // RequirementLevel: Recommended - // Stability: stable - // Examples: 'mytable' - // Note: This mirrors the db.sql.table attribute but references cassandra - // rather than sql. It is not recommended to attempt any client-side - // parsing of `db.statement` just to get this property, but it should be - // set if it is provided by the library being instrumented. If the - // operation is acting upon an anonymous table, or more than one table, - // this value MUST NOT be set. - DBCassandraTableKey = attribute.Key("db.cassandra.table") - - // DBCassandraIdempotenceKey is the attribute Key conforming to the - // "db.cassandra.idempotence" semantic conventions. It represents the - // whether or not the query is idempotent. - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - DBCassandraIdempotenceKey = attribute.Key("db.cassandra.idempotence") - - // DBCassandraSpeculativeExecutionCountKey is the attribute Key conforming - // to the "db.cassandra.speculative_execution_count" semantic conventions. - // It represents the number of times a query was speculatively executed. - // Not set or `0` if the query was not executed speculatively. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 0, 2 - DBCassandraSpeculativeExecutionCountKey = attribute.Key("db.cassandra.speculative_execution_count") - - // DBCassandraCoordinatorIDKey is the attribute Key conforming to the - // "db.cassandra.coordinator.id" semantic conventions. It represents the ID - // of the coordinating node for a query. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'be13faa2-8574-4d71-926d-27f16cf8a7af' - DBCassandraCoordinatorIDKey = attribute.Key("db.cassandra.coordinator.id") - - // DBCassandraCoordinatorDCKey is the attribute Key conforming to the - // "db.cassandra.coordinator.dc" semantic conventions. It represents the - // data center of the coordinating node for a query. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'us-west-2' - DBCassandraCoordinatorDCKey = attribute.Key("db.cassandra.coordinator.dc") -) - -var ( - // all - DBCassandraConsistencyLevelAll = DBCassandraConsistencyLevelKey.String("all") - // each_quorum - DBCassandraConsistencyLevelEachQuorum = DBCassandraConsistencyLevelKey.String("each_quorum") - // quorum - DBCassandraConsistencyLevelQuorum = DBCassandraConsistencyLevelKey.String("quorum") - // local_quorum - DBCassandraConsistencyLevelLocalQuorum = DBCassandraConsistencyLevelKey.String("local_quorum") - // one - DBCassandraConsistencyLevelOne = DBCassandraConsistencyLevelKey.String("one") - // two - DBCassandraConsistencyLevelTwo = DBCassandraConsistencyLevelKey.String("two") - // three - DBCassandraConsistencyLevelThree = DBCassandraConsistencyLevelKey.String("three") - // local_one - DBCassandraConsistencyLevelLocalOne = DBCassandraConsistencyLevelKey.String("local_one") - // any - DBCassandraConsistencyLevelAny = DBCassandraConsistencyLevelKey.String("any") - // serial - DBCassandraConsistencyLevelSerial = DBCassandraConsistencyLevelKey.String("serial") - // local_serial - DBCassandraConsistencyLevelLocalSerial = DBCassandraConsistencyLevelKey.String("local_serial") -) - -// DBCassandraPageSize returns an attribute KeyValue conforming to the -// "db.cassandra.page_size" semantic conventions. It represents the fetch size -// used for paging, i.e. how many rows will be returned at once. -func DBCassandraPageSize(val int) attribute.KeyValue { - return DBCassandraPageSizeKey.Int(val) -} - -// DBCassandraTable returns an attribute KeyValue conforming to the -// "db.cassandra.table" semantic conventions. It represents the name of the -// primary table that the operation is acting upon, including the keyspace name -// (if applicable). -func DBCassandraTable(val string) attribute.KeyValue { - return DBCassandraTableKey.String(val) -} - -// DBCassandraIdempotence returns an attribute KeyValue conforming to the -// "db.cassandra.idempotence" semantic conventions. It represents the whether -// or not the query is idempotent. -func DBCassandraIdempotence(val bool) attribute.KeyValue { - return DBCassandraIdempotenceKey.Bool(val) -} - -// DBCassandraSpeculativeExecutionCount returns an attribute KeyValue -// conforming to the "db.cassandra.speculative_execution_count" semantic -// conventions. It represents the number of times a query was speculatively -// executed. Not set or `0` if the query was not executed speculatively. -func DBCassandraSpeculativeExecutionCount(val int) attribute.KeyValue { - return DBCassandraSpeculativeExecutionCountKey.Int(val) -} - -// DBCassandraCoordinatorID returns an attribute KeyValue conforming to the -// "db.cassandra.coordinator.id" semantic conventions. It represents the ID of -// the coordinating node for a query. -func DBCassandraCoordinatorID(val string) attribute.KeyValue { - return DBCassandraCoordinatorIDKey.String(val) -} - -// DBCassandraCoordinatorDC returns an attribute KeyValue conforming to the -// "db.cassandra.coordinator.dc" semantic conventions. It represents the data -// center of the coordinating node for a query. -func DBCassandraCoordinatorDC(val string) attribute.KeyValue { - return DBCassandraCoordinatorDCKey.String(val) -} - -// Call-level attributes for Redis -const ( - // DBRedisDBIndexKey is the attribute Key conforming to the - // "db.redis.database_index" semantic conventions. It represents the index - // of the database being accessed as used in the [`SELECT` - // command](https://redis.io/commands/select), provided as an integer. To - // be used instead of the generic `db.name` attribute. - // - // Type: int - // RequirementLevel: ConditionallyRequired (If other than the default - // database (`0`).) - // Stability: stable - // Examples: 0, 1, 15 - DBRedisDBIndexKey = attribute.Key("db.redis.database_index") -) - -// DBRedisDBIndex returns an attribute KeyValue conforming to the -// "db.redis.database_index" semantic conventions. It represents the index of -// the database being accessed as used in the [`SELECT` -// command](https://redis.io/commands/select), provided as an integer. To be -// used instead of the generic `db.name` attribute. -func DBRedisDBIndex(val int) attribute.KeyValue { - return DBRedisDBIndexKey.Int(val) -} - -// Call-level attributes for MongoDB -const ( - // DBMongoDBCollectionKey is the attribute Key conforming to the - // "db.mongodb.collection" semantic conventions. It represents the - // collection being accessed within the database stated in `db.name`. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'customers', 'products' - DBMongoDBCollectionKey = attribute.Key("db.mongodb.collection") -) - -// DBMongoDBCollection returns an attribute KeyValue conforming to the -// "db.mongodb.collection" semantic conventions. It represents the collection -// being accessed within the database stated in `db.name`. -func DBMongoDBCollection(val string) attribute.KeyValue { - return DBMongoDBCollectionKey.String(val) -} - -// Call-level attributes for SQL databases -const ( - // DBSQLTableKey is the attribute Key conforming to the "db.sql.table" - // semantic conventions. It represents the name of the primary table that - // the operation is acting upon, including the database name (if - // applicable). - // - // Type: string - // RequirementLevel: Recommended - // Stability: stable - // Examples: 'public.users', 'customers' - // Note: It is not recommended to attempt any client-side parsing of - // `db.statement` just to get this property, but it should be set if it is - // provided by the library being instrumented. If the operation is acting - // upon an anonymous table, or more than one table, this value MUST NOT be - // set. - DBSQLTableKey = attribute.Key("db.sql.table") -) - -// DBSQLTable returns an attribute KeyValue conforming to the "db.sql.table" -// semantic conventions. It represents the name of the primary table that the -// operation is acting upon, including the database name (if applicable). -func DBSQLTable(val string) attribute.KeyValue { - return DBSQLTableKey.String(val) -} - -// Span attributes used by non-OTLP exporters to represent OpenTelemetry Span's -// concepts. -const ( - // OtelStatusCodeKey is the attribute Key conforming to the - // "otel.status_code" semantic conventions. It represents the name of the - // code, either "OK" or "ERROR". MUST NOT be set if the status code is - // UNSET. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - OtelStatusCodeKey = attribute.Key("otel.status_code") - - // OtelStatusDescriptionKey is the attribute Key conforming to the - // "otel.status_description" semantic conventions. It represents the - // description of the Status if it has a value, otherwise not set. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'resource not found' - OtelStatusDescriptionKey = attribute.Key("otel.status_description") -) - -var ( - // The operation has been validated by an Application developer or Operator to have completed successfully - OtelStatusCodeOk = OtelStatusCodeKey.String("OK") - // The operation contains an error - OtelStatusCodeError = OtelStatusCodeKey.String("ERROR") -) - -// OtelStatusDescription returns an attribute KeyValue conforming to the -// "otel.status_description" semantic conventions. It represents the -// description of the Status if it has a value, otherwise not set. -func OtelStatusDescription(val string) attribute.KeyValue { - return OtelStatusDescriptionKey.String(val) -} - -// This semantic convention describes an instance of a function that runs -// without provisioning or managing of servers (also known as serverless -// functions or Function as a Service (FaaS)) with spans. -const ( - // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger" - // semantic conventions. It represents the type of the trigger which caused - // this function execution. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - // Note: For the server/consumer span on the incoming side, - // `faas.trigger` MUST be set. - // - // Clients invoking FaaS instances usually cannot set `faas.trigger`, - // since they would typically need to look in the payload to determine - // the event type. If clients set it, it should be the same as the - // trigger that corresponding incoming would have (i.e., this has - // nothing to do with the underlying transport used to make the API - // call to invoke the lambda, which is often HTTP). - FaaSTriggerKey = attribute.Key("faas.trigger") - - // FaaSExecutionKey is the attribute Key conforming to the "faas.execution" - // semantic conventions. It represents the execution ID of the current - // function execution. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'af9d5aa4-a685-4c5f-a22b-444f80b3cc28' - FaaSExecutionKey = attribute.Key("faas.execution") -) - -var ( - // A response to some data source operation such as a database or filesystem read/write - FaaSTriggerDatasource = FaaSTriggerKey.String("datasource") - // To provide an answer to an inbound HTTP request - FaaSTriggerHTTP = FaaSTriggerKey.String("http") - // A function is set to be executed when messages are sent to a messaging system - FaaSTriggerPubsub = FaaSTriggerKey.String("pubsub") - // A function is scheduled to be executed regularly - FaaSTriggerTimer = FaaSTriggerKey.String("timer") - // If none of the others apply - FaaSTriggerOther = FaaSTriggerKey.String("other") -) - -// FaaSExecution returns an attribute KeyValue conforming to the -// "faas.execution" semantic conventions. It represents the execution ID of the -// current function execution. -func FaaSExecution(val string) attribute.KeyValue { - return FaaSExecutionKey.String(val) -} - -// Semantic Convention for FaaS triggered as a response to some data source -// operation such as a database or filesystem read/write. -const ( - // FaaSDocumentCollectionKey is the attribute Key conforming to the - // "faas.document.collection" semantic conventions. It represents the name - // of the source on which the triggering operation was performed. For - // example, in Cloud Storage or S3 corresponds to the bucket name, and in - // Cosmos DB to the database name. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'myBucketName', 'myDBName' - FaaSDocumentCollectionKey = attribute.Key("faas.document.collection") - - // FaaSDocumentOperationKey is the attribute Key conforming to the - // "faas.document.operation" semantic conventions. It represents the - // describes the type of the operation that was performed on the data. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - FaaSDocumentOperationKey = attribute.Key("faas.document.operation") - - // FaaSDocumentTimeKey is the attribute Key conforming to the - // "faas.document.time" semantic conventions. It represents a string - // containing the time when the data was accessed in the [ISO - // 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format - // expressed in [UTC](https://www.w3.org/TR/NOTE-datetime). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '2020-01-23T13:47:06Z' - FaaSDocumentTimeKey = attribute.Key("faas.document.time") - - // FaaSDocumentNameKey is the attribute Key conforming to the - // "faas.document.name" semantic conventions. It represents the document - // name/table subjected to the operation. For example, in Cloud Storage or - // S3 is the name of the file, and in Cosmos DB the table name. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'myFile.txt', 'myTableName' - FaaSDocumentNameKey = attribute.Key("faas.document.name") -) - -var ( - // When a new object is created - FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert") - // When an object is modified - FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit") - // When an object is deleted - FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete") -) - -// FaaSDocumentCollection returns an attribute KeyValue conforming to the -// "faas.document.collection" semantic conventions. It represents the name of -// the source on which the triggering operation was performed. For example, in -// Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the -// database name. -func FaaSDocumentCollection(val string) attribute.KeyValue { - return FaaSDocumentCollectionKey.String(val) -} - -// FaaSDocumentTime returns an attribute KeyValue conforming to the -// "faas.document.time" semantic conventions. It represents a string containing -// the time when the data was accessed in the [ISO -// 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format -// expressed in [UTC](https://www.w3.org/TR/NOTE-datetime). -func FaaSDocumentTime(val string) attribute.KeyValue { - return FaaSDocumentTimeKey.String(val) -} - -// FaaSDocumentName returns an attribute KeyValue conforming to the -// "faas.document.name" semantic conventions. It represents the document -// name/table subjected to the operation. For example, in Cloud Storage or S3 -// is the name of the file, and in Cosmos DB the table name. -func FaaSDocumentName(val string) attribute.KeyValue { - return FaaSDocumentNameKey.String(val) -} - -// Semantic Convention for FaaS scheduled to be executed regularly. -const ( - // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic - // conventions. It represents a string containing the function invocation - // time in the [ISO - // 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format - // expressed in [UTC](https://www.w3.org/TR/NOTE-datetime). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '2020-01-23T13:47:06Z' - FaaSTimeKey = attribute.Key("faas.time") - - // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic - // conventions. It represents a string containing the schedule period as - // [Cron - // Expression](https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '0/5 * * * ? *' - FaaSCronKey = attribute.Key("faas.cron") -) - -// FaaSTime returns an attribute KeyValue conforming to the "faas.time" -// semantic conventions. It represents a string containing the function -// invocation time in the [ISO -// 8601](https://www.iso.org/iso-8601-date-and-time-format.html) format -// expressed in [UTC](https://www.w3.org/TR/NOTE-datetime). -func FaaSTime(val string) attribute.KeyValue { - return FaaSTimeKey.String(val) -} - -// FaaSCron returns an attribute KeyValue conforming to the "faas.cron" -// semantic conventions. It represents a string containing the schedule period -// as [Cron -// Expression](https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm). -func FaaSCron(val string) attribute.KeyValue { - return FaaSCronKey.String(val) -} - -// Contains additional attributes for incoming FaaS spans. -const ( - // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart" - // semantic conventions. It represents a boolean that is true if the - // serverless function is executed for the first time (aka cold-start). - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - FaaSColdstartKey = attribute.Key("faas.coldstart") -) - -// FaaSColdstart returns an attribute KeyValue conforming to the -// "faas.coldstart" semantic conventions. It represents a boolean that is true -// if the serverless function is executed for the first time (aka cold-start). -func FaaSColdstart(val bool) attribute.KeyValue { - return FaaSColdstartKey.Bool(val) -} - -// Contains additional attributes for outgoing FaaS spans. -const ( - // FaaSInvokedNameKey is the attribute Key conforming to the - // "faas.invoked_name" semantic conventions. It represents the name of the - // invoked function. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'my-function' - // Note: SHOULD be equal to the `faas.name` resource attribute of the - // invoked function. - FaaSInvokedNameKey = attribute.Key("faas.invoked_name") - - // FaaSInvokedProviderKey is the attribute Key conforming to the - // "faas.invoked_provider" semantic conventions. It represents the cloud - // provider of the invoked function. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - // Note: SHOULD be equal to the `cloud.provider` resource attribute of the - // invoked function. - FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider") - - // FaaSInvokedRegionKey is the attribute Key conforming to the - // "faas.invoked_region" semantic conventions. It represents the cloud - // region of the invoked function. - // - // Type: string - // RequirementLevel: ConditionallyRequired (For some cloud providers, like - // AWS or GCP, the region in which a function is hosted is essential to - // uniquely identify the function and also part of its endpoint. Since it's - // part of the endpoint being called, the region is always known to - // clients. In these cases, `faas.invoked_region` MUST be set accordingly. - // If the region is unknown to the client or not required for identifying - // the invoked function, setting `faas.invoked_region` is optional.) - // Stability: stable - // Examples: 'eu-central-1' - // Note: SHOULD be equal to the `cloud.region` resource attribute of the - // invoked function. - FaaSInvokedRegionKey = attribute.Key("faas.invoked_region") -) - -var ( - // Alibaba Cloud - FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud") - // Amazon Web Services - FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws") - // Microsoft Azure - FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure") - // Google Cloud Platform - FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp") - // Tencent Cloud - FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud") -) - -// FaaSInvokedName returns an attribute KeyValue conforming to the -// "faas.invoked_name" semantic conventions. It represents the name of the -// invoked function. -func FaaSInvokedName(val string) attribute.KeyValue { - return FaaSInvokedNameKey.String(val) -} - -// FaaSInvokedRegion returns an attribute KeyValue conforming to the -// "faas.invoked_region" semantic conventions. It represents the cloud region -// of the invoked function. -func FaaSInvokedRegion(val string) attribute.KeyValue { - return FaaSInvokedRegionKey.String(val) -} - -// These attributes may be used for any network related operation. -const ( - // NetTransportKey is the attribute Key conforming to the "net.transport" - // semantic conventions. It represents the transport protocol used. See - // note below. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - NetTransportKey = attribute.Key("net.transport") - - // NetAppProtocolNameKey is the attribute Key conforming to the - // "net.app.protocol.name" semantic conventions. It represents the - // application layer protocol used. The value SHOULD be normalized to - // lowercase. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'amqp', 'http', 'mqtt' - NetAppProtocolNameKey = attribute.Key("net.app.protocol.name") - - // NetAppProtocolVersionKey is the attribute Key conforming to the - // "net.app.protocol.version" semantic conventions. It represents the - // version of the application layer protocol used. See note below. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '3.1.1' - // Note: `net.app.protocol.version` refers to the version of the protocol - // used and might be different from the protocol client's version. If the - // HTTP client used has a version of `0.27.2`, but sends HTTP version - // `1.1`, this attribute should be set to `1.1`. - NetAppProtocolVersionKey = attribute.Key("net.app.protocol.version") - - // NetSockPeerNameKey is the attribute Key conforming to the - // "net.sock.peer.name" semantic conventions. It represents the remote - // socket peer name. - // - // Type: string - // RequirementLevel: Recommended (If available and different from - // `net.peer.name` and if `net.sock.peer.addr` is set.) - // Stability: stable - // Examples: 'proxy.example.com' - NetSockPeerNameKey = attribute.Key("net.sock.peer.name") - - // NetSockPeerAddrKey is the attribute Key conforming to the - // "net.sock.peer.addr" semantic conventions. It represents the remote - // socket peer address: IPv4 or IPv6 for internet protocols, path for local - // communication, - // [etc](https://man7.org/linux/man-pages/man7/address_families.7.html). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '127.0.0.1', '/tmp/mysql.sock' - NetSockPeerAddrKey = attribute.Key("net.sock.peer.addr") - - // NetSockPeerPortKey is the attribute Key conforming to the - // "net.sock.peer.port" semantic conventions. It represents the remote - // socket peer port. - // - // Type: int - // RequirementLevel: Recommended (If defined for the address family and if - // different than `net.peer.port` and if `net.sock.peer.addr` is set.) - // Stability: stable - // Examples: 16456 - NetSockPeerPortKey = attribute.Key("net.sock.peer.port") - - // NetSockFamilyKey is the attribute Key conforming to the - // "net.sock.family" semantic conventions. It represents the protocol - // [address - // family](https://man7.org/linux/man-pages/man7/address_families.7.html) - // which is used for communication. - // - // Type: Enum - // RequirementLevel: ConditionallyRequired (If different than `inet` and if - // any of `net.sock.peer.addr` or `net.sock.host.addr` are set. Consumers - // of telemetry SHOULD accept both IPv4 and IPv6 formats for the address in - // `net.sock.peer.addr` if `net.sock.family` is not set. This is to support - // instrumentations that follow previous versions of this document.) - // Stability: stable - // Examples: 'inet6', 'bluetooth' - NetSockFamilyKey = attribute.Key("net.sock.family") - - // NetPeerNameKey is the attribute Key conforming to the "net.peer.name" - // semantic conventions. It represents the logical remote hostname, see - // note below. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'example.com' - // Note: `net.peer.name` SHOULD NOT be set if capturing it would require an - // extra DNS lookup. - NetPeerNameKey = attribute.Key("net.peer.name") - - // NetPeerPortKey is the attribute Key conforming to the "net.peer.port" - // semantic conventions. It represents the logical remote port number - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 80, 8080, 443 - NetPeerPortKey = attribute.Key("net.peer.port") - - // NetHostNameKey is the attribute Key conforming to the "net.host.name" - // semantic conventions. It represents the logical local hostname or - // similar, see note below. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'localhost' - NetHostNameKey = attribute.Key("net.host.name") - - // NetHostPortKey is the attribute Key conforming to the "net.host.port" - // semantic conventions. It represents the logical local port number, - // preferably the one that the peer used to connect - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 8080 - NetHostPortKey = attribute.Key("net.host.port") - - // NetSockHostAddrKey is the attribute Key conforming to the - // "net.sock.host.addr" semantic conventions. It represents the local - // socket address. Useful in case of a multi-IP host. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '192.168.0.1' - NetSockHostAddrKey = attribute.Key("net.sock.host.addr") - - // NetSockHostPortKey is the attribute Key conforming to the - // "net.sock.host.port" semantic conventions. It represents the local - // socket port number. - // - // Type: int - // RequirementLevel: Recommended (If defined for the address family and if - // different than `net.host.port` and if `net.sock.host.addr` is set.) - // Stability: stable - // Examples: 35555 - NetSockHostPortKey = attribute.Key("net.sock.host.port") - - // NetHostConnectionTypeKey is the attribute Key conforming to the - // "net.host.connection.type" semantic conventions. It represents the - // internet connection type currently being used by the host. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - // Examples: 'wifi' - NetHostConnectionTypeKey = attribute.Key("net.host.connection.type") - - // NetHostConnectionSubtypeKey is the attribute Key conforming to the - // "net.host.connection.subtype" semantic conventions. It represents the - // this describes more details regarding the connection.type. It may be the - // type of cell technology connection, but it could be used for describing - // details about a wifi connection. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - // Examples: 'LTE' - NetHostConnectionSubtypeKey = attribute.Key("net.host.connection.subtype") - - // NetHostCarrierNameKey is the attribute Key conforming to the - // "net.host.carrier.name" semantic conventions. It represents the name of - // the mobile carrier. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'sprint' - NetHostCarrierNameKey = attribute.Key("net.host.carrier.name") - - // NetHostCarrierMccKey is the attribute Key conforming to the - // "net.host.carrier.mcc" semantic conventions. It represents the mobile - // carrier country code. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '310' - NetHostCarrierMccKey = attribute.Key("net.host.carrier.mcc") - - // NetHostCarrierMncKey is the attribute Key conforming to the - // "net.host.carrier.mnc" semantic conventions. It represents the mobile - // carrier network code. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '001' - NetHostCarrierMncKey = attribute.Key("net.host.carrier.mnc") - - // NetHostCarrierIccKey is the attribute Key conforming to the - // "net.host.carrier.icc" semantic conventions. It represents the ISO - // 3166-1 alpha-2 2-character country code associated with the mobile - // carrier network. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'DE' - NetHostCarrierIccKey = attribute.Key("net.host.carrier.icc") -) - -var ( - // ip_tcp - NetTransportTCP = NetTransportKey.String("ip_tcp") - // ip_udp - NetTransportUDP = NetTransportKey.String("ip_udp") - // Named or anonymous pipe. See note below - NetTransportPipe = NetTransportKey.String("pipe") - // In-process communication - NetTransportInProc = NetTransportKey.String("inproc") - // Something else (non IP-based) - NetTransportOther = NetTransportKey.String("other") -) - -var ( - // IPv4 address - NetSockFamilyInet = NetSockFamilyKey.String("inet") - // IPv6 address - NetSockFamilyInet6 = NetSockFamilyKey.String("inet6") - // Unix domain socket path - NetSockFamilyUnix = NetSockFamilyKey.String("unix") -) - -var ( - // wifi - NetHostConnectionTypeWifi = NetHostConnectionTypeKey.String("wifi") - // wired - NetHostConnectionTypeWired = NetHostConnectionTypeKey.String("wired") - // cell - NetHostConnectionTypeCell = NetHostConnectionTypeKey.String("cell") - // unavailable - NetHostConnectionTypeUnavailable = NetHostConnectionTypeKey.String("unavailable") - // unknown - NetHostConnectionTypeUnknown = NetHostConnectionTypeKey.String("unknown") -) - -var ( - // GPRS - NetHostConnectionSubtypeGprs = NetHostConnectionSubtypeKey.String("gprs") - // EDGE - NetHostConnectionSubtypeEdge = NetHostConnectionSubtypeKey.String("edge") - // UMTS - NetHostConnectionSubtypeUmts = NetHostConnectionSubtypeKey.String("umts") - // CDMA - NetHostConnectionSubtypeCdma = NetHostConnectionSubtypeKey.String("cdma") - // EVDO Rel. 0 - NetHostConnectionSubtypeEvdo0 = NetHostConnectionSubtypeKey.String("evdo_0") - // EVDO Rev. A - NetHostConnectionSubtypeEvdoA = NetHostConnectionSubtypeKey.String("evdo_a") - // CDMA2000 1XRTT - NetHostConnectionSubtypeCdma20001xrtt = NetHostConnectionSubtypeKey.String("cdma2000_1xrtt") - // HSDPA - NetHostConnectionSubtypeHsdpa = NetHostConnectionSubtypeKey.String("hsdpa") - // HSUPA - NetHostConnectionSubtypeHsupa = NetHostConnectionSubtypeKey.String("hsupa") - // HSPA - NetHostConnectionSubtypeHspa = NetHostConnectionSubtypeKey.String("hspa") - // IDEN - NetHostConnectionSubtypeIden = NetHostConnectionSubtypeKey.String("iden") - // EVDO Rev. B - NetHostConnectionSubtypeEvdoB = NetHostConnectionSubtypeKey.String("evdo_b") - // LTE - NetHostConnectionSubtypeLte = NetHostConnectionSubtypeKey.String("lte") - // EHRPD - NetHostConnectionSubtypeEhrpd = NetHostConnectionSubtypeKey.String("ehrpd") - // HSPAP - NetHostConnectionSubtypeHspap = NetHostConnectionSubtypeKey.String("hspap") - // GSM - NetHostConnectionSubtypeGsm = NetHostConnectionSubtypeKey.String("gsm") - // TD-SCDMA - NetHostConnectionSubtypeTdScdma = NetHostConnectionSubtypeKey.String("td_scdma") - // IWLAN - NetHostConnectionSubtypeIwlan = NetHostConnectionSubtypeKey.String("iwlan") - // 5G NR (New Radio) - NetHostConnectionSubtypeNr = NetHostConnectionSubtypeKey.String("nr") - // 5G NRNSA (New Radio Non-Standalone) - NetHostConnectionSubtypeNrnsa = NetHostConnectionSubtypeKey.String("nrnsa") - // LTE CA - NetHostConnectionSubtypeLteCa = NetHostConnectionSubtypeKey.String("lte_ca") -) - -// NetAppProtocolName returns an attribute KeyValue conforming to the -// "net.app.protocol.name" semantic conventions. It represents the application -// layer protocol used. The value SHOULD be normalized to lowercase. -func NetAppProtocolName(val string) attribute.KeyValue { - return NetAppProtocolNameKey.String(val) -} - -// NetAppProtocolVersion returns an attribute KeyValue conforming to the -// "net.app.protocol.version" semantic conventions. It represents the version -// of the application layer protocol used. See note below. -func NetAppProtocolVersion(val string) attribute.KeyValue { - return NetAppProtocolVersionKey.String(val) -} - -// NetSockPeerName returns an attribute KeyValue conforming to the -// "net.sock.peer.name" semantic conventions. It represents the remote socket -// peer name. -func NetSockPeerName(val string) attribute.KeyValue { - return NetSockPeerNameKey.String(val) -} - -// NetSockPeerAddr returns an attribute KeyValue conforming to the -// "net.sock.peer.addr" semantic conventions. It represents the remote socket -// peer address: IPv4 or IPv6 for internet protocols, path for local -// communication, -// [etc](https://man7.org/linux/man-pages/man7/address_families.7.html). -func NetSockPeerAddr(val string) attribute.KeyValue { - return NetSockPeerAddrKey.String(val) -} - -// NetSockPeerPort returns an attribute KeyValue conforming to the -// "net.sock.peer.port" semantic conventions. It represents the remote socket -// peer port. -func NetSockPeerPort(val int) attribute.KeyValue { - return NetSockPeerPortKey.Int(val) -} - -// NetPeerName returns an attribute KeyValue conforming to the -// "net.peer.name" semantic conventions. It represents the logical remote -// hostname, see note below. -func NetPeerName(val string) attribute.KeyValue { - return NetPeerNameKey.String(val) -} - -// NetPeerPort returns an attribute KeyValue conforming to the -// "net.peer.port" semantic conventions. It represents the logical remote port -// number -func NetPeerPort(val int) attribute.KeyValue { - return NetPeerPortKey.Int(val) -} - -// NetHostName returns an attribute KeyValue conforming to the -// "net.host.name" semantic conventions. It represents the logical local -// hostname or similar, see note below. -func NetHostName(val string) attribute.KeyValue { - return NetHostNameKey.String(val) -} - -// NetHostPort returns an attribute KeyValue conforming to the -// "net.host.port" semantic conventions. It represents the logical local port -// number, preferably the one that the peer used to connect -func NetHostPort(val int) attribute.KeyValue { - return NetHostPortKey.Int(val) -} - -// NetSockHostAddr returns an attribute KeyValue conforming to the -// "net.sock.host.addr" semantic conventions. It represents the local socket -// address. Useful in case of a multi-IP host. -func NetSockHostAddr(val string) attribute.KeyValue { - return NetSockHostAddrKey.String(val) -} - -// NetSockHostPort returns an attribute KeyValue conforming to the -// "net.sock.host.port" semantic conventions. It represents the local socket -// port number. -func NetSockHostPort(val int) attribute.KeyValue { - return NetSockHostPortKey.Int(val) -} - -// NetHostCarrierName returns an attribute KeyValue conforming to the -// "net.host.carrier.name" semantic conventions. It represents the name of the -// mobile carrier. -func NetHostCarrierName(val string) attribute.KeyValue { - return NetHostCarrierNameKey.String(val) -} - -// NetHostCarrierMcc returns an attribute KeyValue conforming to the -// "net.host.carrier.mcc" semantic conventions. It represents the mobile -// carrier country code. -func NetHostCarrierMcc(val string) attribute.KeyValue { - return NetHostCarrierMccKey.String(val) -} - -// NetHostCarrierMnc returns an attribute KeyValue conforming to the -// "net.host.carrier.mnc" semantic conventions. It represents the mobile -// carrier network code. -func NetHostCarrierMnc(val string) attribute.KeyValue { - return NetHostCarrierMncKey.String(val) -} - -// NetHostCarrierIcc returns an attribute KeyValue conforming to the -// "net.host.carrier.icc" semantic conventions. It represents the ISO 3166-1 -// alpha-2 2-character country code associated with the mobile carrier network. -func NetHostCarrierIcc(val string) attribute.KeyValue { - return NetHostCarrierIccKey.String(val) -} - -// Operations that access some remote service. -const ( - // PeerServiceKey is the attribute Key conforming to the "peer.service" - // semantic conventions. It represents the - // [`service.name`](../../resource/semantic_conventions/README.md#service) - // of the remote service. SHOULD be equal to the actual `service.name` - // resource attribute of the remote service if any. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'AuthTokenCache' - PeerServiceKey = attribute.Key("peer.service") -) - -// PeerService returns an attribute KeyValue conforming to the -// "peer.service" semantic conventions. It represents the -// [`service.name`](../../resource/semantic_conventions/README.md#service) of -// the remote service. SHOULD be equal to the actual `service.name` resource -// attribute of the remote service if any. -func PeerService(val string) attribute.KeyValue { - return PeerServiceKey.String(val) -} - -// These attributes may be used for any operation with an authenticated and/or -// authorized enduser. -const ( - // EnduserIDKey is the attribute Key conforming to the "enduser.id" - // semantic conventions. It represents the username or client_id extracted - // from the access token or - // [Authorization](https://tools.ietf.org/html/rfc7235#section-4.2) header - // in the inbound request from outside the system. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'username' - EnduserIDKey = attribute.Key("enduser.id") - - // EnduserRoleKey is the attribute Key conforming to the "enduser.role" - // semantic conventions. It represents the actual/assumed role the client - // is making the request under extracted from token or application security - // context. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'admin' - EnduserRoleKey = attribute.Key("enduser.role") - - // EnduserScopeKey is the attribute Key conforming to the "enduser.scope" - // semantic conventions. It represents the scopes or granted authorities - // the client currently possesses extracted from token or application - // security context. The value would come from the scope associated with an - // [OAuth 2.0 Access - // Token](https://tools.ietf.org/html/rfc6749#section-3.3) or an attribute - // value in a [SAML 2.0 - // Assertion](http://docs.oasis-open.org/security/saml/Post2.0/sstc-saml-tech-overview-2.0.html). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'read:message, write:files' - EnduserScopeKey = attribute.Key("enduser.scope") -) - -// EnduserID returns an attribute KeyValue conforming to the "enduser.id" -// semantic conventions. It represents the username or client_id extracted from -// the access token or -// [Authorization](https://tools.ietf.org/html/rfc7235#section-4.2) header in -// the inbound request from outside the system. -func EnduserID(val string) attribute.KeyValue { - return EnduserIDKey.String(val) -} - -// EnduserRole returns an attribute KeyValue conforming to the -// "enduser.role" semantic conventions. It represents the actual/assumed role -// the client is making the request under extracted from token or application -// security context. -func EnduserRole(val string) attribute.KeyValue { - return EnduserRoleKey.String(val) -} - -// EnduserScope returns an attribute KeyValue conforming to the -// "enduser.scope" semantic conventions. It represents the scopes or granted -// authorities the client currently possesses extracted from token or -// application security context. The value would come from the scope associated -// with an [OAuth 2.0 Access -// Token](https://tools.ietf.org/html/rfc6749#section-3.3) or an attribute -// value in a [SAML 2.0 -// Assertion](http://docs.oasis-open.org/security/saml/Post2.0/sstc-saml-tech-overview-2.0.html). -func EnduserScope(val string) attribute.KeyValue { - return EnduserScopeKey.String(val) -} - -// These attributes may be used for any operation to store information about a -// thread that started a span. -const ( - // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic - // conventions. It represents the current "managed" thread ID (as opposed - // to OS thread ID). - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 42 - ThreadIDKey = attribute.Key("thread.id") - - // ThreadNameKey is the attribute Key conforming to the "thread.name" - // semantic conventions. It represents the current thread name. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'main' - ThreadNameKey = attribute.Key("thread.name") -) - -// ThreadID returns an attribute KeyValue conforming to the "thread.id" -// semantic conventions. It represents the current "managed" thread ID (as -// opposed to OS thread ID). -func ThreadID(val int) attribute.KeyValue { - return ThreadIDKey.Int(val) -} - -// ThreadName returns an attribute KeyValue conforming to the "thread.name" -// semantic conventions. It represents the current thread name. -func ThreadName(val string) attribute.KeyValue { - return ThreadNameKey.String(val) -} - -// These attributes allow to report this unit of code and therefore to provide -// more context about the span. -const ( - // CodeFunctionKey is the attribute Key conforming to the "code.function" - // semantic conventions. It represents the method or function name, or - // equivalent (usually rightmost part of the code unit's name). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'serveRequest' - CodeFunctionKey = attribute.Key("code.function") - - // CodeNamespaceKey is the attribute Key conforming to the "code.namespace" - // semantic conventions. It represents the "namespace" within which - // `code.function` is defined. Usually the qualified class or module name, - // such that `code.namespace` + some separator + `code.function` form a - // unique identifier for the code unit. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'com.example.MyHTTPService' - CodeNamespaceKey = attribute.Key("code.namespace") - - // CodeFilepathKey is the attribute Key conforming to the "code.filepath" - // semantic conventions. It represents the source code file name that - // identifies the code unit as uniquely as possible (preferably an absolute - // file path). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '/usr/local/MyApplication/content_root/app/index.php' - CodeFilepathKey = attribute.Key("code.filepath") - - // CodeLineNumberKey is the attribute Key conforming to the "code.lineno" - // semantic conventions. It represents the line number in `code.filepath` - // best representing the operation. It SHOULD point within the code unit - // named in `code.function`. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 42 - CodeLineNumberKey = attribute.Key("code.lineno") - - // CodeColumnKey is the attribute Key conforming to the "code.column" - // semantic conventions. It represents the column number in `code.filepath` - // best representing the operation. It SHOULD point within the code unit - // named in `code.function`. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 16 - CodeColumnKey = attribute.Key("code.column") -) - -// CodeFunction returns an attribute KeyValue conforming to the -// "code.function" semantic conventions. It represents the method or function -// name, or equivalent (usually rightmost part of the code unit's name). -func CodeFunction(val string) attribute.KeyValue { - return CodeFunctionKey.String(val) -} - -// CodeNamespace returns an attribute KeyValue conforming to the -// "code.namespace" semantic conventions. It represents the "namespace" within -// which `code.function` is defined. Usually the qualified class or module -// name, such that `code.namespace` + some separator + `code.function` form a -// unique identifier for the code unit. -func CodeNamespace(val string) attribute.KeyValue { - return CodeNamespaceKey.String(val) -} - -// CodeFilepath returns an attribute KeyValue conforming to the -// "code.filepath" semantic conventions. It represents the source code file -// name that identifies the code unit as uniquely as possible (preferably an -// absolute file path). -func CodeFilepath(val string) attribute.KeyValue { - return CodeFilepathKey.String(val) -} - -// CodeLineNumber returns an attribute KeyValue conforming to the "code.lineno" -// semantic conventions. It represents the line number in `code.filepath` best -// representing the operation. It SHOULD point within the code unit named in -// `code.function`. -func CodeLineNumber(val int) attribute.KeyValue { - return CodeLineNumberKey.Int(val) -} - -// CodeColumn returns an attribute KeyValue conforming to the "code.column" -// semantic conventions. It represents the column number in `code.filepath` -// best representing the operation. It SHOULD point within the code unit named -// in `code.function`. -func CodeColumn(val int) attribute.KeyValue { - return CodeColumnKey.Int(val) -} - -// Semantic conventions for HTTP client and server Spans. -const ( - // HTTPMethodKey is the attribute Key conforming to the "http.method" - // semantic conventions. It represents the hTTP request method. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'GET', 'POST', 'HEAD' - HTTPMethodKey = attribute.Key("http.method") - - // HTTPStatusCodeKey is the attribute Key conforming to the - // "http.status_code" semantic conventions. It represents the [HTTP - // response status code](https://tools.ietf.org/html/rfc7231#section-6). - // - // Type: int - // RequirementLevel: ConditionallyRequired (If and only if one was - // received/sent.) - // Stability: stable - // Examples: 200 - HTTPStatusCodeKey = attribute.Key("http.status_code") - - // HTTPFlavorKey is the attribute Key conforming to the "http.flavor" - // semantic conventions. It represents the kind of HTTP protocol used. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - // Note: If `net.transport` is not specified, it can be assumed to be - // `IP.TCP` except if `http.flavor` is `QUIC`, in which case `IP.UDP` is - // assumed. - HTTPFlavorKey = attribute.Key("http.flavor") - - // HTTPUserAgentKey is the attribute Key conforming to the - // "http.user_agent" semantic conventions. It represents the value of the - // [HTTP - // User-Agent](https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent) - // header sent by the client. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'CERN-LineMode/2.15 libwww/2.17b3' - HTTPUserAgentKey = attribute.Key("http.user_agent") - - // HTTPRequestContentLengthKey is the attribute Key conforming to the - // "http.request_content_length" semantic conventions. It represents the - // size of the request payload body in bytes. This is the number of bytes - // transferred excluding headers and is often, but not always, present as - // the - // [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length) - // header. For requests using transport encoding, this should be the - // compressed size. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 3495 - HTTPRequestContentLengthKey = attribute.Key("http.request_content_length") - - // HTTPResponseContentLengthKey is the attribute Key conforming to the - // "http.response_content_length" semantic conventions. It represents the - // size of the response payload body in bytes. This is the number of bytes - // transferred excluding headers and is often, but not always, present as - // the - // [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length) - // header. For requests using transport encoding, this should be the - // compressed size. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 3495 - HTTPResponseContentLengthKey = attribute.Key("http.response_content_length") -) - -var ( - // HTTP/1.0 - HTTPFlavorHTTP10 = HTTPFlavorKey.String("1.0") - // HTTP/1.1 - HTTPFlavorHTTP11 = HTTPFlavorKey.String("1.1") - // HTTP/2 - HTTPFlavorHTTP20 = HTTPFlavorKey.String("2.0") - // HTTP/3 - HTTPFlavorHTTP30 = HTTPFlavorKey.String("3.0") - // SPDY protocol - HTTPFlavorSPDY = HTTPFlavorKey.String("SPDY") - // QUIC protocol - HTTPFlavorQUIC = HTTPFlavorKey.String("QUIC") -) - -// HTTPMethod returns an attribute KeyValue conforming to the "http.method" -// semantic conventions. It represents the hTTP request method. -func HTTPMethod(val string) attribute.KeyValue { - return HTTPMethodKey.String(val) -} - -// HTTPStatusCode returns an attribute KeyValue conforming to the -// "http.status_code" semantic conventions. It represents the [HTTP response -// status code](https://tools.ietf.org/html/rfc7231#section-6). -func HTTPStatusCode(val int) attribute.KeyValue { - return HTTPStatusCodeKey.Int(val) -} - -// HTTPUserAgent returns an attribute KeyValue conforming to the -// "http.user_agent" semantic conventions. It represents the value of the [HTTP -// User-Agent](https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent) -// header sent by the client. -func HTTPUserAgent(val string) attribute.KeyValue { - return HTTPUserAgentKey.String(val) -} - -// HTTPRequestContentLength returns an attribute KeyValue conforming to the -// "http.request_content_length" semantic conventions. It represents the size -// of the request payload body in bytes. This is the number of bytes -// transferred excluding headers and is often, but not always, present as the -// [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length) -// header. For requests using transport encoding, this should be the compressed -// size. -func HTTPRequestContentLength(val int) attribute.KeyValue { - return HTTPRequestContentLengthKey.Int(val) -} - -// HTTPResponseContentLength returns an attribute KeyValue conforming to the -// "http.response_content_length" semantic conventions. It represents the size -// of the response payload body in bytes. This is the number of bytes -// transferred excluding headers and is often, but not always, present as the -// [Content-Length](https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length) -// header. For requests using transport encoding, this should be the compressed -// size. -func HTTPResponseContentLength(val int) attribute.KeyValue { - return HTTPResponseContentLengthKey.Int(val) -} - -// Semantic Convention for HTTP Client -const ( - // HTTPURLKey is the attribute Key conforming to the "http.url" semantic - // conventions. It represents the full HTTP request URL in the form - // `scheme://host[:port]/path?query[#fragment]`. Usually the fragment is - // not transmitted over HTTP, but if it is known, it should be included - // nevertheless. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'https://www.foo.bar/search?q=OpenTelemetry#SemConv' - // Note: `http.url` MUST NOT contain credentials passed via URL in form of - // `https://username:password@www.example.com/`. In such case the - // attribute's value should be `https://www.example.com/`. - HTTPURLKey = attribute.Key("http.url") - - // HTTPResendCountKey is the attribute Key conforming to the - // "http.resend_count" semantic conventions. It represents the ordinal - // number of request resending attempt (for any reason, including - // redirects). - // - // Type: int - // RequirementLevel: Recommended (if and only if request was retried.) - // Stability: stable - // Examples: 3 - // Note: The resend count SHOULD be updated each time an HTTP request gets - // resent by the client, regardless of what was the cause of the resending - // (e.g. redirection, authorization failure, 503 Server Unavailable, - // network issues, or any other). - HTTPResendCountKey = attribute.Key("http.resend_count") -) - -// HTTPURL returns an attribute KeyValue conforming to the "http.url" -// semantic conventions. It represents the full HTTP request URL in the form -// `scheme://host[:port]/path?query[#fragment]`. Usually the fragment is not -// transmitted over HTTP, but if it is known, it should be included -// nevertheless. -func HTTPURL(val string) attribute.KeyValue { - return HTTPURLKey.String(val) -} - -// HTTPResendCount returns an attribute KeyValue conforming to the -// "http.resend_count" semantic conventions. It represents the ordinal number -// of request resending attempt (for any reason, including redirects). -func HTTPResendCount(val int) attribute.KeyValue { - return HTTPResendCountKey.Int(val) -} - -// Semantic Convention for HTTP Server -const ( - // HTTPSchemeKey is the attribute Key conforming to the "http.scheme" - // semantic conventions. It represents the URI scheme identifying the used - // protocol. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'http', 'https' - HTTPSchemeKey = attribute.Key("http.scheme") - - // HTTPTargetKey is the attribute Key conforming to the "http.target" - // semantic conventions. It represents the full request target as passed in - // a HTTP request line or equivalent. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: '/path/12314/?q=ddds' - HTTPTargetKey = attribute.Key("http.target") - - // HTTPRouteKey is the attribute Key conforming to the "http.route" - // semantic conventions. It represents the matched route (path template in - // the format used by the respective server framework). See note below - // - // Type: string - // RequirementLevel: ConditionallyRequired (If and only if it's available) - // Stability: stable - // Examples: '/users/:userID?', '{controller}/{action}/{id?}' - // Note: 'http.route' MUST NOT be populated when this is not supported by - // the HTTP server framework as the route attribute should have - // low-cardinality and the URI path can NOT substitute it. - HTTPRouteKey = attribute.Key("http.route") - - // HTTPClientIPKey is the attribute Key conforming to the "http.client_ip" - // semantic conventions. It represents the IP address of the original - // client behind all proxies, if known (e.g. from - // [X-Forwarded-For](https://developer.mozilla.org/en-US/docs/Web/HTTP/Headers/X-Forwarded-For)). - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '83.164.160.102' - // Note: This is not necessarily the same as `net.sock.peer.addr`, which - // would - // identify the network-level peer, which may be a proxy. - // - // This attribute should be set when a source of information different - // from the one used for `net.sock.peer.addr`, is available even if that - // other - // source just confirms the same value as `net.sock.peer.addr`. - // Rationale: For `net.sock.peer.addr`, one typically does not know if it - // comes from a proxy, reverse proxy, or the actual client. Setting - // `http.client_ip` when it's the same as `net.sock.peer.addr` means that - // one is at least somewhat confident that the address is not that of - // the closest proxy. - HTTPClientIPKey = attribute.Key("http.client_ip") -) - -// HTTPScheme returns an attribute KeyValue conforming to the "http.scheme" -// semantic conventions. It represents the URI scheme identifying the used -// protocol. -func HTTPScheme(val string) attribute.KeyValue { - return HTTPSchemeKey.String(val) -} - -// HTTPTarget returns an attribute KeyValue conforming to the "http.target" -// semantic conventions. It represents the full request target as passed in a -// HTTP request line or equivalent. -func HTTPTarget(val string) attribute.KeyValue { - return HTTPTargetKey.String(val) -} - -// HTTPRoute returns an attribute KeyValue conforming to the "http.route" -// semantic conventions. It represents the matched route (path template in the -// format used by the respective server framework). See note below -func HTTPRoute(val string) attribute.KeyValue { - return HTTPRouteKey.String(val) -} - -// HTTPClientIP returns an attribute KeyValue conforming to the -// "http.client_ip" semantic conventions. It represents the IP address of the -// original client behind all proxies, if known (e.g. from -// [X-Forwarded-For](https://developer.mozilla.org/en-US/docs/Web/HTTP/Headers/X-Forwarded-For)). -func HTTPClientIP(val string) attribute.KeyValue { - return HTTPClientIPKey.String(val) -} - -// Attributes that exist for multiple DynamoDB request types. -const ( - // AWSDynamoDBTableNamesKey is the attribute Key conforming to the - // "aws.dynamodb.table_names" semantic conventions. It represents the keys - // in the `RequestItems` object field. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Users', 'Cats' - AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names") - - // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the - // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the - // JSON-serialized value of each item in the `ConsumedCapacity` response - // field. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: '{ "CapacityUnits": number, "GlobalSecondaryIndexes": { - // "string" : { "CapacityUnits": number, "ReadCapacityUnits": number, - // "WriteCapacityUnits": number } }, "LocalSecondaryIndexes": { "string" : - // { "CapacityUnits": number, "ReadCapacityUnits": number, - // "WriteCapacityUnits": number } }, "ReadCapacityUnits": number, "Table": - // { "CapacityUnits": number, "ReadCapacityUnits": number, - // "WriteCapacityUnits": number }, "TableName": "string", - // "WriteCapacityUnits": number }' - AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity") - - // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to - // the "aws.dynamodb.item_collection_metrics" semantic conventions. It - // represents the JSON-serialized value of the `ItemCollectionMetrics` - // response field. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '{ "string" : [ { "ItemCollectionKey": { "string" : { "B": - // blob, "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": { - // "string" : "AttributeValue" }, "N": "string", "NS": [ "string" ], - // "NULL": boolean, "S": "string", "SS": [ "string" ] } }, - // "SizeEstimateRangeGB": [ number ] } ] }' - AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics") - - // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to - // the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It - // represents the value of the `ProvisionedThroughput.ReadCapacityUnits` - // request parameter. - // - // Type: double - // RequirementLevel: Optional - // Stability: stable - // Examples: 1.0, 2.0 - AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity") - - // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming - // to the "aws.dynamodb.provisioned_write_capacity" semantic conventions. - // It represents the value of the - // `ProvisionedThroughput.WriteCapacityUnits` request parameter. - // - // Type: double - // RequirementLevel: Optional - // Stability: stable - // Examples: 1.0, 2.0 - AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity") - - // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the - // "aws.dynamodb.consistent_read" semantic conventions. It represents the - // value of the `ConsistentRead` request parameter. - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read") - - // AWSDynamoDBProjectionKey is the attribute Key conforming to the - // "aws.dynamodb.projection" semantic conventions. It represents the value - // of the `ProjectionExpression` request parameter. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Title', 'Title, Price, Color', 'Title, Description, - // RelatedItems, ProductReviews' - AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection") - - // AWSDynamoDBLimitKey is the attribute Key conforming to the - // "aws.dynamodb.limit" semantic conventions. It represents the value of - // the `Limit` request parameter. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 10 - AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit") - - // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the - // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the - // value of the `AttributesToGet` request parameter. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: 'lives', 'id' - AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get") - - // AWSDynamoDBIndexNameKey is the attribute Key conforming to the - // "aws.dynamodb.index_name" semantic conventions. It represents the value - // of the `IndexName` request parameter. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'name_to_group' - AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name") - - // AWSDynamoDBSelectKey is the attribute Key conforming to the - // "aws.dynamodb.select" semantic conventions. It represents the value of - // the `Select` request parameter. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'ALL_ATTRIBUTES', 'COUNT' - AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select") -) - -// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the -// "aws.dynamodb.table_names" semantic conventions. It represents the keys in -// the `RequestItems` object field. -func AWSDynamoDBTableNames(val ...string) attribute.KeyValue { - return AWSDynamoDBTableNamesKey.StringSlice(val) -} - -// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to -// the "aws.dynamodb.consumed_capacity" semantic conventions. It represents the -// JSON-serialized value of each item in the `ConsumedCapacity` response field. -func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue { - return AWSDynamoDBConsumedCapacityKey.StringSlice(val) -} - -// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming -// to the "aws.dynamodb.item_collection_metrics" semantic conventions. It -// represents the JSON-serialized value of the `ItemCollectionMetrics` response -// field. -func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue { - return AWSDynamoDBItemCollectionMetricsKey.String(val) -} - -// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue -// conforming to the "aws.dynamodb.provisioned_read_capacity" semantic -// conventions. It represents the value of the -// `ProvisionedThroughput.ReadCapacityUnits` request parameter. -func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue { - return AWSDynamoDBProvisionedReadCapacityKey.Float64(val) -} - -// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue -// conforming to the "aws.dynamodb.provisioned_write_capacity" semantic -// conventions. It represents the value of the -// `ProvisionedThroughput.WriteCapacityUnits` request parameter. -func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue { - return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val) -} - -// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the -// "aws.dynamodb.consistent_read" semantic conventions. It represents the value -// of the `ConsistentRead` request parameter. -func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue { - return AWSDynamoDBConsistentReadKey.Bool(val) -} - -// AWSDynamoDBProjection returns an attribute KeyValue conforming to the -// "aws.dynamodb.projection" semantic conventions. It represents the value of -// the `ProjectionExpression` request parameter. -func AWSDynamoDBProjection(val string) attribute.KeyValue { - return AWSDynamoDBProjectionKey.String(val) -} - -// AWSDynamoDBLimit returns an attribute KeyValue conforming to the -// "aws.dynamodb.limit" semantic conventions. It represents the value of the -// `Limit` request parameter. -func AWSDynamoDBLimit(val int) attribute.KeyValue { - return AWSDynamoDBLimitKey.Int(val) -} - -// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to -// the "aws.dynamodb.attributes_to_get" semantic conventions. It represents the -// value of the `AttributesToGet` request parameter. -func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue { - return AWSDynamoDBAttributesToGetKey.StringSlice(val) -} - -// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the -// "aws.dynamodb.index_name" semantic conventions. It represents the value of -// the `IndexName` request parameter. -func AWSDynamoDBIndexName(val string) attribute.KeyValue { - return AWSDynamoDBIndexNameKey.String(val) -} - -// AWSDynamoDBSelect returns an attribute KeyValue conforming to the -// "aws.dynamodb.select" semantic conventions. It represents the value of the -// `Select` request parameter. -func AWSDynamoDBSelect(val string) attribute.KeyValue { - return AWSDynamoDBSelectKey.String(val) -} - -// DynamoDB.CreateTable -const ( - // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to - // the "aws.dynamodb.global_secondary_indexes" semantic conventions. It - // represents the JSON-serialized value of each item of the - // `GlobalSecondaryIndexes` request field - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: '{ "IndexName": "string", "KeySchema": [ { "AttributeName": - // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ - // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": { - // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }' - AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes") - - // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to - // the "aws.dynamodb.local_secondary_indexes" semantic conventions. It - // represents the JSON-serialized value of each item of the - // `LocalSecondaryIndexes` request field. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: '{ "IndexARN": "string", "IndexName": "string", - // "IndexSizeBytes": number, "ItemCount": number, "KeySchema": [ { - // "AttributeName": "string", "KeyType": "string" } ], "Projection": { - // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" } }' - AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes") -) - -// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue -// conforming to the "aws.dynamodb.global_secondary_indexes" semantic -// conventions. It represents the JSON-serialized value of each item of the -// `GlobalSecondaryIndexes` request field -func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue { - return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val) -} - -// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming -// to the "aws.dynamodb.local_secondary_indexes" semantic conventions. It -// represents the JSON-serialized value of each item of the -// `LocalSecondaryIndexes` request field. -func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue { - return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val) -} - -// DynamoDB.ListTables -const ( - // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the - // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents - // the value of the `ExclusiveStartTableName` request parameter. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Users', 'CatsTable' - AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table") - - // AWSDynamoDBTableCountKey is the attribute Key conforming to the - // "aws.dynamodb.table_count" semantic conventions. It represents the the - // number of items in the `TableNames` response parameter. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 20 - AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count") -) - -// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming -// to the "aws.dynamodb.exclusive_start_table" semantic conventions. It -// represents the value of the `ExclusiveStartTableName` request parameter. -func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue { - return AWSDynamoDBExclusiveStartTableKey.String(val) -} - -// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the -// "aws.dynamodb.table_count" semantic conventions. It represents the the -// number of items in the `TableNames` response parameter. -func AWSDynamoDBTableCount(val int) attribute.KeyValue { - return AWSDynamoDBTableCountKey.Int(val) -} - -// DynamoDB.Query -const ( - // AWSDynamoDBScanForwardKey is the attribute Key conforming to the - // "aws.dynamodb.scan_forward" semantic conventions. It represents the - // value of the `ScanIndexForward` request parameter. - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward") -) - -// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the -// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of -// the `ScanIndexForward` request parameter. -func AWSDynamoDBScanForward(val bool) attribute.KeyValue { - return AWSDynamoDBScanForwardKey.Bool(val) -} - -// DynamoDB.Scan -const ( - // AWSDynamoDBSegmentKey is the attribute Key conforming to the - // "aws.dynamodb.segment" semantic conventions. It represents the value of - // the `Segment` request parameter. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 10 - AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment") - - // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the - // "aws.dynamodb.total_segments" semantic conventions. It represents the - // value of the `TotalSegments` request parameter. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 100 - AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments") - - // AWSDynamoDBCountKey is the attribute Key conforming to the - // "aws.dynamodb.count" semantic conventions. It represents the value of - // the `Count` response parameter. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 10 - AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count") - - // AWSDynamoDBScannedCountKey is the attribute Key conforming to the - // "aws.dynamodb.scanned_count" semantic conventions. It represents the - // value of the `ScannedCount` response parameter. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 50 - AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count") -) - -// AWSDynamoDBSegment returns an attribute KeyValue conforming to the -// "aws.dynamodb.segment" semantic conventions. It represents the value of the -// `Segment` request parameter. -func AWSDynamoDBSegment(val int) attribute.KeyValue { - return AWSDynamoDBSegmentKey.Int(val) -} - -// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the -// "aws.dynamodb.total_segments" semantic conventions. It represents the value -// of the `TotalSegments` request parameter. -func AWSDynamoDBTotalSegments(val int) attribute.KeyValue { - return AWSDynamoDBTotalSegmentsKey.Int(val) -} - -// AWSDynamoDBCount returns an attribute KeyValue conforming to the -// "aws.dynamodb.count" semantic conventions. It represents the value of the -// `Count` response parameter. -func AWSDynamoDBCount(val int) attribute.KeyValue { - return AWSDynamoDBCountKey.Int(val) -} - -// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the -// "aws.dynamodb.scanned_count" semantic conventions. It represents the value -// of the `ScannedCount` response parameter. -func AWSDynamoDBScannedCount(val int) attribute.KeyValue { - return AWSDynamoDBScannedCountKey.Int(val) -} - -// DynamoDB.UpdateTable -const ( - // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to - // the "aws.dynamodb.attribute_definitions" semantic conventions. It - // represents the JSON-serialized value of each item in the - // `AttributeDefinitions` request field. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: '{ "AttributeName": "string", "AttributeType": "string" }' - AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions") - - // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key - // conforming to the "aws.dynamodb.global_secondary_index_updates" semantic - // conventions. It represents the JSON-serialized value of each item in the - // the `GlobalSecondaryIndexUpdates` request field. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: '{ "Create": { "IndexName": "string", "KeySchema": [ { - // "AttributeName": "string", "KeyType": "string" } ], "Projection": { - // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" }, - // "ProvisionedThroughput": { "ReadCapacityUnits": number, - // "WriteCapacityUnits": number } }' - AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates") -) - -// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming -// to the "aws.dynamodb.attribute_definitions" semantic conventions. It -// represents the JSON-serialized value of each item in the -// `AttributeDefinitions` request field. -func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue { - return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val) -} - -// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue -// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic -// conventions. It represents the JSON-serialized value of each item in the the -// `GlobalSecondaryIndexUpdates` request field. -func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue { - return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val) -} - -// Semantic conventions to apply when instrumenting the GraphQL implementation. -// They map GraphQL operations to attributes on a Span. -const ( - // GraphqlOperationNameKey is the attribute Key conforming to the - // "graphql.operation.name" semantic conventions. It represents the name of - // the operation being executed. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'findBookByID' - GraphqlOperationNameKey = attribute.Key("graphql.operation.name") - - // GraphqlOperationTypeKey is the attribute Key conforming to the - // "graphql.operation.type" semantic conventions. It represents the type of - // the operation being executed. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - // Examples: 'query', 'mutation', 'subscription' - GraphqlOperationTypeKey = attribute.Key("graphql.operation.type") - - // GraphqlDocumentKey is the attribute Key conforming to the - // "graphql.document" semantic conventions. It represents the GraphQL - // document being executed. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'query findBookByID { bookByID(id: ?) { name } }' - // Note: The value may be sanitized to exclude sensitive information. - GraphqlDocumentKey = attribute.Key("graphql.document") -) - -var ( - // GraphQL query - GraphqlOperationTypeQuery = GraphqlOperationTypeKey.String("query") - // GraphQL mutation - GraphqlOperationTypeMutation = GraphqlOperationTypeKey.String("mutation") - // GraphQL subscription - GraphqlOperationTypeSubscription = GraphqlOperationTypeKey.String("subscription") -) - -// GraphqlOperationName returns an attribute KeyValue conforming to the -// "graphql.operation.name" semantic conventions. It represents the name of the -// operation being executed. -func GraphqlOperationName(val string) attribute.KeyValue { - return GraphqlOperationNameKey.String(val) -} - -// GraphqlDocument returns an attribute KeyValue conforming to the -// "graphql.document" semantic conventions. It represents the GraphQL document -// being executed. -func GraphqlDocument(val string) attribute.KeyValue { - return GraphqlDocumentKey.String(val) -} - -// Semantic convention describing per-message attributes populated on messaging -// spans or links. -const ( - // MessagingMessageIDKey is the attribute Key conforming to the - // "messaging.message.id" semantic conventions. It represents a value used - // by the messaging system as an identifier for the message, represented as - // a string. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '452a7c7c7c7048c2f887f61572b18fc2' - MessagingMessageIDKey = attribute.Key("messaging.message.id") - - // MessagingMessageConversationIDKey is the attribute Key conforming to the - // "messaging.message.conversation_id" semantic conventions. It represents - // the [conversation ID](#conversations) identifying the conversation to - // which the message belongs, represented as a string. Sometimes called - // "Correlation ID". - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'MyConversationID' - MessagingMessageConversationIDKey = attribute.Key("messaging.message.conversation_id") - - // MessagingMessagePayloadSizeBytesKey is the attribute Key conforming to - // the "messaging.message.payload_size_bytes" semantic conventions. It - // represents the (uncompressed) size of the message payload in bytes. Also - // use this attribute if it is unknown whether the compressed or - // uncompressed payload size is reported. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 2738 - MessagingMessagePayloadSizeBytesKey = attribute.Key("messaging.message.payload_size_bytes") - - // MessagingMessagePayloadCompressedSizeBytesKey is the attribute Key - // conforming to the "messaging.message.payload_compressed_size_bytes" - // semantic conventions. It represents the compressed size of the message - // payload in bytes. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 2048 - MessagingMessagePayloadCompressedSizeBytesKey = attribute.Key("messaging.message.payload_compressed_size_bytes") -) - -// MessagingMessageID returns an attribute KeyValue conforming to the -// "messaging.message.id" semantic conventions. It represents a value used by -// the messaging system as an identifier for the message, represented as a -// string. -func MessagingMessageID(val string) attribute.KeyValue { - return MessagingMessageIDKey.String(val) -} - -// MessagingMessageConversationID returns an attribute KeyValue conforming -// to the "messaging.message.conversation_id" semantic conventions. It -// represents the [conversation ID](#conversations) identifying the -// conversation to which the message belongs, represented as a string. -// Sometimes called "Correlation ID". -func MessagingMessageConversationID(val string) attribute.KeyValue { - return MessagingMessageConversationIDKey.String(val) -} - -// MessagingMessagePayloadSizeBytes returns an attribute KeyValue conforming -// to the "messaging.message.payload_size_bytes" semantic conventions. It -// represents the (uncompressed) size of the message payload in bytes. Also use -// this attribute if it is unknown whether the compressed or uncompressed -// payload size is reported. -func MessagingMessagePayloadSizeBytes(val int) attribute.KeyValue { - return MessagingMessagePayloadSizeBytesKey.Int(val) -} - -// MessagingMessagePayloadCompressedSizeBytes returns an attribute KeyValue -// conforming to the "messaging.message.payload_compressed_size_bytes" semantic -// conventions. It represents the compressed size of the message payload in -// bytes. -func MessagingMessagePayloadCompressedSizeBytes(val int) attribute.KeyValue { - return MessagingMessagePayloadCompressedSizeBytesKey.Int(val) -} - -// Semantic convention for attributes that describe messaging destination on -// broker -const ( - // MessagingDestinationNameKey is the attribute Key conforming to the - // "messaging.destination.name" semantic conventions. It represents the - // message destination name - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'MyQueue', 'MyTopic' - // Note: Destination name SHOULD uniquely identify a specific queue, topic - // or other entity within the broker. If - // the broker does not have such notion, the destination name SHOULD - // uniquely identify the broker. - MessagingDestinationNameKey = attribute.Key("messaging.destination.name") - - // MessagingDestinationKindKey is the attribute Key conforming to the - // "messaging.destination.kind" semantic conventions. It represents the - // kind of message destination - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - MessagingDestinationKindKey = attribute.Key("messaging.destination.kind") - - // MessagingDestinationTemplateKey is the attribute Key conforming to the - // "messaging.destination.template" semantic conventions. It represents the - // low cardinality representation of the messaging destination name - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '/customers/{customerID}' - // Note: Destination names could be constructed from templates. An example - // would be a destination name involving a user name or product id. - // Although the destination name in this case is of high cardinality, the - // underlying template is of low cardinality and can be effectively used - // for grouping and aggregation. - MessagingDestinationTemplateKey = attribute.Key("messaging.destination.template") - - // MessagingDestinationTemporaryKey is the attribute Key conforming to the - // "messaging.destination.temporary" semantic conventions. It represents a - // boolean that is true if the message destination is temporary and might - // not exist anymore after messages are processed. - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - MessagingDestinationTemporaryKey = attribute.Key("messaging.destination.temporary") - - // MessagingDestinationAnonymousKey is the attribute Key conforming to the - // "messaging.destination.anonymous" semantic conventions. It represents a - // boolean that is true if the message destination is anonymous (could be - // unnamed or have auto-generated name). - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - MessagingDestinationAnonymousKey = attribute.Key("messaging.destination.anonymous") -) - -var ( - // A message sent to a queue - MessagingDestinationKindQueue = MessagingDestinationKindKey.String("queue") - // A message sent to a topic - MessagingDestinationKindTopic = MessagingDestinationKindKey.String("topic") -) - -// MessagingDestinationName returns an attribute KeyValue conforming to the -// "messaging.destination.name" semantic conventions. It represents the message -// destination name -func MessagingDestinationName(val string) attribute.KeyValue { - return MessagingDestinationNameKey.String(val) -} - -// MessagingDestinationTemplate returns an attribute KeyValue conforming to -// the "messaging.destination.template" semantic conventions. It represents the -// low cardinality representation of the messaging destination name -func MessagingDestinationTemplate(val string) attribute.KeyValue { - return MessagingDestinationTemplateKey.String(val) -} - -// MessagingDestinationTemporary returns an attribute KeyValue conforming to -// the "messaging.destination.temporary" semantic conventions. It represents a -// boolean that is true if the message destination is temporary and might not -// exist anymore after messages are processed. -func MessagingDestinationTemporary(val bool) attribute.KeyValue { - return MessagingDestinationTemporaryKey.Bool(val) -} - -// MessagingDestinationAnonymous returns an attribute KeyValue conforming to -// the "messaging.destination.anonymous" semantic conventions. It represents a -// boolean that is true if the message destination is anonymous (could be -// unnamed or have auto-generated name). -func MessagingDestinationAnonymous(val bool) attribute.KeyValue { - return MessagingDestinationAnonymousKey.Bool(val) -} - -// Semantic convention for attributes that describe messaging source on broker -const ( - // MessagingSourceNameKey is the attribute Key conforming to the - // "messaging.source.name" semantic conventions. It represents the message - // source name - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'MyQueue', 'MyTopic' - // Note: Source name SHOULD uniquely identify a specific queue, topic, or - // other entity within the broker. If - // the broker does not have such notion, the source name SHOULD uniquely - // identify the broker. - MessagingSourceNameKey = attribute.Key("messaging.source.name") - - // MessagingSourceKindKey is the attribute Key conforming to the - // "messaging.source.kind" semantic conventions. It represents the kind of - // message source - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - MessagingSourceKindKey = attribute.Key("messaging.source.kind") - - // MessagingSourceTemplateKey is the attribute Key conforming to the - // "messaging.source.template" semantic conventions. It represents the low - // cardinality representation of the messaging source name - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '/customers/{customerID}' - // Note: Source names could be constructed from templates. An example would - // be a source name involving a user name or product id. Although the - // source name in this case is of high cardinality, the underlying template - // is of low cardinality and can be effectively used for grouping and - // aggregation. - MessagingSourceTemplateKey = attribute.Key("messaging.source.template") - - // MessagingSourceTemporaryKey is the attribute Key conforming to the - // "messaging.source.temporary" semantic conventions. It represents a - // boolean that is true if the message source is temporary and might not - // exist anymore after messages are processed. - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - MessagingSourceTemporaryKey = attribute.Key("messaging.source.temporary") - - // MessagingSourceAnonymousKey is the attribute Key conforming to the - // "messaging.source.anonymous" semantic conventions. It represents a - // boolean that is true if the message source is anonymous (could be - // unnamed or have auto-generated name). - // - // Type: boolean - // RequirementLevel: Optional - // Stability: stable - MessagingSourceAnonymousKey = attribute.Key("messaging.source.anonymous") -) - -var ( - // A message received from a queue - MessagingSourceKindQueue = MessagingSourceKindKey.String("queue") - // A message received from a topic - MessagingSourceKindTopic = MessagingSourceKindKey.String("topic") -) - -// MessagingSourceName returns an attribute KeyValue conforming to the -// "messaging.source.name" semantic conventions. It represents the message -// source name -func MessagingSourceName(val string) attribute.KeyValue { - return MessagingSourceNameKey.String(val) -} - -// MessagingSourceTemplate returns an attribute KeyValue conforming to the -// "messaging.source.template" semantic conventions. It represents the low -// cardinality representation of the messaging source name -func MessagingSourceTemplate(val string) attribute.KeyValue { - return MessagingSourceTemplateKey.String(val) -} - -// MessagingSourceTemporary returns an attribute KeyValue conforming to the -// "messaging.source.temporary" semantic conventions. It represents a boolean -// that is true if the message source is temporary and might not exist anymore -// after messages are processed. -func MessagingSourceTemporary(val bool) attribute.KeyValue { - return MessagingSourceTemporaryKey.Bool(val) -} - -// MessagingSourceAnonymous returns an attribute KeyValue conforming to the -// "messaging.source.anonymous" semantic conventions. It represents a boolean -// that is true if the message source is anonymous (could be unnamed or have -// auto-generated name). -func MessagingSourceAnonymous(val bool) attribute.KeyValue { - return MessagingSourceAnonymousKey.Bool(val) -} - -// General attributes used in messaging systems. -const ( - // MessagingSystemKey is the attribute Key conforming to the - // "messaging.system" semantic conventions. It represents a string - // identifying the messaging system. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'kafka', 'rabbitmq', 'rocketmq', 'activemq', 'AmazonSQS' - MessagingSystemKey = attribute.Key("messaging.system") - - // MessagingOperationKey is the attribute Key conforming to the - // "messaging.operation" semantic conventions. It represents a string - // identifying the kind of messaging operation as defined in the [Operation - // names](#operation-names) section above. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - // Note: If a custom value is used, it MUST be of low cardinality. - MessagingOperationKey = attribute.Key("messaging.operation") - - // MessagingBatchMessageCountKey is the attribute Key conforming to the - // "messaging.batch.message_count" semantic conventions. It represents the - // number of messages sent, received, or processed in the scope of the - // batching operation. - // - // Type: int - // RequirementLevel: ConditionallyRequired (If the span describes an - // operation on a batch of messages.) - // Stability: stable - // Examples: 0, 1, 2 - // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on - // spans that operate with a single message. When a messaging client - // library supports both batch and single-message API for the same - // operation, instrumentations SHOULD use `messaging.batch.message_count` - // for batching APIs and SHOULD NOT use it for single-message APIs. - MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count") -) - -var ( - // publish - MessagingOperationPublish = MessagingOperationKey.String("publish") - // receive - MessagingOperationReceive = MessagingOperationKey.String("receive") - // process - MessagingOperationProcess = MessagingOperationKey.String("process") -) - -// MessagingSystem returns an attribute KeyValue conforming to the -// "messaging.system" semantic conventions. It represents a string identifying -// the messaging system. -func MessagingSystem(val string) attribute.KeyValue { - return MessagingSystemKey.String(val) -} - -// MessagingBatchMessageCount returns an attribute KeyValue conforming to -// the "messaging.batch.message_count" semantic conventions. It represents the -// number of messages sent, received, or processed in the scope of the batching -// operation. -func MessagingBatchMessageCount(val int) attribute.KeyValue { - return MessagingBatchMessageCountKey.Int(val) -} - -// Semantic convention for a consumer of messages received from a messaging -// system -const ( - // MessagingConsumerIDKey is the attribute Key conforming to the - // "messaging.consumer.id" semantic conventions. It represents the - // identifier for the consumer receiving a message. For Kafka, set it to - // `{messaging.kafka.consumer.group} - {messaging.kafka.client_id}`, if - // both are present, or only `messaging.kafka.consumer.group`. For brokers, - // such as RabbitMQ and Artemis, set it to the `client_id` of the client - // consuming the message. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'mygroup - client-6' - MessagingConsumerIDKey = attribute.Key("messaging.consumer.id") -) - -// MessagingConsumerID returns an attribute KeyValue conforming to the -// "messaging.consumer.id" semantic conventions. It represents the identifier -// for the consumer receiving a message. For Kafka, set it to -// `{messaging.kafka.consumer.group} - {messaging.kafka.client_id}`, if both -// are present, or only `messaging.kafka.consumer.group`. For brokers, such as -// RabbitMQ and Artemis, set it to the `client_id` of the client consuming the -// message. -func MessagingConsumerID(val string) attribute.KeyValue { - return MessagingConsumerIDKey.String(val) -} - -// Attributes for RabbitMQ -const ( - // MessagingRabbitmqDestinationRoutingKeyKey is the attribute Key - // conforming to the "messaging.rabbitmq.destination.routing_key" semantic - // conventions. It represents the rabbitMQ message routing key. - // - // Type: string - // RequirementLevel: ConditionallyRequired (If not empty.) - // Stability: stable - // Examples: 'myKey' - MessagingRabbitmqDestinationRoutingKeyKey = attribute.Key("messaging.rabbitmq.destination.routing_key") -) - -// MessagingRabbitmqDestinationRoutingKey returns an attribute KeyValue -// conforming to the "messaging.rabbitmq.destination.routing_key" semantic -// conventions. It represents the rabbitMQ message routing key. -func MessagingRabbitmqDestinationRoutingKey(val string) attribute.KeyValue { - return MessagingRabbitmqDestinationRoutingKeyKey.String(val) -} - -// Attributes for Apache Kafka -const ( - // MessagingKafkaMessageKeyKey is the attribute Key conforming to the - // "messaging.kafka.message.key" semantic conventions. It represents the - // message keys in Kafka are used for grouping alike messages to ensure - // they're processed on the same partition. They differ from - // `messaging.message.id` in that they're not unique. If the key is `null`, - // the attribute MUST NOT be set. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'myKey' - // Note: If the key type is not string, it's string representation has to - // be supplied for the attribute. If the key has no unambiguous, canonical - // string form, don't include its value. - MessagingKafkaMessageKeyKey = attribute.Key("messaging.kafka.message.key") - - // MessagingKafkaConsumerGroupKey is the attribute Key conforming to the - // "messaging.kafka.consumer.group" semantic conventions. It represents the - // name of the Kafka Consumer Group that is handling the message. Only - // applies to consumers, not producers. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'my-group' - MessagingKafkaConsumerGroupKey = attribute.Key("messaging.kafka.consumer.group") - - // MessagingKafkaClientIDKey is the attribute Key conforming to the - // "messaging.kafka.client_id" semantic conventions. It represents the - // client ID for the Consumer or Producer that is handling the message. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'client-5' - MessagingKafkaClientIDKey = attribute.Key("messaging.kafka.client_id") - - // MessagingKafkaDestinationPartitionKey is the attribute Key conforming to - // the "messaging.kafka.destination.partition" semantic conventions. It - // represents the partition the message is sent to. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 2 - MessagingKafkaDestinationPartitionKey = attribute.Key("messaging.kafka.destination.partition") - - // MessagingKafkaSourcePartitionKey is the attribute Key conforming to the - // "messaging.kafka.source.partition" semantic conventions. It represents - // the partition the message is received from. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 2 - MessagingKafkaSourcePartitionKey = attribute.Key("messaging.kafka.source.partition") - - // MessagingKafkaMessageOffsetKey is the attribute Key conforming to the - // "messaging.kafka.message.offset" semantic conventions. It represents the - // offset of a record in the corresponding Kafka partition. - // - // Type: int - // RequirementLevel: Optional - // Stability: stable - // Examples: 42 - MessagingKafkaMessageOffsetKey = attribute.Key("messaging.kafka.message.offset") - - // MessagingKafkaMessageTombstoneKey is the attribute Key conforming to the - // "messaging.kafka.message.tombstone" semantic conventions. It represents - // a boolean that is true if the message is a tombstone. - // - // Type: boolean - // RequirementLevel: ConditionallyRequired (If value is `true`. When - // missing, the value is assumed to be `false`.) - // Stability: stable - MessagingKafkaMessageTombstoneKey = attribute.Key("messaging.kafka.message.tombstone") -) - -// MessagingKafkaMessageKey returns an attribute KeyValue conforming to the -// "messaging.kafka.message.key" semantic conventions. It represents the -// message keys in Kafka are used for grouping alike messages to ensure they're -// processed on the same partition. They differ from `messaging.message.id` in -// that they're not unique. If the key is `null`, the attribute MUST NOT be -// set. -func MessagingKafkaMessageKey(val string) attribute.KeyValue { - return MessagingKafkaMessageKeyKey.String(val) -} - -// MessagingKafkaConsumerGroup returns an attribute KeyValue conforming to -// the "messaging.kafka.consumer.group" semantic conventions. It represents the -// name of the Kafka Consumer Group that is handling the message. Only applies -// to consumers, not producers. -func MessagingKafkaConsumerGroup(val string) attribute.KeyValue { - return MessagingKafkaConsumerGroupKey.String(val) -} - -// MessagingKafkaClientID returns an attribute KeyValue conforming to the -// "messaging.kafka.client_id" semantic conventions. It represents the client -// ID for the Consumer or Producer that is handling the message. -func MessagingKafkaClientID(val string) attribute.KeyValue { - return MessagingKafkaClientIDKey.String(val) -} - -// MessagingKafkaDestinationPartition returns an attribute KeyValue -// conforming to the "messaging.kafka.destination.partition" semantic -// conventions. It represents the partition the message is sent to. -func MessagingKafkaDestinationPartition(val int) attribute.KeyValue { - return MessagingKafkaDestinationPartitionKey.Int(val) -} - -// MessagingKafkaSourcePartition returns an attribute KeyValue conforming to -// the "messaging.kafka.source.partition" semantic conventions. It represents -// the partition the message is received from. -func MessagingKafkaSourcePartition(val int) attribute.KeyValue { - return MessagingKafkaSourcePartitionKey.Int(val) -} - -// MessagingKafkaMessageOffset returns an attribute KeyValue conforming to -// the "messaging.kafka.message.offset" semantic conventions. It represents the -// offset of a record in the corresponding Kafka partition. -func MessagingKafkaMessageOffset(val int) attribute.KeyValue { - return MessagingKafkaMessageOffsetKey.Int(val) -} - -// MessagingKafkaMessageTombstone returns an attribute KeyValue conforming -// to the "messaging.kafka.message.tombstone" semantic conventions. It -// represents a boolean that is true if the message is a tombstone. -func MessagingKafkaMessageTombstone(val bool) attribute.KeyValue { - return MessagingKafkaMessageTombstoneKey.Bool(val) -} - -// Attributes for Apache RocketMQ -const ( - // MessagingRocketmqNamespaceKey is the attribute Key conforming to the - // "messaging.rocketmq.namespace" semantic conventions. It represents the - // namespace of RocketMQ resources, resources in different namespaces are - // individual. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'myNamespace' - MessagingRocketmqNamespaceKey = attribute.Key("messaging.rocketmq.namespace") - - // MessagingRocketmqClientGroupKey is the attribute Key conforming to the - // "messaging.rocketmq.client_group" semantic conventions. It represents - // the name of the RocketMQ producer/consumer group that is handling the - // message. The client type is identified by the SpanKind. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'myConsumerGroup' - MessagingRocketmqClientGroupKey = attribute.Key("messaging.rocketmq.client_group") - - // MessagingRocketmqClientIDKey is the attribute Key conforming to the - // "messaging.rocketmq.client_id" semantic conventions. It represents the - // unique identifier for each client. - // - // Type: string - // RequirementLevel: Required - // Stability: stable - // Examples: 'myhost@8742@s8083jm' - MessagingRocketmqClientIDKey = attribute.Key("messaging.rocketmq.client_id") - - // MessagingRocketmqMessageDeliveryTimestampKey is the attribute Key - // conforming to the "messaging.rocketmq.message.delivery_timestamp" - // semantic conventions. It represents the timestamp in milliseconds that - // the delay message is expected to be delivered to consumer. - // - // Type: int - // RequirementLevel: ConditionallyRequired (If the message type is delay - // and delay time level is not specified.) - // Stability: stable - // Examples: 1665987217045 - MessagingRocketmqMessageDeliveryTimestampKey = attribute.Key("messaging.rocketmq.message.delivery_timestamp") - - // MessagingRocketmqMessageDelayTimeLevelKey is the attribute Key - // conforming to the "messaging.rocketmq.message.delay_time_level" semantic - // conventions. It represents the delay time level for delay message, which - // determines the message delay time. - // - // Type: int - // RequirementLevel: ConditionallyRequired (If the message type is delay - // and delivery timestamp is not specified.) - // Stability: stable - // Examples: 3 - MessagingRocketmqMessageDelayTimeLevelKey = attribute.Key("messaging.rocketmq.message.delay_time_level") - - // MessagingRocketmqMessageGroupKey is the attribute Key conforming to the - // "messaging.rocketmq.message.group" semantic conventions. It represents - // the it is essential for FIFO message. Messages that belong to the same - // message group are always processed one by one within the same consumer - // group. - // - // Type: string - // RequirementLevel: ConditionallyRequired (If the message type is FIFO.) - // Stability: stable - // Examples: 'myMessageGroup' - MessagingRocketmqMessageGroupKey = attribute.Key("messaging.rocketmq.message.group") - - // MessagingRocketmqMessageTypeKey is the attribute Key conforming to the - // "messaging.rocketmq.message.type" semantic conventions. It represents - // the type of message. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - MessagingRocketmqMessageTypeKey = attribute.Key("messaging.rocketmq.message.type") - - // MessagingRocketmqMessageTagKey is the attribute Key conforming to the - // "messaging.rocketmq.message.tag" semantic conventions. It represents the - // secondary classifier of message besides topic. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'tagA' - MessagingRocketmqMessageTagKey = attribute.Key("messaging.rocketmq.message.tag") - - // MessagingRocketmqMessageKeysKey is the attribute Key conforming to the - // "messaging.rocketmq.message.keys" semantic conventions. It represents - // the key(s) of message, another way to mark message besides message id. - // - // Type: string[] - // RequirementLevel: Optional - // Stability: stable - // Examples: 'keyA', 'keyB' - MessagingRocketmqMessageKeysKey = attribute.Key("messaging.rocketmq.message.keys") - - // MessagingRocketmqConsumptionModelKey is the attribute Key conforming to - // the "messaging.rocketmq.consumption_model" semantic conventions. It - // represents the model of message consumption. This only applies to - // consumer spans. - // - // Type: Enum - // RequirementLevel: Optional - // Stability: stable - MessagingRocketmqConsumptionModelKey = attribute.Key("messaging.rocketmq.consumption_model") -) - -var ( - // Normal message - MessagingRocketmqMessageTypeNormal = MessagingRocketmqMessageTypeKey.String("normal") - // FIFO message - MessagingRocketmqMessageTypeFifo = MessagingRocketmqMessageTypeKey.String("fifo") - // Delay message - MessagingRocketmqMessageTypeDelay = MessagingRocketmqMessageTypeKey.String("delay") - // Transaction message - MessagingRocketmqMessageTypeTransaction = MessagingRocketmqMessageTypeKey.String("transaction") -) - -var ( - // Clustering consumption model - MessagingRocketmqConsumptionModelClustering = MessagingRocketmqConsumptionModelKey.String("clustering") - // Broadcasting consumption model - MessagingRocketmqConsumptionModelBroadcasting = MessagingRocketmqConsumptionModelKey.String("broadcasting") -) - -// MessagingRocketmqNamespace returns an attribute KeyValue conforming to -// the "messaging.rocketmq.namespace" semantic conventions. It represents the -// namespace of RocketMQ resources, resources in different namespaces are -// individual. -func MessagingRocketmqNamespace(val string) attribute.KeyValue { - return MessagingRocketmqNamespaceKey.String(val) -} - -// MessagingRocketmqClientGroup returns an attribute KeyValue conforming to -// the "messaging.rocketmq.client_group" semantic conventions. It represents -// the name of the RocketMQ producer/consumer group that is handling the -// message. The client type is identified by the SpanKind. -func MessagingRocketmqClientGroup(val string) attribute.KeyValue { - return MessagingRocketmqClientGroupKey.String(val) -} - -// MessagingRocketmqClientID returns an attribute KeyValue conforming to the -// "messaging.rocketmq.client_id" semantic conventions. It represents the -// unique identifier for each client. -func MessagingRocketmqClientID(val string) attribute.KeyValue { - return MessagingRocketmqClientIDKey.String(val) -} - -// MessagingRocketmqMessageDeliveryTimestamp returns an attribute KeyValue -// conforming to the "messaging.rocketmq.message.delivery_timestamp" semantic -// conventions. It represents the timestamp in milliseconds that the delay -// message is expected to be delivered to consumer. -func MessagingRocketmqMessageDeliveryTimestamp(val int) attribute.KeyValue { - return MessagingRocketmqMessageDeliveryTimestampKey.Int(val) -} - -// MessagingRocketmqMessageDelayTimeLevel returns an attribute KeyValue -// conforming to the "messaging.rocketmq.message.delay_time_level" semantic -// conventions. It represents the delay time level for delay message, which -// determines the message delay time. -func MessagingRocketmqMessageDelayTimeLevel(val int) attribute.KeyValue { - return MessagingRocketmqMessageDelayTimeLevelKey.Int(val) -} - -// MessagingRocketmqMessageGroup returns an attribute KeyValue conforming to -// the "messaging.rocketmq.message.group" semantic conventions. It represents -// the it is essential for FIFO message. Messages that belong to the same -// message group are always processed one by one within the same consumer -// group. -func MessagingRocketmqMessageGroup(val string) attribute.KeyValue { - return MessagingRocketmqMessageGroupKey.String(val) -} - -// MessagingRocketmqMessageTag returns an attribute KeyValue conforming to -// the "messaging.rocketmq.message.tag" semantic conventions. It represents the -// secondary classifier of message besides topic. -func MessagingRocketmqMessageTag(val string) attribute.KeyValue { - return MessagingRocketmqMessageTagKey.String(val) -} - -// MessagingRocketmqMessageKeys returns an attribute KeyValue conforming to -// the "messaging.rocketmq.message.keys" semantic conventions. It represents -// the key(s) of message, another way to mark message besides message id. -func MessagingRocketmqMessageKeys(val ...string) attribute.KeyValue { - return MessagingRocketmqMessageKeysKey.StringSlice(val) -} - -// Semantic conventions for remote procedure calls. -const ( - // RPCSystemKey is the attribute Key conforming to the "rpc.system" - // semantic conventions. It represents a string identifying the remoting - // system. See below for a list of well-known identifiers. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - RPCSystemKey = attribute.Key("rpc.system") - - // RPCServiceKey is the attribute Key conforming to the "rpc.service" - // semantic conventions. It represents the full (logical) name of the - // service being called, including its package name, if applicable. - // - // Type: string - // RequirementLevel: Recommended - // Stability: stable - // Examples: 'myservice.EchoService' - // Note: This is the logical name of the service from the RPC interface - // perspective, which can be different from the name of any implementing - // class. The `code.namespace` attribute may be used to store the latter - // (despite the attribute name, it may include a class name; e.g., class - // with method actually executing the call on the server side, RPC client - // stub class on the client side). - RPCServiceKey = attribute.Key("rpc.service") - - // RPCMethodKey is the attribute Key conforming to the "rpc.method" - // semantic conventions. It represents the name of the (logical) method - // being called, must be equal to the $method part in the span name. - // - // Type: string - // RequirementLevel: Recommended - // Stability: stable - // Examples: 'exampleMethod' - // Note: This is the logical name of the method from the RPC interface - // perspective, which can be different from the name of any implementing - // method/function. The `code.function` attribute may be used to store the - // latter (e.g., method actually executing the call on the server side, RPC - // client stub method on the client side). - RPCMethodKey = attribute.Key("rpc.method") -) - -var ( - // gRPC - RPCSystemGRPC = RPCSystemKey.String("grpc") - // Java RMI - RPCSystemJavaRmi = RPCSystemKey.String("java_rmi") - // .NET WCF - RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf") - // Apache Dubbo - RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo") -) - -// RPCService returns an attribute KeyValue conforming to the "rpc.service" -// semantic conventions. It represents the full (logical) name of the service -// being called, including its package name, if applicable. -func RPCService(val string) attribute.KeyValue { - return RPCServiceKey.String(val) -} - -// RPCMethod returns an attribute KeyValue conforming to the "rpc.method" -// semantic conventions. It represents the name of the (logical) method being -// called, must be equal to the $method part in the span name. -func RPCMethod(val string) attribute.KeyValue { - return RPCMethodKey.String(val) -} - -// Tech-specific attributes for gRPC. -const ( - // RPCGRPCStatusCodeKey is the attribute Key conforming to the - // "rpc.grpc.status_code" semantic conventions. It represents the [numeric - // status - // code](https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md) of - // the gRPC request. - // - // Type: Enum - // RequirementLevel: Required - // Stability: stable - RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code") -) - -var ( - // OK - RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0) - // CANCELLED - RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1) - // UNKNOWN - RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2) - // INVALID_ARGUMENT - RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3) - // DEADLINE_EXCEEDED - RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4) - // NOT_FOUND - RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5) - // ALREADY_EXISTS - RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6) - // PERMISSION_DENIED - RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7) - // RESOURCE_EXHAUSTED - RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8) - // FAILED_PRECONDITION - RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9) - // ABORTED - RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10) - // OUT_OF_RANGE - RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11) - // UNIMPLEMENTED - RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12) - // INTERNAL - RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13) - // UNAVAILABLE - RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14) - // DATA_LOSS - RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15) - // UNAUTHENTICATED - RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16) -) - -// Tech-specific attributes for [JSON RPC](https://www.jsonrpc.org/). -const ( - // RPCJsonrpcVersionKey is the attribute Key conforming to the - // "rpc.jsonrpc.version" semantic conventions. It represents the protocol - // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 - // does not specify this, the value can be omitted. - // - // Type: string - // RequirementLevel: ConditionallyRequired (If other than the default - // version (`1.0`)) - // Stability: stable - // Examples: '2.0', '1.0' - RPCJsonrpcVersionKey = attribute.Key("rpc.jsonrpc.version") - - // RPCJsonrpcRequestIDKey is the attribute Key conforming to the - // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` - // property of request or response. Since protocol allows id to be int, - // string, `null` or missing (for notifications), value is expected to be - // cast to string for simplicity. Use empty string in case of `null` value. - // Omit entirely if this is a notification. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: '10', 'request-7', '' - RPCJsonrpcRequestIDKey = attribute.Key("rpc.jsonrpc.request_id") - - // RPCJsonrpcErrorCodeKey is the attribute Key conforming to the - // "rpc.jsonrpc.error_code" semantic conventions. It represents the - // `error.code` property of response if it is an error response. - // - // Type: int - // RequirementLevel: ConditionallyRequired (If response is not successful.) - // Stability: stable - // Examples: -32700, 100 - RPCJsonrpcErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code") - - // RPCJsonrpcErrorMessageKey is the attribute Key conforming to the - // "rpc.jsonrpc.error_message" semantic conventions. It represents the - // `error.message` property of response if it is an error response. - // - // Type: string - // RequirementLevel: Optional - // Stability: stable - // Examples: 'Parse error', 'User already exists' - RPCJsonrpcErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message") -) - -// RPCJsonrpcVersion returns an attribute KeyValue conforming to the -// "rpc.jsonrpc.version" semantic conventions. It represents the protocol -// version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 -// does not specify this, the value can be omitted. -func RPCJsonrpcVersion(val string) attribute.KeyValue { - return RPCJsonrpcVersionKey.String(val) -} - -// RPCJsonrpcRequestID returns an attribute KeyValue conforming to the -// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` -// property of request or response. Since protocol allows id to be int, string, -// `null` or missing (for notifications), value is expected to be cast to -// string for simplicity. Use empty string in case of `null` value. Omit -// entirely if this is a notification. -func RPCJsonrpcRequestID(val string) attribute.KeyValue { - return RPCJsonrpcRequestIDKey.String(val) -} - -// RPCJsonrpcErrorCode returns an attribute KeyValue conforming to the -// "rpc.jsonrpc.error_code" semantic conventions. It represents the -// `error.code` property of response if it is an error response. -func RPCJsonrpcErrorCode(val int) attribute.KeyValue { - return RPCJsonrpcErrorCodeKey.Int(val) -} - -// RPCJsonrpcErrorMessage returns an attribute KeyValue conforming to the -// "rpc.jsonrpc.error_message" semantic conventions. It represents the -// `error.message` property of response if it is an error response. -func RPCJsonrpcErrorMessage(val string) attribute.KeyValue { - return RPCJsonrpcErrorMessageKey.String(val) -} diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/MIGRATION.md b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/MIGRATION.md new file mode 100644 index 000000000..8a11ea28d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/MIGRATION.md @@ -0,0 +1,155 @@ +# Semantic Convention Changes + +The `go.opentelemetry.io/otel/semconv/v1.30.0` should be a drop-in replacement for `go.opentelemetry.io/otel/semconv/v1.28.0` with the following exceptions. + +Note: `go.opentelemetry.io/otel/semconv/v1.29.0` does not exist due to bugs from the upstream [OpenTelemetry Semantic Conventions]. + +## Dropped deprecations + +The following declarations have been deprecated in the [OpenTelemetry Semantic Conventions]. +Refer to the respective documentation in that repository for deprecation instructions for each type. + +- `CodeColumn` +- `CodeColumnKey` +- `CodeFunction` +- `CodeFunctionKey` +- `DBCassandraConsistencyLevelAll` +- `DBCassandraConsistencyLevelAny` +- `DBCassandraConsistencyLevelEachQuorum` +- `DBCassandraConsistencyLevelKey` +- `DBCassandraConsistencyLevelLocalOne` +- `DBCassandraConsistencyLevelLocalQuorum` +- `DBCassandraConsistencyLevelLocalSerial` +- `DBCassandraConsistencyLevelOne` +- `DBCassandraConsistencyLevelQuorum` +- `DBCassandraConsistencyLevelSerial` +- `DBCassandraConsistencyLevelThree` +- `DBCassandraConsistencyLevelTwo` +- `DBCassandraCoordinatorDC` +- `DBCassandraCoordinatorDCKey` +- `DBCassandraCoordinatorID` +- `DBCassandraCoordinatorIDKey` +- `DBCassandraIdempotence` +- `DBCassandraIdempotenceKey` +- `DBCassandraPageSize` +- `DBCassandraPageSizeKey` +- `DBCassandraSpeculativeExecutionCount` +- `DBCassandraSpeculativeExecutionCountKey` +- `DBCosmosDBClientID` +- `DBCosmosDBClientIDKey` +- `DBCosmosDBConnectionModeDirect` +- `DBCosmosDBConnectionModeGateway` +- `DBCosmosDBConnectionModeKey` +- `DBCosmosDBOperationTypeBatch` +- `DBCosmosDBOperationTypeCreate` +- `DBCosmosDBOperationTypeDelete` +- `DBCosmosDBOperationTypeExecute` +- `DBCosmosDBOperationTypeExecuteJavascript` +- `DBCosmosDBOperationTypeHead` +- `DBCosmosDBOperationTypeHeadFeed` +- `DBCosmosDBOperationTypeInvalid` +- `DBCosmosDBOperationTypeKey` +- `DBCosmosDBOperationTypePatch` +- `DBCosmosDBOperationTypeQuery` +- `DBCosmosDBOperationTypeQueryPlan` +- `DBCosmosDBOperationTypeRead` +- `DBCosmosDBOperationTypeReadFeed` +- `DBCosmosDBOperationTypeReplace` +- `DBCosmosDBOperationTypeUpsert` +- `DBCosmosDBRequestCharge` +- `DBCosmosDBRequestChargeKey` +- `DBCosmosDBRequestContentLength` +- `DBCosmosDBRequestContentLengthKey` +- `DBCosmosDBSubStatusCode` +- `DBCosmosDBSubStatusCodeKey` +- `DBElasticsearchNodeName` +- `DBElasticsearchNodeNameKey` +- `DBSystemAdabas` +- `DBSystemCache` +- `DBSystemCassandra` +- `DBSystemClickhouse` +- `DBSystemCloudscape` +- `DBSystemCockroachdb` +- `DBSystemColdfusion` +- `DBSystemCosmosDB` +- `DBSystemCouchDB` +- `DBSystemCouchbase` +- `DBSystemDb2` +- `DBSystemDerby` +- `DBSystemDynamoDB` +- `DBSystemEDB` +- `DBSystemElasticsearch` +- `DBSystemFilemaker` +- `DBSystemFirebird` +- `DBSystemFirstSQL` +- `DBSystemGeode` +- `DBSystemH2` +- `DBSystemHBase` +- `DBSystemHSQLDB` +- `DBSystemHanaDB` +- `DBSystemHive` +- `DBSystemInfluxdb` +- `DBSystemInformix` +- `DBSystemIngres` +- `DBSystemInstantDB` +- `DBSystemInterbase` +- `DBSystemIntersystemsCache` +- `DBSystemKey` +- `DBSystemMSSQL` +- `DBSystemMariaDB` +- `DBSystemMaxDB` +- `DBSystemMemcached` +- `DBSystemMongoDB` +- `DBSystemMssqlcompact` +- `DBSystemMySQL` +- `DBSystemNeo4j` +- `DBSystemNetezza` +- `DBSystemOpensearch` +- `DBSystemOracle` +- `DBSystemOtherSQL` +- `DBSystemPervasive` +- `DBSystemPointbase` +- `DBSystemPostgreSQL` +- `DBSystemProgress` +- `DBSystemRedis` +- `DBSystemRedshift` +- `DBSystemSpanner` +- `DBSystemSqlite` +- `DBSystemSybase` +- `DBSystemTeradata` +- `DBSystemTrino` +- `DBSystemVertica` +- `EventName` +- `EventNameKey` +- `ExceptionEscaped` +- `ExceptionEscapedKey` +- `GenAIOpenaiRequestSeed` +- `GenAIOpenaiRequestSeedKey` +- `ProcessExecutableBuildIDProfiling` +- `ProcessExecutableBuildIDProfilingKey` +- `SystemNetworkStateClose` +- `SystemNetworkStateCloseWait` +- `SystemNetworkStateClosing` +- `SystemNetworkStateDelete` +- `SystemNetworkStateEstablished` +- `SystemNetworkStateFinWait1` +- `SystemNetworkStateFinWait2` +- `SystemNetworkStateKey` +- `SystemNetworkStateLastAck` +- `SystemNetworkStateListen` +- `SystemNetworkStateSynRecv` +- `SystemNetworkStateSynSent` +- `SystemNetworkStateTimeWait` +- `VCSRepositoryChangeID` +- `VCSRepositoryChangeIDKey` +- `VCSRepositoryChangeTitle` +- `VCSRepositoryChangeTitleKey` +- `VCSRepositoryRefName` +- `VCSRepositoryRefNameKey` +- `VCSRepositoryRefRevision` +- `VCSRepositoryRefRevisionKey` +- `VCSRepositoryRefTypeBranch` +- `VCSRepositoryRefTypeKey` +- `VCSRepositoryRefTypeTag` + +[OpenTelemetry Semantic Conventions]: https://github.com/open-telemetry/semantic-conventions diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/README.md b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/README.md new file mode 100644 index 000000000..072ea6928 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/README.md @@ -0,0 +1,3 @@ +# Semconv v1.30.0 + +[![PkgGoDev](https://pkg.go.dev/badge/go.opentelemetry.io/otel/semconv/v1.30.0)](https://pkg.go.dev/go.opentelemetry.io/otel/semconv/v1.30.0) diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/attribute_group.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/attribute_group.go new file mode 100644 index 000000000..60f3df0db --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/attribute_group.go @@ -0,0 +1,12333 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +// Code generated from semantic convention specification. DO NOT EDIT. + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0" + +import "go.opentelemetry.io/otel/attribute" + +// Namespace: android +const ( + // AndroidOSAPILevelKey is the attribute Key conforming to the + // "android.os.api_level" semantic conventions. It represents the uniquely + // identifies the framework API revision offered by a version (`os.version`) of + // the android operating system. More information can be found [here]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "33", "32" + // + // [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels + AndroidOSAPILevelKey = attribute.Key("android.os.api_level") +) + +// AndroidOSAPILevel returns an attribute KeyValue conforming to the +// "android.os.api_level" semantic conventions. It represents the uniquely +// identifies the framework API revision offered by a version (`os.version`) of +// the android operating system. More information can be found [here]. +// +// [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels +func AndroidOSAPILevel(val string) attribute.KeyValue { + return AndroidOSAPILevelKey.String(val) +} + +// Namespace: artifact +const ( + // ArtifactAttestationFilenameKey is the attribute Key conforming to the + // "artifact.attestation.filename" semantic conventions. It represents the + // provenance filename of the built attestation which directly relates to the + // build artifact filename. This filename SHOULD accompany the artifact at + // publish time. See the [SLSA Relationship] specification for more information. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "golang-binary-amd64-v0.1.0.attestation", + // "docker-image-amd64-v0.1.0.intoto.json1", "release-1.tar.gz.attestation", + // "file-name-package.tar.gz.intoto.json1" + // + // [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations + ArtifactAttestationFilenameKey = attribute.Key("artifact.attestation.filename") + + // ArtifactAttestationHashKey is the attribute Key conforming to the + // "artifact.attestation.hash" semantic conventions. It represents the full + // [hash value (see glossary)], of the built attestation. Some envelopes in the + // [software attestation space] also refer to this as the **digest**. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1b31dfcd5b7f9267bf2ff47651df1cfb9147b9e4df1f335accf65b4cda498408" + // + // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec + ArtifactAttestationHashKey = attribute.Key("artifact.attestation.hash") + + // ArtifactAttestationIDKey is the attribute Key conforming to the + // "artifact.attestation.id" semantic conventions. It represents the id of the + // build [software attestation]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123" + // + // [software attestation]: https://slsa.dev/attestation-model + ArtifactAttestationIDKey = attribute.Key("artifact.attestation.id") + + // ArtifactFilenameKey is the attribute Key conforming to the + // "artifact.filename" semantic conventions. It represents the human readable + // file name of the artifact, typically generated during build and release + // processes. Often includes the package name and version in the file name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "golang-binary-amd64-v0.1.0", "docker-image-amd64-v0.1.0", + // "release-1.tar.gz", "file-name-package.tar.gz" + // Note: This file name can also act as the [Package Name] + // in cases where the package ecosystem maps accordingly. + // Additionally, the artifact [can be published] + // for others, but that is not a guarantee. + // + // [Package Name]: https://slsa.dev/spec/v1.0/terminology#package-model + // [can be published]: https://slsa.dev/spec/v1.0/terminology#software-supply-chain + ArtifactFilenameKey = attribute.Key("artifact.filename") + + // ArtifactHashKey is the attribute Key conforming to the "artifact.hash" + // semantic conventions. It represents the full [hash value (see glossary)], + // often found in checksum.txt on a release of the artifact and used to verify + // package integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9ff4c52759e2c4ac70b7d517bc7fcdc1cda631ca0045271ddd1b192544f8a3e9" + // Note: The specific algorithm used to create the cryptographic hash value is + // not defined. In situations where an artifact has multiple + // cryptographic hashes, it is up to the implementer to choose which + // hash value to set here; this should be the most secure hash algorithm + // that is suitable for the situation and consistent with the + // corresponding attestation. The implementer can then provide the other + // hash values through an additional set of attribute extensions as they + // deem necessary. + // + // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + ArtifactHashKey = attribute.Key("artifact.hash") + + // ArtifactPurlKey is the attribute Key conforming to the "artifact.purl" + // semantic conventions. It represents the [Package URL] of the + // [package artifact] provides a standard way to identify and locate the + // packaged artifact. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pkg:github/package-url/purl-spec@1209109710924", + // "pkg:npm/foo@12.12.3" + // + // [Package URL]: https://github.com/package-url/purl-spec + // [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model + ArtifactPurlKey = attribute.Key("artifact.purl") + + // ArtifactVersionKey is the attribute Key conforming to the "artifact.version" + // semantic conventions. It represents the version of the artifact. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "v0.1.0", "1.2.1", "122691-build" + ArtifactVersionKey = attribute.Key("artifact.version") +) + +// ArtifactAttestationFilename returns an attribute KeyValue conforming to the +// "artifact.attestation.filename" semantic conventions. It represents the +// provenance filename of the built attestation which directly relates to the +// build artifact filename. This filename SHOULD accompany the artifact at +// publish time. See the [SLSA Relationship] specification for more information. +// +// [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations +func ArtifactAttestationFilename(val string) attribute.KeyValue { + return ArtifactAttestationFilenameKey.String(val) +} + +// ArtifactAttestationHash returns an attribute KeyValue conforming to the +// "artifact.attestation.hash" semantic conventions. It represents the full +// [hash value (see glossary)], of the built attestation. Some envelopes in the +// [software attestation space] also refer to this as the **digest**. +// +// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf +// [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec +func ArtifactAttestationHash(val string) attribute.KeyValue { + return ArtifactAttestationHashKey.String(val) +} + +// ArtifactAttestationID returns an attribute KeyValue conforming to the +// "artifact.attestation.id" semantic conventions. It represents the id of the +// build [software attestation]. +// +// [software attestation]: https://slsa.dev/attestation-model +func ArtifactAttestationID(val string) attribute.KeyValue { + return ArtifactAttestationIDKey.String(val) +} + +// ArtifactFilename returns an attribute KeyValue conforming to the +// "artifact.filename" semantic conventions. It represents the human readable +// file name of the artifact, typically generated during build and release +// processes. Often includes the package name and version in the file name. +func ArtifactFilename(val string) attribute.KeyValue { + return ArtifactFilenameKey.String(val) +} + +// ArtifactHash returns an attribute KeyValue conforming to the "artifact.hash" +// semantic conventions. It represents the full [hash value (see glossary)], +// often found in checksum.txt on a release of the artifact and used to verify +// package integrity. +// +// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf +func ArtifactHash(val string) attribute.KeyValue { + return ArtifactHashKey.String(val) +} + +// ArtifactPurl returns an attribute KeyValue conforming to the "artifact.purl" +// semantic conventions. It represents the [Package URL] of the +// [package artifact] provides a standard way to identify and locate the packaged +// artifact. +// +// [Package URL]: https://github.com/package-url/purl-spec +// [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model +func ArtifactPurl(val string) attribute.KeyValue { + return ArtifactPurlKey.String(val) +} + +// ArtifactVersion returns an attribute KeyValue conforming to the +// "artifact.version" semantic conventions. It represents the version of the +// artifact. +func ArtifactVersion(val string) attribute.KeyValue { + return ArtifactVersionKey.String(val) +} + +// Namespace: aws +const ( + // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to the + // "aws.dynamodb.attribute_definitions" semantic conventions. It represents the + // JSON-serialized value of each item in the `AttributeDefinitions` request + // field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "AttributeName": "string", "AttributeType": "string" }" + AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions") + + // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the + // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the + // value of the `AttributesToGet` request parameter. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "lives", "id" + AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get") + + // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the + // "aws.dynamodb.consistent_read" semantic conventions. It represents the value + // of the `ConsistentRead` request parameter. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read") + + // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the + // JSON-serialized value of each item in the `ConsumedCapacity` response field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "CapacityUnits": number, "GlobalSecondaryIndexes": { "string" : + // { "CapacityUnits": number, "ReadCapacityUnits": number, "WriteCapacityUnits": + // number } }, "LocalSecondaryIndexes": { "string" : { "CapacityUnits": number, + // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }, + // "ReadCapacityUnits": number, "Table": { "CapacityUnits": number, + // "ReadCapacityUnits": number, "WriteCapacityUnits": number }, "TableName": + // "string", "WriteCapacityUnits": number }" + AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity") + + // AWSDynamoDBCountKey is the attribute Key conforming to the + // "aws.dynamodb.count" semantic conventions. It represents the value of the + // `Count` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count") + + // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the + // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the + // value of the `ExclusiveStartTableName` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Users", "CatsTable" + AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table") + + // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key conforming to + // the "aws.dynamodb.global_secondary_index_updates" semantic conventions. It + // represents the JSON-serialized value of each item in the + // `GlobalSecondaryIndexUpdates` request field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "Create": { "IndexName": "string", "KeySchema": [ { + // "AttributeName": "string", "KeyType": "string" } ], "Projection": { + // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" }, + // "ProvisionedThroughput": { "ReadCapacityUnits": number, "WriteCapacityUnits": + // number } }" + AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates") + + // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to the + // "aws.dynamodb.global_secondary_indexes" semantic conventions. It represents + // the JSON-serialized value of each item of the `GlobalSecondaryIndexes` + // request field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "IndexName": "string", "KeySchema": [ { "AttributeName": + // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ + // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": { + // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }" + AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes") + + // AWSDynamoDBIndexNameKey is the attribute Key conforming to the + // "aws.dynamodb.index_name" semantic conventions. It represents the value of + // the `IndexName` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "name_to_group" + AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name") + + // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to the + // "aws.dynamodb.item_collection_metrics" semantic conventions. It represents + // the JSON-serialized value of the `ItemCollectionMetrics` response field. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "string" : [ { "ItemCollectionKey": { "string" : { "B": blob, + // "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": { "string" : + // "AttributeValue" }, "N": "string", "NS": [ "string" ], "NULL": boolean, "S": + // "string", "SS": [ "string" ] } }, "SizeEstimateRangeGB": [ number ] } ] }" + AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics") + + // AWSDynamoDBLimitKey is the attribute Key conforming to the + // "aws.dynamodb.limit" semantic conventions. It represents the value of the + // `Limit` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit") + + // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to the + // "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents + // the JSON-serialized value of each item of the `LocalSecondaryIndexes` request + // field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "IndexArn": "string", "IndexName": "string", "IndexSizeBytes": + // number, "ItemCount": number, "KeySchema": [ { "AttributeName": "string", + // "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ "string" ], + // "ProjectionType": "string" } }" + AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes") + + // AWSDynamoDBProjectionKey is the attribute Key conforming to the + // "aws.dynamodb.projection" semantic conventions. It represents the value of + // the `ProjectionExpression` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Title", "Title, Price, Color", "Title, Description, RelatedItems, + // ProductReviews" + AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection") + + // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.provisioned_read_capacity" semantic conventions. It represents + // the value of the `ProvisionedThroughput.ReadCapacityUnits` request parameter. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0, 2.0 + AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity") + + // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.provisioned_write_capacity" semantic conventions. It represents + // the value of the `ProvisionedThroughput.WriteCapacityUnits` request + // parameter. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0, 2.0 + AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity") + + // AWSDynamoDBScanForwardKey is the attribute Key conforming to the + // "aws.dynamodb.scan_forward" semantic conventions. It represents the value of + // the `ScanIndexForward` request parameter. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward") + + // AWSDynamoDBScannedCountKey is the attribute Key conforming to the + // "aws.dynamodb.scanned_count" semantic conventions. It represents the value of + // the `ScannedCount` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 50 + AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count") + + // AWSDynamoDBSegmentKey is the attribute Key conforming to the + // "aws.dynamodb.segment" semantic conventions. It represents the value of the + // `Segment` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment") + + // AWSDynamoDBSelectKey is the attribute Key conforming to the + // "aws.dynamodb.select" semantic conventions. It represents the value of the + // `Select` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ALL_ATTRIBUTES", "COUNT" + AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select") + + // AWSDynamoDBTableCountKey is the attribute Key conforming to the + // "aws.dynamodb.table_count" semantic conventions. It represents the number of + // items in the `TableNames` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 20 + AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count") + + // AWSDynamoDBTableNamesKey is the attribute Key conforming to the + // "aws.dynamodb.table_names" semantic conventions. It represents the keys in + // the `RequestItems` object field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Users", "Cats" + AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names") + + // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the + // "aws.dynamodb.total_segments" semantic conventions. It represents the value + // of the `TotalSegments` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments") + + // AWSECSClusterARNKey is the attribute Key conforming to the + // "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an + // [ECS cluster]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster" + // + // [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html + AWSECSClusterARNKey = attribute.Key("aws.ecs.cluster.arn") + + // AWSECSContainerARNKey is the attribute Key conforming to the + // "aws.ecs.container.arn" semantic conventions. It represents the Amazon + // Resource Name (ARN) of an [ECS container instance]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:ecs:us-west-1:123456789123:container/32624152-9086-4f0e-acae-1a75b14fe4d9" + // + // [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html + AWSECSContainerARNKey = attribute.Key("aws.ecs.container.arn") + + // AWSECSLaunchtypeKey is the attribute Key conforming to the + // "aws.ecs.launchtype" semantic conventions. It represents the [launch type] + // for an ECS task. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [launch type]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/launch_types.html + AWSECSLaunchtypeKey = attribute.Key("aws.ecs.launchtype") + + // AWSECSTaskARNKey is the attribute Key conforming to the "aws.ecs.task.arn" + // semantic conventions. It represents the ARN of a running [ECS task]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:ecs:us-west-1:123456789123:task/10838bed-421f-43ef-870a-f43feacbbb5b", + // "arn:aws:ecs:us-west-1:123456789123:task/my-cluster/task-id/23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd" + // + // [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids + AWSECSTaskARNKey = attribute.Key("aws.ecs.task.arn") + + // AWSECSTaskFamilyKey is the attribute Key conforming to the + // "aws.ecs.task.family" semantic conventions. It represents the family name of + // the [ECS task definition] used to create the ECS task. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-family" + // + // [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html + AWSECSTaskFamilyKey = attribute.Key("aws.ecs.task.family") + + // AWSECSTaskIDKey is the attribute Key conforming to the "aws.ecs.task.id" + // semantic conventions. It represents the ID of a running ECS task. The ID MUST + // be extracted from `task.arn`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "10838bed-421f-43ef-870a-f43feacbbb5b", + // "23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd" + AWSECSTaskIDKey = attribute.Key("aws.ecs.task.id") + + // AWSECSTaskRevisionKey is the attribute Key conforming to the + // "aws.ecs.task.revision" semantic conventions. It represents the revision for + // the task definition used to create the ECS task. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "8", "26" + AWSECSTaskRevisionKey = attribute.Key("aws.ecs.task.revision") + + // AWSEKSClusterARNKey is the attribute Key conforming to the + // "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS + // cluster. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster" + AWSEKSClusterARNKey = attribute.Key("aws.eks.cluster.arn") + + // AWSExtendedRequestIDKey is the attribute Key conforming to the + // "aws.extended_request_id" semantic conventions. It represents the AWS + // extended request ID as returned in the response header `x-amz-id-2`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "wzHcyEWfmOGDIE5QOhTAqFDoDWP3y8IUvpNINCwL9N4TEHbUw0/gZJ+VZTmCNCWR7fezEN3eCiQ=" + AWSExtendedRequestIDKey = attribute.Key("aws.extended_request_id") + + // AWSLambdaInvokedARNKey is the attribute Key conforming to the + // "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked + // ARN as provided on the `Context` passed to the function ( + // `Lambda-Runtime-Invoked-Function-Arn` header on the + // `/runtime/invocation/next` applicable). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:lambda:us-east-1:123456:function:myfunction:myalias" + // Note: This may be different from `cloud.resource_id` if an alias is involved. + AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn") + + // AWSLogGroupARNsKey is the attribute Key conforming to the + // "aws.log.group.arns" semantic conventions. It represents the Amazon Resource + // Name(s) (ARN) of the AWS log group(s). + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:*" + // Note: See the [log group ARN format documentation]. + // + // [log group ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format + AWSLogGroupARNsKey = attribute.Key("aws.log.group.arns") + + // AWSLogGroupNamesKey is the attribute Key conforming to the + // "aws.log.group.names" semantic conventions. It represents the name(s) of the + // AWS log group(s) an application is writing to. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/aws/lambda/my-function", "opentelemetry-service" + // Note: Multiple log groups must be supported for cases like multi-container + // applications, where a single application has sidecar containers, and each + // write to their own log group. + AWSLogGroupNamesKey = attribute.Key("aws.log.group.names") + + // AWSLogStreamARNsKey is the attribute Key conforming to the + // "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the + // AWS log stream(s). + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:log-stream:logs/main/10838bed-421f-43ef-870a-f43feacbbb5b" + // Note: See the [log stream ARN format documentation]. One log group can + // contain several log streams, so these ARNs necessarily identify both a log + // group and a log stream. + // + // [log stream ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format + AWSLogStreamARNsKey = attribute.Key("aws.log.stream.arns") + + // AWSLogStreamNamesKey is the attribute Key conforming to the + // "aws.log.stream.names" semantic conventions. It represents the name(s) of the + // AWS log stream(s) an application is writing to. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "logs/main/10838bed-421f-43ef-870a-f43feacbbb5b" + AWSLogStreamNamesKey = attribute.Key("aws.log.stream.names") + + // AWSRequestIDKey is the attribute Key conforming to the "aws.request_id" + // semantic conventions. It represents the AWS request ID as returned in the + // response headers `x-amzn-requestid`, `x-amzn-request-id` or + // `x-amz-request-id`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "79b9da39-b7ae-508a-a6bc-864b2829c622", "C9ER4AJX75574TDJ" + AWSRequestIDKey = attribute.Key("aws.request_id") + + // AWSS3BucketKey is the attribute Key conforming to the "aws.s3.bucket" + // semantic conventions. It represents the S3 bucket name the request refers to. + // Corresponds to the `--bucket` parameter of the [S3 API] operations. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "some-bucket-name" + // Note: The `bucket` attribute is applicable to all S3 operations that + // reference a bucket, i.e. that require the bucket name as a mandatory + // parameter. + // This applies to almost all S3 operations except `list-buckets`. + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + AWSS3BucketKey = attribute.Key("aws.s3.bucket") + + // AWSS3CopySourceKey is the attribute Key conforming to the + // "aws.s3.copy_source" semantic conventions. It represents the source object + // (in the form `bucket`/`key`) for the copy operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "someFile.yml" + // Note: The `copy_source` attribute applies to S3 copy operations and + // corresponds to the `--copy-source` parameter + // of the [copy-object operation within the S3 API]. + // This applies in particular to the following operations: + // + // - [copy-object] + // - [upload-part-copy] + // + // + // [copy-object operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3CopySourceKey = attribute.Key("aws.s3.copy_source") + + // AWSS3DeleteKey is the attribute Key conforming to the "aws.s3.delete" + // semantic conventions. It represents the delete request container that + // specifies the objects to be deleted. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "Objects=[{Key=string,VersionId=string},{Key=string,VersionId=string}],Quiet=boolean" + // Note: The `delete` attribute is only applicable to the [delete-object] + // operation. + // The `delete` attribute corresponds to the `--delete` parameter of the + // [delete-objects operation within the S3 API]. + // + // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html + // [delete-objects operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-objects.html + AWSS3DeleteKey = attribute.Key("aws.s3.delete") + + // AWSS3KeyKey is the attribute Key conforming to the "aws.s3.key" semantic + // conventions. It represents the S3 object key the request refers to. + // Corresponds to the `--key` parameter of the [S3 API] operations. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "someFile.yml" + // Note: The `key` attribute is applicable to all object-related S3 operations, + // i.e. that require the object key as a mandatory parameter. + // This applies in particular to the following operations: + // + // - [copy-object] + // - [delete-object] + // - [get-object] + // - [head-object] + // - [put-object] + // - [restore-object] + // - [select-object-content] + // - [abort-multipart-upload] + // - [complete-multipart-upload] + // - [create-multipart-upload] + // - [list-parts] + // - [upload-part] + // - [upload-part-copy] + // + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html + // [get-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/get-object.html + // [head-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/head-object.html + // [put-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/put-object.html + // [restore-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/restore-object.html + // [select-object-content]: https://docs.aws.amazon.com/cli/latest/reference/s3api/select-object-content.html + // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html + // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html + // [create-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/create-multipart-upload.html + // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3KeyKey = attribute.Key("aws.s3.key") + + // AWSS3PartNumberKey is the attribute Key conforming to the + // "aws.s3.part_number" semantic conventions. It represents the part number of + // the part being uploaded in a multipart-upload operation. This is a positive + // integer between 1 and 10,000. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3456 + // Note: The `part_number` attribute is only applicable to the [upload-part] + // and [upload-part-copy] operations. + // The `part_number` attribute corresponds to the `--part-number` parameter of + // the + // [upload-part operation within the S3 API]. + // + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + // [upload-part operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + AWSS3PartNumberKey = attribute.Key("aws.s3.part_number") + + // AWSS3UploadIDKey is the attribute Key conforming to the "aws.s3.upload_id" + // semantic conventions. It represents the upload ID that identifies the + // multipart upload. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "dfRtDYWFbkRONycy.Yxwh66Yjlx.cph0gtNBtJ" + // Note: The `upload_id` attribute applies to S3 multipart-upload operations and + // corresponds to the `--upload-id` parameter + // of the [S3 API] multipart operations. + // This applies in particular to the following operations: + // + // - [abort-multipart-upload] + // - [complete-multipart-upload] + // - [list-parts] + // - [upload-part] + // - [upload-part-copy] + // + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html + // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html + // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3UploadIDKey = attribute.Key("aws.s3.upload_id") +) + +// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming to +// the "aws.dynamodb.attribute_definitions" semantic conventions. It represents +// the JSON-serialized value of each item in the `AttributeDefinitions` request +// field. +func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue { + return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val) +} + +// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to the +// "aws.dynamodb.attributes_to_get" semantic conventions. It represents the value +// of the `AttributesToGet` request parameter. +func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue { + return AWSDynamoDBAttributesToGetKey.StringSlice(val) +} + +// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the +// "aws.dynamodb.consistent_read" semantic conventions. It represents the value +// of the `ConsistentRead` request parameter. +func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue { + return AWSDynamoDBConsistentReadKey.Bool(val) +} + +// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to the +// "aws.dynamodb.consumed_capacity" semantic conventions. It represents the +// JSON-serialized value of each item in the `ConsumedCapacity` response field. +func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue { + return AWSDynamoDBConsumedCapacityKey.StringSlice(val) +} + +// AWSDynamoDBCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.count" semantic conventions. It represents the value of the +// `Count` response parameter. +func AWSDynamoDBCount(val int) attribute.KeyValue { + return AWSDynamoDBCountKey.Int(val) +} + +// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming to the +// "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the +// value of the `ExclusiveStartTableName` request parameter. +func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue { + return AWSDynamoDBExclusiveStartTableKey.String(val) +} + +// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue +// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic +// conventions. It represents the JSON-serialized value of each item in the +// `GlobalSecondaryIndexUpdates` request field. +func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue { + return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val) +} + +// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue conforming to +// the "aws.dynamodb.global_secondary_indexes" semantic conventions. It +// represents the JSON-serialized value of each item of the +// `GlobalSecondaryIndexes` request field. +func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue { + return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val) +} + +// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the +// "aws.dynamodb.index_name" semantic conventions. It represents the value of the +// `IndexName` request parameter. +func AWSDynamoDBIndexName(val string) attribute.KeyValue { + return AWSDynamoDBIndexNameKey.String(val) +} + +// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming to +// the "aws.dynamodb.item_collection_metrics" semantic conventions. It represents +// the JSON-serialized value of the `ItemCollectionMetrics` response field. +func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue { + return AWSDynamoDBItemCollectionMetricsKey.String(val) +} + +// AWSDynamoDBLimit returns an attribute KeyValue conforming to the +// "aws.dynamodb.limit" semantic conventions. It represents the value of the +// `Limit` request parameter. +func AWSDynamoDBLimit(val int) attribute.KeyValue { + return AWSDynamoDBLimitKey.Int(val) +} + +// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming to +// the "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents +// the JSON-serialized value of each item of the `LocalSecondaryIndexes` request +// field. +func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue { + return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val) +} + +// AWSDynamoDBProjection returns an attribute KeyValue conforming to the +// "aws.dynamodb.projection" semantic conventions. It represents the value of the +// `ProjectionExpression` request parameter. +func AWSDynamoDBProjection(val string) attribute.KeyValue { + return AWSDynamoDBProjectionKey.String(val) +} + +// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue conforming to +// the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It +// represents the value of the `ProvisionedThroughput.ReadCapacityUnits` request +// parameter. +func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue { + return AWSDynamoDBProvisionedReadCapacityKey.Float64(val) +} + +// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue conforming +// to the "aws.dynamodb.provisioned_write_capacity" semantic conventions. It +// represents the value of the `ProvisionedThroughput.WriteCapacityUnits` request +// parameter. +func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue { + return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val) +} + +// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the +// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of +// the `ScanIndexForward` request parameter. +func AWSDynamoDBScanForward(val bool) attribute.KeyValue { + return AWSDynamoDBScanForwardKey.Bool(val) +} + +// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.scanned_count" semantic conventions. It represents the value of +// the `ScannedCount` response parameter. +func AWSDynamoDBScannedCount(val int) attribute.KeyValue { + return AWSDynamoDBScannedCountKey.Int(val) +} + +// AWSDynamoDBSegment returns an attribute KeyValue conforming to the +// "aws.dynamodb.segment" semantic conventions. It represents the value of the +// `Segment` request parameter. +func AWSDynamoDBSegment(val int) attribute.KeyValue { + return AWSDynamoDBSegmentKey.Int(val) +} + +// AWSDynamoDBSelect returns an attribute KeyValue conforming to the +// "aws.dynamodb.select" semantic conventions. It represents the value of the +// `Select` request parameter. +func AWSDynamoDBSelect(val string) attribute.KeyValue { + return AWSDynamoDBSelectKey.String(val) +} + +// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.table_count" semantic conventions. It represents the number of +// items in the `TableNames` response parameter. +func AWSDynamoDBTableCount(val int) attribute.KeyValue { + return AWSDynamoDBTableCountKey.Int(val) +} + +// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the +// "aws.dynamodb.table_names" semantic conventions. It represents the keys in the +// `RequestItems` object field. +func AWSDynamoDBTableNames(val ...string) attribute.KeyValue { + return AWSDynamoDBTableNamesKey.StringSlice(val) +} + +// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the +// "aws.dynamodb.total_segments" semantic conventions. It represents the value of +// the `TotalSegments` request parameter. +func AWSDynamoDBTotalSegments(val int) attribute.KeyValue { + return AWSDynamoDBTotalSegmentsKey.Int(val) +} + +// AWSECSClusterARN returns an attribute KeyValue conforming to the +// "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an +// [ECS cluster]. +// +// [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html +func AWSECSClusterARN(val string) attribute.KeyValue { + return AWSECSClusterARNKey.String(val) +} + +// AWSECSContainerARN returns an attribute KeyValue conforming to the +// "aws.ecs.container.arn" semantic conventions. It represents the Amazon +// Resource Name (ARN) of an [ECS container instance]. +// +// [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html +func AWSECSContainerARN(val string) attribute.KeyValue { + return AWSECSContainerARNKey.String(val) +} + +// AWSECSTaskARN returns an attribute KeyValue conforming to the +// "aws.ecs.task.arn" semantic conventions. It represents the ARN of a running +// [ECS task]. +// +// [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids +func AWSECSTaskARN(val string) attribute.KeyValue { + return AWSECSTaskARNKey.String(val) +} + +// AWSECSTaskFamily returns an attribute KeyValue conforming to the +// "aws.ecs.task.family" semantic conventions. It represents the family name of +// the [ECS task definition] used to create the ECS task. +// +// [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html +func AWSECSTaskFamily(val string) attribute.KeyValue { + return AWSECSTaskFamilyKey.String(val) +} + +// AWSECSTaskID returns an attribute KeyValue conforming to the "aws.ecs.task.id" +// semantic conventions. It represents the ID of a running ECS task. The ID MUST +// be extracted from `task.arn`. +func AWSECSTaskID(val string) attribute.KeyValue { + return AWSECSTaskIDKey.String(val) +} + +// AWSECSTaskRevision returns an attribute KeyValue conforming to the +// "aws.ecs.task.revision" semantic conventions. It represents the revision for +// the task definition used to create the ECS task. +func AWSECSTaskRevision(val string) attribute.KeyValue { + return AWSECSTaskRevisionKey.String(val) +} + +// AWSEKSClusterARN returns an attribute KeyValue conforming to the +// "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS +// cluster. +func AWSEKSClusterARN(val string) attribute.KeyValue { + return AWSEKSClusterARNKey.String(val) +} + +// AWSExtendedRequestID returns an attribute KeyValue conforming to the +// "aws.extended_request_id" semantic conventions. It represents the AWS extended +// request ID as returned in the response header `x-amz-id-2`. +func AWSExtendedRequestID(val string) attribute.KeyValue { + return AWSExtendedRequestIDKey.String(val) +} + +// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the +// "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked +// ARN as provided on the `Context` passed to the function ( +// `Lambda-Runtime-Invoked-Function-Arn` header on the `/runtime/invocation/next` +// applicable). +func AWSLambdaInvokedARN(val string) attribute.KeyValue { + return AWSLambdaInvokedARNKey.String(val) +} + +// AWSLogGroupARNs returns an attribute KeyValue conforming to the +// "aws.log.group.arns" semantic conventions. It represents the Amazon Resource +// Name(s) (ARN) of the AWS log group(s). +func AWSLogGroupARNs(val ...string) attribute.KeyValue { + return AWSLogGroupARNsKey.StringSlice(val) +} + +// AWSLogGroupNames returns an attribute KeyValue conforming to the +// "aws.log.group.names" semantic conventions. It represents the name(s) of the +// AWS log group(s) an application is writing to. +func AWSLogGroupNames(val ...string) attribute.KeyValue { + return AWSLogGroupNamesKey.StringSlice(val) +} + +// AWSLogStreamARNs returns an attribute KeyValue conforming to the +// "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the +// AWS log stream(s). +func AWSLogStreamARNs(val ...string) attribute.KeyValue { + return AWSLogStreamARNsKey.StringSlice(val) +} + +// AWSLogStreamNames returns an attribute KeyValue conforming to the +// "aws.log.stream.names" semantic conventions. It represents the name(s) of the +// AWS log stream(s) an application is writing to. +func AWSLogStreamNames(val ...string) attribute.KeyValue { + return AWSLogStreamNamesKey.StringSlice(val) +} + +// AWSRequestID returns an attribute KeyValue conforming to the "aws.request_id" +// semantic conventions. It represents the AWS request ID as returned in the +// response headers `x-amzn-requestid`, `x-amzn-request-id` or `x-amz-request-id` +// . +func AWSRequestID(val string) attribute.KeyValue { + return AWSRequestIDKey.String(val) +} + +// AWSS3Bucket returns an attribute KeyValue conforming to the "aws.s3.bucket" +// semantic conventions. It represents the S3 bucket name the request refers to. +// Corresponds to the `--bucket` parameter of the [S3 API] operations. +// +// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html +func AWSS3Bucket(val string) attribute.KeyValue { + return AWSS3BucketKey.String(val) +} + +// AWSS3CopySource returns an attribute KeyValue conforming to the +// "aws.s3.copy_source" semantic conventions. It represents the source object (in +// the form `bucket`/`key`) for the copy operation. +func AWSS3CopySource(val string) attribute.KeyValue { + return AWSS3CopySourceKey.String(val) +} + +// AWSS3Delete returns an attribute KeyValue conforming to the "aws.s3.delete" +// semantic conventions. It represents the delete request container that +// specifies the objects to be deleted. +func AWSS3Delete(val string) attribute.KeyValue { + return AWSS3DeleteKey.String(val) +} + +// AWSS3Key returns an attribute KeyValue conforming to the "aws.s3.key" semantic +// conventions. It represents the S3 object key the request refers to. +// Corresponds to the `--key` parameter of the [S3 API] operations. +// +// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html +func AWSS3Key(val string) attribute.KeyValue { + return AWSS3KeyKey.String(val) +} + +// AWSS3PartNumber returns an attribute KeyValue conforming to the +// "aws.s3.part_number" semantic conventions. It represents the part number of +// the part being uploaded in a multipart-upload operation. This is a positive +// integer between 1 and 10,000. +func AWSS3PartNumber(val int) attribute.KeyValue { + return AWSS3PartNumberKey.Int(val) +} + +// AWSS3UploadID returns an attribute KeyValue conforming to the +// "aws.s3.upload_id" semantic conventions. It represents the upload ID that +// identifies the multipart upload. +func AWSS3UploadID(val string) attribute.KeyValue { + return AWSS3UploadIDKey.String(val) +} + +// Enum values for aws.ecs.launchtype +var ( + // ec2 + // Stability: development + AWSECSLaunchtypeEC2 = AWSECSLaunchtypeKey.String("ec2") + // fargate + // Stability: development + AWSECSLaunchtypeFargate = AWSECSLaunchtypeKey.String("fargate") +) + +// Namespace: az +const ( + // AzNamespaceKey is the attribute Key conforming to the "az.namespace" semantic + // conventions. It represents the [Azure Resource Provider Namespace] as + // recognized by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Microsoft.Storage", "Microsoft.KeyVault", "Microsoft.ServiceBus" + // + // [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers + AzNamespaceKey = attribute.Key("az.namespace") + + // AzServiceRequestIDKey is the attribute Key conforming to the + // "az.service_request_id" semantic conventions. It represents the unique + // identifier of the service request. It's generated by the Azure service and + // returned with the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "00000000-0000-0000-0000-000000000000" + AzServiceRequestIDKey = attribute.Key("az.service_request_id") +) + +// AzNamespace returns an attribute KeyValue conforming to the "az.namespace" +// semantic conventions. It represents the [Azure Resource Provider Namespace] as +// recognized by the client. +// +// [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers +func AzNamespace(val string) attribute.KeyValue { + return AzNamespaceKey.String(val) +} + +// AzServiceRequestID returns an attribute KeyValue conforming to the +// "az.service_request_id" semantic conventions. It represents the unique +// identifier of the service request. It's generated by the Azure service and +// returned with the response. +func AzServiceRequestID(val string) attribute.KeyValue { + return AzServiceRequestIDKey.String(val) +} + +// Namespace: azure +const ( + // AzureClientIDKey is the attribute Key conforming to the "azure.client.id" + // semantic conventions. It represents the unique identifier of the client + // instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "3ba4827d-4422-483f-b59f-85b74211c11d", "storage-client-1" + AzureClientIDKey = attribute.Key("azure.client.id") + + // AzureCosmosDBConnectionModeKey is the attribute Key conforming to the + // "azure.cosmosdb.connection.mode" semantic conventions. It represents the + // cosmos client connection mode. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AzureCosmosDBConnectionModeKey = attribute.Key("azure.cosmosdb.connection.mode") + + // AzureCosmosDBConsistencyLevelKey is the attribute Key conforming to the + // "azure.cosmosdb.consistency.level" semantic conventions. It represents the + // account or request [consistency level]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Eventual", "ConsistentPrefix", "BoundedStaleness", "Strong", + // "Session" + // + // [consistency level]: https://learn.microsoft.com/azure/cosmos-db/consistency-levels + AzureCosmosDBConsistencyLevelKey = attribute.Key("azure.cosmosdb.consistency.level") + + // AzureCosmosDBOperationContactedRegionsKey is the attribute Key conforming to + // the "azure.cosmosdb.operation.contacted_regions" semantic conventions. It + // represents the list of regions contacted during operation in the order that + // they were contacted. If there is more than one region listed, it indicates + // that the operation was performed on multiple regions i.e. cross-regional + // call. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "North Central US", "Australia East", "Australia Southeast" + // Note: Region name matches the format of `displayName` in [Azure Location API] + // + // [Azure Location API]: https://learn.microsoft.com/rest/api/subscription/subscriptions/list-locations?view=rest-subscription-2021-10-01&tabs=HTTP#location + AzureCosmosDBOperationContactedRegionsKey = attribute.Key("azure.cosmosdb.operation.contacted_regions") + + // AzureCosmosDBOperationRequestChargeKey is the attribute Key conforming to the + // "azure.cosmosdb.operation.request_charge" semantic conventions. It represents + // the number of request units consumed by the operation. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 46.18, 1.0 + AzureCosmosDBOperationRequestChargeKey = attribute.Key("azure.cosmosdb.operation.request_charge") + + // AzureCosmosDBRequestBodySizeKey is the attribute Key conforming to the + // "azure.cosmosdb.request.body.size" semantic conventions. It represents the + // request payload size in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AzureCosmosDBRequestBodySizeKey = attribute.Key("azure.cosmosdb.request.body.size") + + // AzureCosmosDBResponseSubStatusCodeKey is the attribute Key conforming to the + // "azure.cosmosdb.response.sub_status_code" semantic conventions. It represents + // the cosmos DB sub status code. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1000, 1002 + AzureCosmosDBResponseSubStatusCodeKey = attribute.Key("azure.cosmosdb.response.sub_status_code") +) + +// AzureClientID returns an attribute KeyValue conforming to the +// "azure.client.id" semantic conventions. It represents the unique identifier of +// the client instance. +func AzureClientID(val string) attribute.KeyValue { + return AzureClientIDKey.String(val) +} + +// AzureCosmosDBOperationContactedRegions returns an attribute KeyValue +// conforming to the "azure.cosmosdb.operation.contacted_regions" semantic +// conventions. It represents the list of regions contacted during operation in +// the order that they were contacted. If there is more than one region listed, +// it indicates that the operation was performed on multiple regions i.e. +// cross-regional call. +func AzureCosmosDBOperationContactedRegions(val ...string) attribute.KeyValue { + return AzureCosmosDBOperationContactedRegionsKey.StringSlice(val) +} + +// AzureCosmosDBOperationRequestCharge returns an attribute KeyValue conforming +// to the "azure.cosmosdb.operation.request_charge" semantic conventions. It +// represents the number of request units consumed by the operation. +func AzureCosmosDBOperationRequestCharge(val float64) attribute.KeyValue { + return AzureCosmosDBOperationRequestChargeKey.Float64(val) +} + +// AzureCosmosDBRequestBodySize returns an attribute KeyValue conforming to the +// "azure.cosmosdb.request.body.size" semantic conventions. It represents the +// request payload size in bytes. +func AzureCosmosDBRequestBodySize(val int) attribute.KeyValue { + return AzureCosmosDBRequestBodySizeKey.Int(val) +} + +// AzureCosmosDBResponseSubStatusCode returns an attribute KeyValue conforming to +// the "azure.cosmosdb.response.sub_status_code" semantic conventions. It +// represents the cosmos DB sub status code. +func AzureCosmosDBResponseSubStatusCode(val int) attribute.KeyValue { + return AzureCosmosDBResponseSubStatusCodeKey.Int(val) +} + +// Enum values for azure.cosmosdb.connection.mode +var ( + // Gateway (HTTP) connection. + // Stability: development + AzureCosmosDBConnectionModeGateway = AzureCosmosDBConnectionModeKey.String("gateway") + // Direct connection. + // Stability: development + AzureCosmosDBConnectionModeDirect = AzureCosmosDBConnectionModeKey.String("direct") +) + +// Enum values for azure.cosmosdb.consistency.level +var ( + // strong + // Stability: development + AzureCosmosDBConsistencyLevelStrong = AzureCosmosDBConsistencyLevelKey.String("Strong") + // bounded_staleness + // Stability: development + AzureCosmosDBConsistencyLevelBoundedStaleness = AzureCosmosDBConsistencyLevelKey.String("BoundedStaleness") + // session + // Stability: development + AzureCosmosDBConsistencyLevelSession = AzureCosmosDBConsistencyLevelKey.String("Session") + // eventual + // Stability: development + AzureCosmosDBConsistencyLevelEventual = AzureCosmosDBConsistencyLevelKey.String("Eventual") + // consistent_prefix + // Stability: development + AzureCosmosDBConsistencyLevelConsistentPrefix = AzureCosmosDBConsistencyLevelKey.String("ConsistentPrefix") +) + +// Namespace: browser +const ( + // BrowserBrandsKey is the attribute Key conforming to the "browser.brands" + // semantic conventions. It represents the array of brand name and version + // separated by a space. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: " Not A;Brand 99", "Chromium 99", "Chrome 99" + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.brands`). + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + BrowserBrandsKey = attribute.Key("browser.brands") + + // BrowserLanguageKey is the attribute Key conforming to the "browser.language" + // semantic conventions. It represents the preferred language of the user using + // the browser. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "en", "en-US", "fr", "fr-FR" + // Note: This value is intended to be taken from the Navigator API + // `navigator.language`. + BrowserLanguageKey = attribute.Key("browser.language") + + // BrowserMobileKey is the attribute Key conforming to the "browser.mobile" + // semantic conventions. It represents a boolean that is true if the browser is + // running on a mobile device. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.mobile`). If unavailable, this attribute SHOULD be + // left unset. + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + BrowserMobileKey = attribute.Key("browser.mobile") + + // BrowserPlatformKey is the attribute Key conforming to the "browser.platform" + // semantic conventions. It represents the platform on which the browser is + // running. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Windows", "macOS", "Android" + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.platform`). If unavailable, the legacy + // `navigator.platform` API SHOULD NOT be used instead and this attribute SHOULD + // be left unset in order for the values to be consistent. + // The list of possible values is defined in the + // [W3C User-Agent Client Hints specification]. Note that some (but not all) of + // these values can overlap with values in the + // [`os.type` and `os.name` attributes]. However, for consistency, the values in + // the `browser.platform` attribute should capture the exact value that the user + // agent provides. + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + // [W3C User-Agent Client Hints specification]: https://wicg.github.io/ua-client-hints/#sec-ch-ua-platform + // [`os.type` and `os.name` attributes]: ./os.md + BrowserPlatformKey = attribute.Key("browser.platform") +) + +// BrowserBrands returns an attribute KeyValue conforming to the "browser.brands" +// semantic conventions. It represents the array of brand name and version +// separated by a space. +func BrowserBrands(val ...string) attribute.KeyValue { + return BrowserBrandsKey.StringSlice(val) +} + +// BrowserLanguage returns an attribute KeyValue conforming to the +// "browser.language" semantic conventions. It represents the preferred language +// of the user using the browser. +func BrowserLanguage(val string) attribute.KeyValue { + return BrowserLanguageKey.String(val) +} + +// BrowserMobile returns an attribute KeyValue conforming to the "browser.mobile" +// semantic conventions. It represents a boolean that is true if the browser is +// running on a mobile device. +func BrowserMobile(val bool) attribute.KeyValue { + return BrowserMobileKey.Bool(val) +} + +// BrowserPlatform returns an attribute KeyValue conforming to the +// "browser.platform" semantic conventions. It represents the platform on which +// the browser is running. +func BrowserPlatform(val string) attribute.KeyValue { + return BrowserPlatformKey.String(val) +} + +// Namespace: cassandra +const ( + // CassandraConsistencyLevelKey is the attribute Key conforming to the + // "cassandra.consistency.level" semantic conventions. It represents the + // consistency level of the query. Based on consistency values from [CQL]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [CQL]: https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html + CassandraConsistencyLevelKey = attribute.Key("cassandra.consistency.level") + + // CassandraCoordinatorDCKey is the attribute Key conforming to the + // "cassandra.coordinator.dc" semantic conventions. It represents the data + // center of the coordinating node for a query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: us-west-2 + CassandraCoordinatorDCKey = attribute.Key("cassandra.coordinator.dc") + + // CassandraCoordinatorIDKey is the attribute Key conforming to the + // "cassandra.coordinator.id" semantic conventions. It represents the ID of the + // coordinating node for a query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: be13faa2-8574-4d71-926d-27f16cf8a7af + CassandraCoordinatorIDKey = attribute.Key("cassandra.coordinator.id") + + // CassandraPageSizeKey is the attribute Key conforming to the + // "cassandra.page.size" semantic conventions. It represents the fetch size used + // for paging, i.e. how many rows will be returned at once. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 5000 + CassandraPageSizeKey = attribute.Key("cassandra.page.size") + + // CassandraQueryIdempotentKey is the attribute Key conforming to the + // "cassandra.query.idempotent" semantic conventions. It represents the whether + // or not the query is idempotent. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + CassandraQueryIdempotentKey = attribute.Key("cassandra.query.idempotent") + + // CassandraSpeculativeExecutionCountKey is the attribute Key conforming to the + // "cassandra.speculative_execution.count" semantic conventions. It represents + // the number of times a query was speculatively executed. Not set or `0` if the + // query was not executed speculatively. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 2 + CassandraSpeculativeExecutionCountKey = attribute.Key("cassandra.speculative_execution.count") +) + +// CassandraCoordinatorDC returns an attribute KeyValue conforming to the +// "cassandra.coordinator.dc" semantic conventions. It represents the data center +// of the coordinating node for a query. +func CassandraCoordinatorDC(val string) attribute.KeyValue { + return CassandraCoordinatorDCKey.String(val) +} + +// CassandraCoordinatorID returns an attribute KeyValue conforming to the +// "cassandra.coordinator.id" semantic conventions. It represents the ID of the +// coordinating node for a query. +func CassandraCoordinatorID(val string) attribute.KeyValue { + return CassandraCoordinatorIDKey.String(val) +} + +// CassandraPageSize returns an attribute KeyValue conforming to the +// "cassandra.page.size" semantic conventions. It represents the fetch size used +// for paging, i.e. how many rows will be returned at once. +func CassandraPageSize(val int) attribute.KeyValue { + return CassandraPageSizeKey.Int(val) +} + +// CassandraQueryIdempotent returns an attribute KeyValue conforming to the +// "cassandra.query.idempotent" semantic conventions. It represents the whether +// or not the query is idempotent. +func CassandraQueryIdempotent(val bool) attribute.KeyValue { + return CassandraQueryIdempotentKey.Bool(val) +} + +// CassandraSpeculativeExecutionCount returns an attribute KeyValue conforming to +// the "cassandra.speculative_execution.count" semantic conventions. It +// represents the number of times a query was speculatively executed. Not set or +// `0` if the query was not executed speculatively. +func CassandraSpeculativeExecutionCount(val int) attribute.KeyValue { + return CassandraSpeculativeExecutionCountKey.Int(val) +} + +// Enum values for cassandra.consistency.level +var ( + // all + // Stability: development + CassandraConsistencyLevelAll = CassandraConsistencyLevelKey.String("all") + // each_quorum + // Stability: development + CassandraConsistencyLevelEachQuorum = CassandraConsistencyLevelKey.String("each_quorum") + // quorum + // Stability: development + CassandraConsistencyLevelQuorum = CassandraConsistencyLevelKey.String("quorum") + // local_quorum + // Stability: development + CassandraConsistencyLevelLocalQuorum = CassandraConsistencyLevelKey.String("local_quorum") + // one + // Stability: development + CassandraConsistencyLevelOne = CassandraConsistencyLevelKey.String("one") + // two + // Stability: development + CassandraConsistencyLevelTwo = CassandraConsistencyLevelKey.String("two") + // three + // Stability: development + CassandraConsistencyLevelThree = CassandraConsistencyLevelKey.String("three") + // local_one + // Stability: development + CassandraConsistencyLevelLocalOne = CassandraConsistencyLevelKey.String("local_one") + // any + // Stability: development + CassandraConsistencyLevelAny = CassandraConsistencyLevelKey.String("any") + // serial + // Stability: development + CassandraConsistencyLevelSerial = CassandraConsistencyLevelKey.String("serial") + // local_serial + // Stability: development + CassandraConsistencyLevelLocalSerial = CassandraConsistencyLevelKey.String("local_serial") +) + +// Namespace: cicd +const ( + // CICDPipelineNameKey is the attribute Key conforming to the + // "cicd.pipeline.name" semantic conventions. It represents the human readable + // name of the pipeline within a CI/CD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Build and Test", "Lint", "Deploy Go Project", + // "deploy_to_environment" + CICDPipelineNameKey = attribute.Key("cicd.pipeline.name") + + // CICDPipelineResultKey is the attribute Key conforming to the + // "cicd.pipeline.result" semantic conventions. It represents the result of a + // pipeline run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "timeout", "skipped" + CICDPipelineResultKey = attribute.Key("cicd.pipeline.result") + + // CICDPipelineRunIDKey is the attribute Key conforming to the + // "cicd.pipeline.run.id" semantic conventions. It represents the unique + // identifier of a pipeline run within a CI/CD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "120912" + CICDPipelineRunIDKey = attribute.Key("cicd.pipeline.run.id") + + // CICDPipelineRunStateKey is the attribute Key conforming to the + // "cicd.pipeline.run.state" semantic conventions. It represents the pipeline + // run goes through these states during its lifecycle. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pending", "executing", "finalizing" + CICDPipelineRunStateKey = attribute.Key("cicd.pipeline.run.state") + + // CICDPipelineTaskNameKey is the attribute Key conforming to the + // "cicd.pipeline.task.name" semantic conventions. It represents the human + // readable name of a task within a pipeline. Task here most closely aligns with + // a [computing process] in a pipeline. Other terms for tasks include commands, + // steps, and procedures. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Run GoLang Linter", "Go Build", "go-test", "deploy_binary" + // + // [computing process]: https://wikipedia.org/wiki/Pipeline_(computing) + CICDPipelineTaskNameKey = attribute.Key("cicd.pipeline.task.name") + + // CICDPipelineTaskRunIDKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.id" semantic conventions. It represents the unique + // identifier of a task run within a pipeline. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "12097" + CICDPipelineTaskRunIDKey = attribute.Key("cicd.pipeline.task.run.id") + + // CICDPipelineTaskRunURLFullKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.url.full" semantic conventions. It represents the + // [URL] of the pipeline run providing the complete address in order to locate + // and identify the pipeline run. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763/job/26920038674?pr=1075" + // + // [URL]: https://wikipedia.org/wiki/URL + CICDPipelineTaskRunURLFullKey = attribute.Key("cicd.pipeline.task.run.url.full") + + // CICDPipelineTaskTypeKey is the attribute Key conforming to the + // "cicd.pipeline.task.type" semantic conventions. It represents the type of the + // task within a pipeline. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "build", "test", "deploy" + CICDPipelineTaskTypeKey = attribute.Key("cicd.pipeline.task.type") + + // CICDSystemComponentKey is the attribute Key conforming to the + // "cicd.system.component" semantic conventions. It represents the name of a + // component of the CICD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "controller", "scheduler", "agent" + CICDSystemComponentKey = attribute.Key("cicd.system.component") + + // CICDWorkerStateKey is the attribute Key conforming to the "cicd.worker.state" + // semantic conventions. It represents the state of a CICD worker / agent. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "idle", "busy", "down" + CICDWorkerStateKey = attribute.Key("cicd.worker.state") +) + +// CICDPipelineName returns an attribute KeyValue conforming to the +// "cicd.pipeline.name" semantic conventions. It represents the human readable +// name of the pipeline within a CI/CD system. +func CICDPipelineName(val string) attribute.KeyValue { + return CICDPipelineNameKey.String(val) +} + +// CICDPipelineRunID returns an attribute KeyValue conforming to the +// "cicd.pipeline.run.id" semantic conventions. It represents the unique +// identifier of a pipeline run within a CI/CD system. +func CICDPipelineRunID(val string) attribute.KeyValue { + return CICDPipelineRunIDKey.String(val) +} + +// CICDPipelineTaskName returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.name" semantic conventions. It represents the human +// readable name of a task within a pipeline. Task here most closely aligns with +// a [computing process] in a pipeline. Other terms for tasks include commands, +// steps, and procedures. +// +// [computing process]: https://wikipedia.org/wiki/Pipeline_(computing) +func CICDPipelineTaskName(val string) attribute.KeyValue { + return CICDPipelineTaskNameKey.String(val) +} + +// CICDPipelineTaskRunID returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.run.id" semantic conventions. It represents the unique +// identifier of a task run within a pipeline. +func CICDPipelineTaskRunID(val string) attribute.KeyValue { + return CICDPipelineTaskRunIDKey.String(val) +} + +// CICDPipelineTaskRunURLFull returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.run.url.full" semantic conventions. It represents the +// [URL] of the pipeline run providing the complete address in order to locate +// and identify the pipeline run. +// +// [URL]: https://wikipedia.org/wiki/URL +func CICDPipelineTaskRunURLFull(val string) attribute.KeyValue { + return CICDPipelineTaskRunURLFullKey.String(val) +} + +// CICDSystemComponent returns an attribute KeyValue conforming to the +// "cicd.system.component" semantic conventions. It represents the name of a +// component of the CICD system. +func CICDSystemComponent(val string) attribute.KeyValue { + return CICDSystemComponentKey.String(val) +} + +// Enum values for cicd.pipeline.result +var ( + // The pipeline run finished successfully. + // Stability: development + CICDPipelineResultSuccess = CICDPipelineResultKey.String("success") + // The pipeline run did not finish successfully, eg. due to a compile error or a + // failing test. Such failures are usually detected by non-zero exit codes of + // the tools executed in the pipeline run. + // Stability: development + CICDPipelineResultFailure = CICDPipelineResultKey.String("failure") + // The pipeline run failed due to an error in the CICD system, eg. due to the + // worker being killed. + // Stability: development + CICDPipelineResultError = CICDPipelineResultKey.String("error") + // A timeout caused the pipeline run to be interrupted. + // Stability: development + CICDPipelineResultTimeout = CICDPipelineResultKey.String("timeout") + // The pipeline run was cancelled, eg. by a user manually cancelling the + // pipeline run. + // Stability: development + CICDPipelineResultCancellation = CICDPipelineResultKey.String("cancellation") + // The pipeline run was skipped, eg. due to a precondition not being met. + // Stability: development + CICDPipelineResultSkip = CICDPipelineResultKey.String("skip") +) + +// Enum values for cicd.pipeline.run.state +var ( + // The run pending state spans from the event triggering the pipeline run until + // the execution of the run starts (eg. time spent in a queue, provisioning + // agents, creating run resources). + // + // Stability: development + CICDPipelineRunStatePending = CICDPipelineRunStateKey.String("pending") + // The executing state spans the execution of any run tasks (eg. build, test). + // Stability: development + CICDPipelineRunStateExecuting = CICDPipelineRunStateKey.String("executing") + // The finalizing state spans from when the run has finished executing (eg. + // cleanup of run resources). + // Stability: development + CICDPipelineRunStateFinalizing = CICDPipelineRunStateKey.String("finalizing") +) + +// Enum values for cicd.pipeline.task.type +var ( + // build + // Stability: development + CICDPipelineTaskTypeBuild = CICDPipelineTaskTypeKey.String("build") + // test + // Stability: development + CICDPipelineTaskTypeTest = CICDPipelineTaskTypeKey.String("test") + // deploy + // Stability: development + CICDPipelineTaskTypeDeploy = CICDPipelineTaskTypeKey.String("deploy") +) + +// Enum values for cicd.worker.state +var ( + // The worker is not performing work for the CICD system. It is available to the + // CICD system to perform work on (online / idle). + // Stability: development + CICDWorkerStateAvailable = CICDWorkerStateKey.String("available") + // The worker is performing work for the CICD system. + // Stability: development + CICDWorkerStateBusy = CICDWorkerStateKey.String("busy") + // The worker is not available to the CICD system (disconnected / down). + // Stability: development + CICDWorkerStateOffline = CICDWorkerStateKey.String("offline") +) + +// Namespace: client +const ( + // ClientAddressKey is the attribute Key conforming to the "client.address" + // semantic conventions. It represents the client address - domain name if + // available without reverse DNS lookup; otherwise, IP address or Unix domain + // socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "client.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the server side, and when communicating through an + // intermediary, `client.address` SHOULD represent the client address behind any + // intermediaries, for example proxies, if it's available. + ClientAddressKey = attribute.Key("client.address") + + // ClientPortKey is the attribute Key conforming to the "client.port" semantic + // conventions. It represents the client port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + // Note: When observed from the server side, and when communicating through an + // intermediary, `client.port` SHOULD represent the client port behind any + // intermediaries, for example proxies, if it's available. + ClientPortKey = attribute.Key("client.port") +) + +// ClientAddress returns an attribute KeyValue conforming to the "client.address" +// semantic conventions. It represents the client address - domain name if +// available without reverse DNS lookup; otherwise, IP address or Unix domain +// socket name. +func ClientAddress(val string) attribute.KeyValue { + return ClientAddressKey.String(val) +} + +// ClientPort returns an attribute KeyValue conforming to the "client.port" +// semantic conventions. It represents the client port number. +func ClientPort(val int) attribute.KeyValue { + return ClientPortKey.Int(val) +} + +// Namespace: cloud +const ( + // CloudAccountIDKey is the attribute Key conforming to the "cloud.account.id" + // semantic conventions. It represents the cloud account ID the resource is + // assigned to. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "111111111111", "opentelemetry" + CloudAccountIDKey = attribute.Key("cloud.account.id") + + // CloudAvailabilityZoneKey is the attribute Key conforming to the + // "cloud.availability_zone" semantic conventions. It represents the cloud + // regions often have multiple, isolated locations known as zones to increase + // availability. Availability zone represents the zone where the resource is + // running. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-east-1c" + // Note: Availability zones are called "zones" on Alibaba Cloud and Google + // Cloud. + CloudAvailabilityZoneKey = attribute.Key("cloud.availability_zone") + + // CloudPlatformKey is the attribute Key conforming to the "cloud.platform" + // semantic conventions. It represents the cloud platform in use. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The prefix of the service SHOULD match the one specified in + // `cloud.provider`. + CloudPlatformKey = attribute.Key("cloud.platform") + + // CloudProviderKey is the attribute Key conforming to the "cloud.provider" + // semantic conventions. It represents the name of the cloud provider. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + CloudProviderKey = attribute.Key("cloud.provider") + + // CloudRegionKey is the attribute Key conforming to the "cloud.region" semantic + // conventions. It represents the geographical region the resource is running. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-central1", "us-east-1" + // Note: Refer to your provider's docs to see the available regions, for example + // [Alibaba Cloud regions], [AWS regions], [Azure regions], + // [Google Cloud regions], or [Tencent Cloud regions]. + // + // [Alibaba Cloud regions]: https://www.alibabacloud.com/help/doc-detail/40654.htm + // [AWS regions]: https://aws.amazon.com/about-aws/global-infrastructure/regions_az/ + // [Azure regions]: https://azure.microsoft.com/global-infrastructure/geographies/ + // [Google Cloud regions]: https://cloud.google.com/about/locations + // [Tencent Cloud regions]: https://www.tencentcloud.com/document/product/213/6091 + CloudRegionKey = attribute.Key("cloud.region") + + // CloudResourceIDKey is the attribute Key conforming to the "cloud.resource_id" + // semantic conventions. It represents the cloud provider-specific native + // identifier of the monitored cloud resource (e.g. an [ARN] on AWS, a + // [fully qualified resource ID] on Azure, a [full resource name] on GCP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:lambda:REGION:ACCOUNT_ID:function:my-function", + // "//run.googleapis.com/projects/PROJECT_ID/locations/LOCATION_ID/services/SERVICE_ID", + // "/subscriptions//resourceGroups/ + // /providers/Microsoft.Web/sites//functions/" + // Note: On some cloud providers, it may not be possible to determine the full + // ID at startup, + // so it may be necessary to set `cloud.resource_id` as a span attribute + // instead. + // + // The exact value to use for `cloud.resource_id` depends on the cloud provider. + // The following well-known definitions MUST be used if you set this attribute + // and they apply: + // + // - **AWS Lambda:** The function [ARN]. + // Take care not to use the "invoked ARN" directly but replace any + // [alias suffix] + // with the resolved function version, as the same runtime instance may be + // invocable with + // multiple different aliases. + // - **GCP:** The [URI of the resource] + // - **Azure:** The [Fully Qualified Resource ID] of the invoked function, + // *not* the function app, having the form + // + // `/subscriptions//resourceGroups//providers/Microsoft.Web/sites//functions/` + // . + // This means that a span attribute MUST be used, as an Azure function app + // can host multiple functions that would usually share + // a TracerProvider. + // + // + // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html + // [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id + // [full resource name]: https://cloud.google.com/apis/design/resource_names#full_resource_name + // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html + // [alias suffix]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-aliases.html + // [URI of the resource]: https://cloud.google.com/iam/docs/full-resource-names + // [Fully Qualified Resource ID]: https://docs.microsoft.com/rest/api/resources/resources/get-by-id + CloudResourceIDKey = attribute.Key("cloud.resource_id") +) + +// CloudAccountID returns an attribute KeyValue conforming to the +// "cloud.account.id" semantic conventions. It represents the cloud account ID +// the resource is assigned to. +func CloudAccountID(val string) attribute.KeyValue { + return CloudAccountIDKey.String(val) +} + +// CloudAvailabilityZone returns an attribute KeyValue conforming to the +// "cloud.availability_zone" semantic conventions. It represents the cloud +// regions often have multiple, isolated locations known as zones to increase +// availability. Availability zone represents the zone where the resource is +// running. +func CloudAvailabilityZone(val string) attribute.KeyValue { + return CloudAvailabilityZoneKey.String(val) +} + +// CloudRegion returns an attribute KeyValue conforming to the "cloud.region" +// semantic conventions. It represents the geographical region the resource is +// running. +func CloudRegion(val string) attribute.KeyValue { + return CloudRegionKey.String(val) +} + +// CloudResourceID returns an attribute KeyValue conforming to the +// "cloud.resource_id" semantic conventions. It represents the cloud +// provider-specific native identifier of the monitored cloud resource (e.g. an +// [ARN] on AWS, a [fully qualified resource ID] on Azure, a [full resource name] +// on GCP). +// +// [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html +// [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id +// [full resource name]: https://cloud.google.com/apis/design/resource_names#full_resource_name +func CloudResourceID(val string) attribute.KeyValue { + return CloudResourceIDKey.String(val) +} + +// Enum values for cloud.platform +var ( + // Alibaba Cloud Elastic Compute Service + // Stability: development + CloudPlatformAlibabaCloudECS = CloudPlatformKey.String("alibaba_cloud_ecs") + // Alibaba Cloud Function Compute + // Stability: development + CloudPlatformAlibabaCloudFc = CloudPlatformKey.String("alibaba_cloud_fc") + // Red Hat OpenShift on Alibaba Cloud + // Stability: development + CloudPlatformAlibabaCloudOpenshift = CloudPlatformKey.String("alibaba_cloud_openshift") + // AWS Elastic Compute Cloud + // Stability: development + CloudPlatformAWSEC2 = CloudPlatformKey.String("aws_ec2") + // AWS Elastic Container Service + // Stability: development + CloudPlatformAWSECS = CloudPlatformKey.String("aws_ecs") + // AWS Elastic Kubernetes Service + // Stability: development + CloudPlatformAWSEKS = CloudPlatformKey.String("aws_eks") + // AWS Lambda + // Stability: development + CloudPlatformAWSLambda = CloudPlatformKey.String("aws_lambda") + // AWS Elastic Beanstalk + // Stability: development + CloudPlatformAWSElasticBeanstalk = CloudPlatformKey.String("aws_elastic_beanstalk") + // AWS App Runner + // Stability: development + CloudPlatformAWSAppRunner = CloudPlatformKey.String("aws_app_runner") + // Red Hat OpenShift on AWS (ROSA) + // Stability: development + CloudPlatformAWSOpenshift = CloudPlatformKey.String("aws_openshift") + // Azure Virtual Machines + // Stability: development + CloudPlatformAzureVM = CloudPlatformKey.String("azure_vm") + // Azure Container Apps + // Stability: development + CloudPlatformAzureContainerApps = CloudPlatformKey.String("azure_container_apps") + // Azure Container Instances + // Stability: development + CloudPlatformAzureContainerInstances = CloudPlatformKey.String("azure_container_instances") + // Azure Kubernetes Service + // Stability: development + CloudPlatformAzureAKS = CloudPlatformKey.String("azure_aks") + // Azure Functions + // Stability: development + CloudPlatformAzureFunctions = CloudPlatformKey.String("azure_functions") + // Azure App Service + // Stability: development + CloudPlatformAzureAppService = CloudPlatformKey.String("azure_app_service") + // Azure Red Hat OpenShift + // Stability: development + CloudPlatformAzureOpenshift = CloudPlatformKey.String("azure_openshift") + // Google Bare Metal Solution (BMS) + // Stability: development + CloudPlatformGCPBareMetalSolution = CloudPlatformKey.String("gcp_bare_metal_solution") + // Google Cloud Compute Engine (GCE) + // Stability: development + CloudPlatformGCPComputeEngine = CloudPlatformKey.String("gcp_compute_engine") + // Google Cloud Run + // Stability: development + CloudPlatformGCPCloudRun = CloudPlatformKey.String("gcp_cloud_run") + // Google Cloud Kubernetes Engine (GKE) + // Stability: development + CloudPlatformGCPKubernetesEngine = CloudPlatformKey.String("gcp_kubernetes_engine") + // Google Cloud Functions (GCF) + // Stability: development + CloudPlatformGCPCloudFunctions = CloudPlatformKey.String("gcp_cloud_functions") + // Google Cloud App Engine (GAE) + // Stability: development + CloudPlatformGCPAppEngine = CloudPlatformKey.String("gcp_app_engine") + // Red Hat OpenShift on Google Cloud + // Stability: development + CloudPlatformGCPOpenshift = CloudPlatformKey.String("gcp_openshift") + // Red Hat OpenShift on IBM Cloud + // Stability: development + CloudPlatformIbmCloudOpenshift = CloudPlatformKey.String("ibm_cloud_openshift") + // Compute on Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudPlatformOracleCloudCompute = CloudPlatformKey.String("oracle_cloud_compute") + // Kubernetes Engine (OKE) on Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudPlatformOracleCloudOke = CloudPlatformKey.String("oracle_cloud_oke") + // Tencent Cloud Cloud Virtual Machine (CVM) + // Stability: development + CloudPlatformTencentCloudCvm = CloudPlatformKey.String("tencent_cloud_cvm") + // Tencent Cloud Elastic Kubernetes Service (EKS) + // Stability: development + CloudPlatformTencentCloudEKS = CloudPlatformKey.String("tencent_cloud_eks") + // Tencent Cloud Serverless Cloud Function (SCF) + // Stability: development + CloudPlatformTencentCloudScf = CloudPlatformKey.String("tencent_cloud_scf") +) + +// Enum values for cloud.provider +var ( + // Alibaba Cloud + // Stability: development + CloudProviderAlibabaCloud = CloudProviderKey.String("alibaba_cloud") + // Amazon Web Services + // Stability: development + CloudProviderAWS = CloudProviderKey.String("aws") + // Microsoft Azure + // Stability: development + CloudProviderAzure = CloudProviderKey.String("azure") + // Google Cloud Platform + // Stability: development + CloudProviderGCP = CloudProviderKey.String("gcp") + // Heroku Platform as a Service + // Stability: development + CloudProviderHeroku = CloudProviderKey.String("heroku") + // IBM Cloud + // Stability: development + CloudProviderIbmCloud = CloudProviderKey.String("ibm_cloud") + // Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudProviderOracleCloud = CloudProviderKey.String("oracle_cloud") + // Tencent Cloud + // Stability: development + CloudProviderTencentCloud = CloudProviderKey.String("tencent_cloud") +) + +// Namespace: cloudevents +const ( + // CloudeventsEventIDKey is the attribute Key conforming to the + // "cloudevents.event_id" semantic conventions. It represents the [event_id] + // uniquely identifies the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123e4567-e89b-12d3-a456-426614174000", "0001" + // + // [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id + CloudeventsEventIDKey = attribute.Key("cloudevents.event_id") + + // CloudeventsEventSourceKey is the attribute Key conforming to the + // "cloudevents.event_source" semantic conventions. It represents the [source] + // identifies the context in which an event happened. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://github.com/cloudevents", "/cloudevents/spec/pull/123", + // "my-service" + // + // [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1 + CloudeventsEventSourceKey = attribute.Key("cloudevents.event_source") + + // CloudeventsEventSpecVersionKey is the attribute Key conforming to the + // "cloudevents.event_spec_version" semantic conventions. It represents the + // [version of the CloudEvents specification] which the event uses. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + // + // [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion + CloudeventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version") + + // CloudeventsEventSubjectKey is the attribute Key conforming to the + // "cloudevents.event_subject" semantic conventions. It represents the [subject] + // of the event in the context of the event producer (identified by source). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: mynewfile.jpg + // + // [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject + CloudeventsEventSubjectKey = attribute.Key("cloudevents.event_subject") + + // CloudeventsEventTypeKey is the attribute Key conforming to the + // "cloudevents.event_type" semantic conventions. It represents the [event_type] + // contains a value describing the type of event related to the originating + // occurrence. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "com.github.pull_request.opened", "com.example.object.deleted.v2" + // + // [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type + CloudeventsEventTypeKey = attribute.Key("cloudevents.event_type") +) + +// CloudeventsEventID returns an attribute KeyValue conforming to the +// "cloudevents.event_id" semantic conventions. It represents the [event_id] +// uniquely identifies the event. +// +// [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id +func CloudeventsEventID(val string) attribute.KeyValue { + return CloudeventsEventIDKey.String(val) +} + +// CloudeventsEventSource returns an attribute KeyValue conforming to the +// "cloudevents.event_source" semantic conventions. It represents the [source] +// identifies the context in which an event happened. +// +// [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1 +func CloudeventsEventSource(val string) attribute.KeyValue { + return CloudeventsEventSourceKey.String(val) +} + +// CloudeventsEventSpecVersion returns an attribute KeyValue conforming to the +// "cloudevents.event_spec_version" semantic conventions. It represents the +// [version of the CloudEvents specification] which the event uses. +// +// [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion +func CloudeventsEventSpecVersion(val string) attribute.KeyValue { + return CloudeventsEventSpecVersionKey.String(val) +} + +// CloudeventsEventSubject returns an attribute KeyValue conforming to the +// "cloudevents.event_subject" semantic conventions. It represents the [subject] +// of the event in the context of the event producer (identified by source). +// +// [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject +func CloudeventsEventSubject(val string) attribute.KeyValue { + return CloudeventsEventSubjectKey.String(val) +} + +// CloudeventsEventType returns an attribute KeyValue conforming to the +// "cloudevents.event_type" semantic conventions. It represents the [event_type] +// contains a value describing the type of event related to the originating +// occurrence. +// +// [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type +func CloudeventsEventType(val string) attribute.KeyValue { + return CloudeventsEventTypeKey.String(val) +} + +// Namespace: cloudfoundry +const ( + // CloudfoundryAppIDKey is the attribute Key conforming to the + // "cloudfoundry.app.id" semantic conventions. It represents the guid of the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.application_id`. This is the same value as + // reported by `cf app --guid`. + CloudfoundryAppIDKey = attribute.Key("cloudfoundry.app.id") + + // CloudfoundryAppInstanceIDKey is the attribute Key conforming to the + // "cloudfoundry.app.instance.id" semantic conventions. It represents the index + // of the application instance. 0 when just one instance is active. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0", "1" + // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope] + // . + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the application instance index for applications + // deployed on the runtime. + // + // Application instrumentation should use the value from environment + // variable `CF_INSTANCE_INDEX`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + CloudfoundryAppInstanceIDKey = attribute.Key("cloudfoundry.app.instance.id") + + // CloudfoundryAppNameKey is the attribute Key conforming to the + // "cloudfoundry.app.name" semantic conventions. It represents the name of the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-app-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.application_name`. This is the same value + // as reported by `cf apps`. + CloudfoundryAppNameKey = attribute.Key("cloudfoundry.app.name") + + // CloudfoundryOrgIDKey is the attribute Key conforming to the + // "cloudfoundry.org.id" semantic conventions. It represents the guid of the + // CloudFoundry org the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.org_id`. This is the same value as + // reported by `cf org --guid`. + CloudfoundryOrgIDKey = attribute.Key("cloudfoundry.org.id") + + // CloudfoundryOrgNameKey is the attribute Key conforming to the + // "cloudfoundry.org.name" semantic conventions. It represents the name of the + // CloudFoundry organization the app is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-org-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.org_name`. This is the same value as + // reported by `cf orgs`. + CloudfoundryOrgNameKey = attribute.Key("cloudfoundry.org.name") + + // CloudfoundryProcessIDKey is the attribute Key conforming to the + // "cloudfoundry.process.id" semantic conventions. It represents the UID + // identifying the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.process_id`. It is supposed to be equal to + // `VCAP_APPLICATION.app_id` for applications deployed to the runtime. + // For system components, this could be the actual PID. + CloudfoundryProcessIDKey = attribute.Key("cloudfoundry.process.id") + + // CloudfoundryProcessTypeKey is the attribute Key conforming to the + // "cloudfoundry.process.type" semantic conventions. It represents the type of + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "web" + // Note: CloudFoundry applications can consist of multiple jobs. Usually the + // main process will be of type `web`. There can be additional background + // tasks or side-cars with different process types. + CloudfoundryProcessTypeKey = attribute.Key("cloudfoundry.process.type") + + // CloudfoundrySpaceIDKey is the attribute Key conforming to the + // "cloudfoundry.space.id" semantic conventions. It represents the guid of the + // CloudFoundry space the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.space_id`. This is the same value as + // reported by `cf space --guid`. + CloudfoundrySpaceIDKey = attribute.Key("cloudfoundry.space.id") + + // CloudfoundrySpaceNameKey is the attribute Key conforming to the + // "cloudfoundry.space.name" semantic conventions. It represents the name of the + // CloudFoundry space the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-space-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.space_name`. This is the same value as + // reported by `cf spaces`. + CloudfoundrySpaceNameKey = attribute.Key("cloudfoundry.space.name") + + // CloudfoundrySystemIDKey is the attribute Key conforming to the + // "cloudfoundry.system.id" semantic conventions. It represents a guid or + // another name describing the event source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cf/gorouter" + // Note: CloudFoundry defines the `source_id` in the [Loggregator v2 envelope]. + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the component name, e.g. "gorouter", for + // CloudFoundry components. + // + // When system components are instrumented, values from the + // [Bosh spec] + // should be used. The `system.id` should be set to + // `spec.deployment/spec.name`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec + CloudfoundrySystemIDKey = attribute.Key("cloudfoundry.system.id") + + // CloudfoundrySystemInstanceIDKey is the attribute Key conforming to the + // "cloudfoundry.system.instance.id" semantic conventions. It represents a guid + // describing the concrete instance of the event source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope] + // . + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the vm id for CloudFoundry components. + // + // When system components are instrumented, values from the + // [Bosh spec] + // should be used. The `system.instance.id` should be set to `spec.id`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec + CloudfoundrySystemInstanceIDKey = attribute.Key("cloudfoundry.system.instance.id") +) + +// CloudfoundryAppID returns an attribute KeyValue conforming to the +// "cloudfoundry.app.id" semantic conventions. It represents the guid of the +// application. +func CloudfoundryAppID(val string) attribute.KeyValue { + return CloudfoundryAppIDKey.String(val) +} + +// CloudfoundryAppInstanceID returns an attribute KeyValue conforming to the +// "cloudfoundry.app.instance.id" semantic conventions. It represents the index +// of the application instance. 0 when just one instance is active. +func CloudfoundryAppInstanceID(val string) attribute.KeyValue { + return CloudfoundryAppInstanceIDKey.String(val) +} + +// CloudfoundryAppName returns an attribute KeyValue conforming to the +// "cloudfoundry.app.name" semantic conventions. It represents the name of the +// application. +func CloudfoundryAppName(val string) attribute.KeyValue { + return CloudfoundryAppNameKey.String(val) +} + +// CloudfoundryOrgID returns an attribute KeyValue conforming to the +// "cloudfoundry.org.id" semantic conventions. It represents the guid of the +// CloudFoundry org the application is running in. +func CloudfoundryOrgID(val string) attribute.KeyValue { + return CloudfoundryOrgIDKey.String(val) +} + +// CloudfoundryOrgName returns an attribute KeyValue conforming to the +// "cloudfoundry.org.name" semantic conventions. It represents the name of the +// CloudFoundry organization the app is running in. +func CloudfoundryOrgName(val string) attribute.KeyValue { + return CloudfoundryOrgNameKey.String(val) +} + +// CloudfoundryProcessID returns an attribute KeyValue conforming to the +// "cloudfoundry.process.id" semantic conventions. It represents the UID +// identifying the process. +func CloudfoundryProcessID(val string) attribute.KeyValue { + return CloudfoundryProcessIDKey.String(val) +} + +// CloudfoundryProcessType returns an attribute KeyValue conforming to the +// "cloudfoundry.process.type" semantic conventions. It represents the type of +// process. +func CloudfoundryProcessType(val string) attribute.KeyValue { + return CloudfoundryProcessTypeKey.String(val) +} + +// CloudfoundrySpaceID returns an attribute KeyValue conforming to the +// "cloudfoundry.space.id" semantic conventions. It represents the guid of the +// CloudFoundry space the application is running in. +func CloudfoundrySpaceID(val string) attribute.KeyValue { + return CloudfoundrySpaceIDKey.String(val) +} + +// CloudfoundrySpaceName returns an attribute KeyValue conforming to the +// "cloudfoundry.space.name" semantic conventions. It represents the name of the +// CloudFoundry space the application is running in. +func CloudfoundrySpaceName(val string) attribute.KeyValue { + return CloudfoundrySpaceNameKey.String(val) +} + +// CloudfoundrySystemID returns an attribute KeyValue conforming to the +// "cloudfoundry.system.id" semantic conventions. It represents a guid or another +// name describing the event source. +func CloudfoundrySystemID(val string) attribute.KeyValue { + return CloudfoundrySystemIDKey.String(val) +} + +// CloudfoundrySystemInstanceID returns an attribute KeyValue conforming to the +// "cloudfoundry.system.instance.id" semantic conventions. It represents a guid +// describing the concrete instance of the event source. +func CloudfoundrySystemInstanceID(val string) attribute.KeyValue { + return CloudfoundrySystemInstanceIDKey.String(val) +} + +// Namespace: code +const ( + // CodeColumnNumberKey is the attribute Key conforming to the + // "code.column.number" semantic conventions. It represents the column number in + // `code.file.path` best representing the operation. It SHOULD point within the + // code unit named in `code.function.name`. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + CodeColumnNumberKey = attribute.Key("code.column.number") + + // CodeFilePathKey is the attribute Key conforming to the "code.file.path" + // semantic conventions. It represents the source code file name that identifies + // the code unit as uniquely as possible (preferably an absolute file path). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: /usr/local/MyApplication/content_root/app/index.php + CodeFilePathKey = attribute.Key("code.file.path") + + // CodeFilepathKey is the attribute Key conforming to the "code.filepath" + // semantic conventions. It represents the deprecated, use `code.file.path` + // instead. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: /usr/local/MyApplication/content_root/app/index.php + CodeFilepathKey = attribute.Key("code.filepath") + + // CodeFunctionNameKey is the attribute Key conforming to the + // "code.function.name" semantic conventions. It represents the method or + // function name, or equivalent (usually rightmost part of the code unit's + // name). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: serveRequest + CodeFunctionNameKey = attribute.Key("code.function.name") + + // CodeLineNumberKey is the attribute Key conforming to the "code.line.number" + // semantic conventions. It represents the line number in `code.file.path` best + // representing the operation. It SHOULD point within the code unit named in + // `code.function.name`. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + CodeLineNumberKey = attribute.Key("code.line.number") + + // CodeNamespaceKey is the attribute Key conforming to the "code.namespace" + // semantic conventions. It represents the "namespace" within which + // `code.function.name` is defined. Usually the qualified class or module name, + // such that `code.namespace` + some separator + `code.function.name` form a + // unique identifier for the code unit. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: com.example.MyHttpService + CodeNamespaceKey = attribute.Key("code.namespace") + + // CodeStacktraceKey is the attribute Key conforming to the "code.stacktrace" + // semantic conventions. It represents a stacktrace as a string in the natural + // representation for the language runtime. The representation is to be + // determined and documented by each language SIG. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at + // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at + // com.example.GenerateTrace.main(GenerateTrace.java:5) + CodeStacktraceKey = attribute.Key("code.stacktrace") +) + +// CodeColumnNumber returns an attribute KeyValue conforming to the +// "code.column.number" semantic conventions. It represents the column number in +// `code.file.path` best representing the operation. It SHOULD point within the +// code unit named in `code.function.name`. +func CodeColumnNumber(val int) attribute.KeyValue { + return CodeColumnNumberKey.Int(val) +} + +// CodeFilePath returns an attribute KeyValue conforming to the "code.file.path" +// semantic conventions. It represents the source code file name that identifies +// the code unit as uniquely as possible (preferably an absolute file path). +func CodeFilePath(val string) attribute.KeyValue { + return CodeFilePathKey.String(val) +} + +// CodeFilepath returns an attribute KeyValue conforming to the "code.filepath" +// semantic conventions. It represents the deprecated, use `code.file.path` +// instead. +func CodeFilepath(val string) attribute.KeyValue { + return CodeFilepathKey.String(val) +} + +// CodeFunctionName returns an attribute KeyValue conforming to the +// "code.function.name" semantic conventions. It represents the method or +// function name, or equivalent (usually rightmost part of the code unit's name). +func CodeFunctionName(val string) attribute.KeyValue { + return CodeFunctionNameKey.String(val) +} + +// CodeLineNumber returns an attribute KeyValue conforming to the +// "code.line.number" semantic conventions. It represents the line number in +// `code.file.path` best representing the operation. It SHOULD point within the +// code unit named in `code.function.name`. +func CodeLineNumber(val int) attribute.KeyValue { + return CodeLineNumberKey.Int(val) +} + +// CodeNamespace returns an attribute KeyValue conforming to the "code.namespace" +// semantic conventions. It represents the "namespace" within which +// `code.function.name` is defined. Usually the qualified class or module name, +// such that `code.namespace` + some separator + `code.function.name` form a +// unique identifier for the code unit. +func CodeNamespace(val string) attribute.KeyValue { + return CodeNamespaceKey.String(val) +} + +// CodeStacktrace returns an attribute KeyValue conforming to the +// "code.stacktrace" semantic conventions. It represents a stacktrace as a string +// in the natural representation for the language runtime. The representation is +// to be determined and documented by each language SIG. +func CodeStacktrace(val string) attribute.KeyValue { + return CodeStacktraceKey.String(val) +} + +// Namespace: container +const ( + // ContainerCommandKey is the attribute Key conforming to the + // "container.command" semantic conventions. It represents the command used to + // run the container (i.e. the command name). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol" + // Note: If using embedded credentials or sensitive data, it is recommended to + // remove them to prevent potential leakage. + ContainerCommandKey = attribute.Key("container.command") + + // ContainerCommandArgsKey is the attribute Key conforming to the + // "container.command_args" semantic conventions. It represents the all the + // command arguments (including the command/executable itself) run by the + // container. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol", "--config", "config.yaml" + ContainerCommandArgsKey = attribute.Key("container.command_args") + + // ContainerCommandLineKey is the attribute Key conforming to the + // "container.command_line" semantic conventions. It represents the full command + // run by the container as a single string representing the full command. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol --config config.yaml" + ContainerCommandLineKey = attribute.Key("container.command_line") + + // ContainerCsiPluginNameKey is the attribute Key conforming to the + // "container.csi.plugin.name" semantic conventions. It represents the name of + // the CSI ([Container Storage Interface]) plugin used by the volume. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pd.csi.storage.gke.io" + // Note: This can sometimes be referred to as a "driver" in CSI implementations. + // This should represent the `name` field of the GetPluginInfo RPC. + // + // [Container Storage Interface]: https://github.com/container-storage-interface/spec + ContainerCsiPluginNameKey = attribute.Key("container.csi.plugin.name") + + // ContainerCsiVolumeIDKey is the attribute Key conforming to the + // "container.csi.volume.id" semantic conventions. It represents the unique + // volume ID returned by the CSI ([Container Storage Interface]) plugin. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "projects/my-gcp-project/zones/my-gcp-zone/disks/my-gcp-disk" + // Note: This can sometimes be referred to as a "volume handle" in CSI + // implementations. This should represent the `Volume.volume_id` field in CSI + // spec. + // + // [Container Storage Interface]: https://github.com/container-storage-interface/spec + ContainerCsiVolumeIDKey = attribute.Key("container.csi.volume.id") + + // ContainerIDKey is the attribute Key conforming to the "container.id" semantic + // conventions. It represents the container ID. Usually a UUID, as for example + // used to [identify Docker containers]. The UUID might be abbreviated. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a3bf90e006b2" + // + // [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification + ContainerIDKey = attribute.Key("container.id") + + // ContainerImageIDKey is the attribute Key conforming to the + // "container.image.id" semantic conventions. It represents the runtime specific + // image identifier. Usually a hash algorithm followed by a UUID. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "sha256:19c92d0a00d1b66d897bceaa7319bee0dd38a10a851c60bcec9474aa3f01e50f" + // Note: Docker defines a sha256 of the image id; `container.image.id` + // corresponds to the `Image` field from the Docker container inspect [API] + // endpoint. + // K8s defines a link to the container registry repository with digest + // `"imageID": "registry.azurecr.io /namespace/service/dockerfile@sha256:bdeabd40c3a8a492eaf9e8e44d0ebbb84bac7ee25ac0cf8a7159d25f62555625"` + // . + // The ID is assigned by the container runtime and can vary in different + // environments. Consider using `oci.manifest.digest` if it is important to + // identify the same image in different environments/runtimes. + // + // [API]: https://docs.docker.com/engine/api/v1.43/#tag/Container/operation/ContainerInspect + ContainerImageIDKey = attribute.Key("container.image.id") + + // ContainerImageNameKey is the attribute Key conforming to the + // "container.image.name" semantic conventions. It represents the name of the + // image the container was built on. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "gcr.io/opentelemetry/operator" + ContainerImageNameKey = attribute.Key("container.image.name") + + // ContainerImageRepoDigestsKey is the attribute Key conforming to the + // "container.image.repo_digests" semantic conventions. It represents the repo + // digests of the container image as provided by the container runtime. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "example@sha256:afcc7f1ac1b49db317a7196c902e61c6c3c4607d63599ee1a82d702d249a0ccb", + // "internal.registry.example.com:5000/example@sha256:b69959407d21e8a062e0416bf13405bb2b71ed7a84dde4158ebafacfa06f5578" + // Note: [Docker] and [CRI] report those under the `RepoDigests` field. + // + // [Docker]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect + // [CRI]: https://github.com/kubernetes/cri-api/blob/c75ef5b473bbe2d0a4fc92f82235efd665ea8e9f/pkg/apis/runtime/v1/api.proto#L1237-L1238 + ContainerImageRepoDigestsKey = attribute.Key("container.image.repo_digests") + + // ContainerImageTagsKey is the attribute Key conforming to the + // "container.image.tags" semantic conventions. It represents the container + // image tags. An example can be found in [Docker Image Inspect]. Should be only + // the `` section of the full name for example from + // `registry.example.com/my-org/my-image:`. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "v1.27.1", "3.5.7-0" + // + // [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect + ContainerImageTagsKey = attribute.Key("container.image.tags") + + // ContainerNameKey is the attribute Key conforming to the "container.name" + // semantic conventions. It represents the container name used by container + // runtime. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-autoconf" + ContainerNameKey = attribute.Key("container.name") + + // ContainerRuntimeKey is the attribute Key conforming to the + // "container.runtime" semantic conventions. It represents the container runtime + // managing this container. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "docker", "containerd", "rkt" + ContainerRuntimeKey = attribute.Key("container.runtime") +) + +// ContainerCommand returns an attribute KeyValue conforming to the +// "container.command" semantic conventions. It represents the command used to +// run the container (i.e. the command name). +func ContainerCommand(val string) attribute.KeyValue { + return ContainerCommandKey.String(val) +} + +// ContainerCommandArgs returns an attribute KeyValue conforming to the +// "container.command_args" semantic conventions. It represents the all the +// command arguments (including the command/executable itself) run by the +// container. +func ContainerCommandArgs(val ...string) attribute.KeyValue { + return ContainerCommandArgsKey.StringSlice(val) +} + +// ContainerCommandLine returns an attribute KeyValue conforming to the +// "container.command_line" semantic conventions. It represents the full command +// run by the container as a single string representing the full command. +func ContainerCommandLine(val string) attribute.KeyValue { + return ContainerCommandLineKey.String(val) +} + +// ContainerCsiPluginName returns an attribute KeyValue conforming to the +// "container.csi.plugin.name" semantic conventions. It represents the name of +// the CSI ([Container Storage Interface]) plugin used by the volume. +// +// [Container Storage Interface]: https://github.com/container-storage-interface/spec +func ContainerCsiPluginName(val string) attribute.KeyValue { + return ContainerCsiPluginNameKey.String(val) +} + +// ContainerCsiVolumeID returns an attribute KeyValue conforming to the +// "container.csi.volume.id" semantic conventions. It represents the unique +// volume ID returned by the CSI ([Container Storage Interface]) plugin. +// +// [Container Storage Interface]: https://github.com/container-storage-interface/spec +func ContainerCsiVolumeID(val string) attribute.KeyValue { + return ContainerCsiVolumeIDKey.String(val) +} + +// ContainerID returns an attribute KeyValue conforming to the "container.id" +// semantic conventions. It represents the container ID. Usually a UUID, as for +// example used to [identify Docker containers]. The UUID might be abbreviated. +// +// [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification +func ContainerID(val string) attribute.KeyValue { + return ContainerIDKey.String(val) +} + +// ContainerImageID returns an attribute KeyValue conforming to the +// "container.image.id" semantic conventions. It represents the runtime specific +// image identifier. Usually a hash algorithm followed by a UUID. +func ContainerImageID(val string) attribute.KeyValue { + return ContainerImageIDKey.String(val) +} + +// ContainerImageName returns an attribute KeyValue conforming to the +// "container.image.name" semantic conventions. It represents the name of the +// image the container was built on. +func ContainerImageName(val string) attribute.KeyValue { + return ContainerImageNameKey.String(val) +} + +// ContainerImageRepoDigests returns an attribute KeyValue conforming to the +// "container.image.repo_digests" semantic conventions. It represents the repo +// digests of the container image as provided by the container runtime. +func ContainerImageRepoDigests(val ...string) attribute.KeyValue { + return ContainerImageRepoDigestsKey.StringSlice(val) +} + +// ContainerImageTags returns an attribute KeyValue conforming to the +// "container.image.tags" semantic conventions. It represents the container image +// tags. An example can be found in [Docker Image Inspect]. Should be only the +// `` section of the full name for example from +// `registry.example.com/my-org/my-image:`. +// +// [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect +func ContainerImageTags(val ...string) attribute.KeyValue { + return ContainerImageTagsKey.StringSlice(val) +} + +// ContainerName returns an attribute KeyValue conforming to the "container.name" +// semantic conventions. It represents the container name used by container +// runtime. +func ContainerName(val string) attribute.KeyValue { + return ContainerNameKey.String(val) +} + +// ContainerRuntime returns an attribute KeyValue conforming to the +// "container.runtime" semantic conventions. It represents the container runtime +// managing this container. +func ContainerRuntime(val string) attribute.KeyValue { + return ContainerRuntimeKey.String(val) +} + +// Namespace: cpu +const ( + // CPUModeKey is the attribute Key conforming to the "cpu.mode" semantic + // conventions. It represents the mode of the CPU. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "user", "system" + CPUModeKey = attribute.Key("cpu.mode") +) + +// Enum values for cpu.mode +var ( + // user + // Stability: development + CPUModeUser = CPUModeKey.String("user") + // system + // Stability: development + CPUModeSystem = CPUModeKey.String("system") + // nice + // Stability: development + CPUModeNice = CPUModeKey.String("nice") + // idle + // Stability: development + CPUModeIdle = CPUModeKey.String("idle") + // iowait + // Stability: development + CPUModeIowait = CPUModeKey.String("iowait") + // interrupt + // Stability: development + CPUModeInterrupt = CPUModeKey.String("interrupt") + // steal + // Stability: development + CPUModeSteal = CPUModeKey.String("steal") + // kernel + // Stability: development + CPUModeKernel = CPUModeKey.String("kernel") +) + +// Namespace: db +const ( + // DBClientConnectionPoolNameKey is the attribute Key conforming to the + // "db.client.connection.pool.name" semantic conventions. It represents the name + // of the connection pool; unique within the instrumented application. In case + // the connection pool implementation doesn't provide a name, instrumentation + // SHOULD use a combination of parameters that would make the name unique, for + // example, combining attributes `server.address`, `server.port`, and + // `db.namespace`, formatted as `server.address:server.port/db.namespace`. + // Instrumentations that generate connection pool name following different + // patterns SHOULD document it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myDataSource" + DBClientConnectionPoolNameKey = attribute.Key("db.client.connection.pool.name") + + // DBClientConnectionStateKey is the attribute Key conforming to the + // "db.client.connection.state" semantic conventions. It represents the state of + // a connection in the pool. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "idle" + DBClientConnectionStateKey = attribute.Key("db.client.connection.state") + + // DBCollectionNameKey is the attribute Key conforming to the + // "db.collection.name" semantic conventions. It represents the name of a + // collection (table, container) within the database. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: "public.users", "customers" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // The collection name SHOULD NOT be extracted from `db.query.text`, + // unless the query format is known to only ever have a single collection name + // present. + // + // For batch operations, if the individual operations are known to have the same + // collection name + // then that collection name SHOULD be used. + DBCollectionNameKey = attribute.Key("db.collection.name") + + // DBNamespaceKey is the attribute Key conforming to the "db.namespace" semantic + // conventions. It represents the name of the database, fully qualified within + // the server address and port. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: "customers", "test.users" + // Note: If a database system has multiple namespace components, they SHOULD be + // concatenated (potentially using database system specific conventions) from + // most general to most specific namespace component, and more specific + // namespaces SHOULD NOT be captured without the more general namespaces, to + // ensure that "startswith" queries for the more general namespaces will be + // valid. + // Semantic conventions for individual database systems SHOULD document what + // `db.namespace` means in the context of that system. + // It is RECOMMENDED to capture the value as provided by the application without + // attempting to do any case normalization. + DBNamespaceKey = attribute.Key("db.namespace") + + // DBOperationBatchSizeKey is the attribute Key conforming to the + // "db.operation.batch.size" semantic conventions. It represents the number of + // queries included in a batch operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: 2, 3, 4 + // Note: Operations are only considered batches when they contain two or more + // operations, and so `db.operation.batch.size` SHOULD never be `1`. + DBOperationBatchSizeKey = attribute.Key("db.operation.batch.size") + + // DBOperationNameKey is the attribute Key conforming to the "db.operation.name" + // semantic conventions. It represents the name of the operation or command + // being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: "findAndModify", "HMSET", "SELECT" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // The operation name SHOULD NOT be extracted from `db.query.text`, + // unless the query format is known to only ever have a single operation name + // present. + // + // For batch operations, if the individual operations are known to have the same + // operation name + // then that operation name SHOULD be used prepended by `BATCH `, + // otherwise `db.operation.name` SHOULD be `BATCH` or some other database + // system specific term if more applicable. + DBOperationNameKey = attribute.Key("db.operation.name") + + // DBQuerySummaryKey is the attribute Key conforming to the "db.query.summary" + // semantic conventions. It represents the low cardinality representation of a + // database query text. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: "SELECT wuser_table", "INSERT shipping_details SELECT orders", "get + // user by id" + // Note: `db.query.summary` provides static summary of the query text. It + // describes a class of database queries and is useful as a grouping key, + // especially when analyzing telemetry for database calls involving complex + // queries. + // Summary may be available to the instrumentation through instrumentation hooks + // or other means. If it is not available, instrumentations that support query + // parsing SHOULD generate a summary following [Generating query summary] + // section. + // + // [Generating query summary]: ../../docs/database/database-spans.md#generating-a-summary-of-the-query-text + DBQuerySummaryKey = attribute.Key("db.query.summary") + + // DBQueryTextKey is the attribute Key conforming to the "db.query.text" + // semantic conventions. It represents the database query being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: "SELECT * FROM wuser_table where username = ?", "SET mykey ?" + // Note: For sanitization see [Sanitization of `db.query.text`]. + // For batch operations, if the individual operations are known to have the same + // query text then that query text SHOULD be used, otherwise all of the + // individual query texts SHOULD be concatenated with separator `; ` or some + // other database system specific separator if more applicable. + // Even though parameterized query text can potentially have sensitive data, by + // using a parameterized query the user is giving a strong signal that any + // sensitive data will be passed as parameter values, and the benefit to + // observability of capturing the static part of the query text by default + // outweighs the risk. + // + // [Sanitization of `db.query.text`]: ../../docs/database/database-spans.md#sanitization-of-dbquerytext + DBQueryTextKey = attribute.Key("db.query.text") + + // DBResponseReturnedRowsKey is the attribute Key conforming to the + // "db.response.returned_rows" semantic conventions. It represents the number of + // rows returned by the operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10, 30, 1000 + DBResponseReturnedRowsKey = attribute.Key("db.response.returned_rows") + + // DBResponseStatusCodeKey is the attribute Key conforming to the + // "db.response.status_code" semantic conventions. It represents the database + // response status code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: "102", "ORA-17002", "08P01", "404" + // Note: The status code returned by the database. Usually it represents an + // error code, but may also represent partial success, warning, or differentiate + // between various types of successful outcomes. + // Semantic conventions for individual database systems SHOULD document what + // `db.response.status_code` means in the context of that system. + DBResponseStatusCodeKey = attribute.Key("db.response.status_code") + + // DBSystemNameKey is the attribute Key conforming to the "db.system.name" + // semantic conventions. It represents the database management system (DBMS) + // product as identified by the client instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Release_Candidate + // + // Examples: + // Note: The actual DBMS may differ from the one identified by the client. For + // example, when using PostgreSQL client libraries to connect to a CockroachDB, + // the `db.system.name` is set to `postgresql` based on the instrumentation's + // best knowledge. + DBSystemNameKey = attribute.Key("db.system.name") +) + +// DBClientConnectionPoolName returns an attribute KeyValue conforming to the +// "db.client.connection.pool.name" semantic conventions. It represents the name +// of the connection pool; unique within the instrumented application. In case +// the connection pool implementation doesn't provide a name, instrumentation +// SHOULD use a combination of parameters that would make the name unique, for +// example, combining attributes `server.address`, `server.port`, and +// `db.namespace`, formatted as `server.address:server.port/db.namespace`. +// Instrumentations that generate connection pool name following different +// patterns SHOULD document it. +func DBClientConnectionPoolName(val string) attribute.KeyValue { + return DBClientConnectionPoolNameKey.String(val) +} + +// DBCollectionName returns an attribute KeyValue conforming to the +// "db.collection.name" semantic conventions. It represents the name of a +// collection (table, container) within the database. +func DBCollectionName(val string) attribute.KeyValue { + return DBCollectionNameKey.String(val) +} + +// DBNamespace returns an attribute KeyValue conforming to the "db.namespace" +// semantic conventions. It represents the name of the database, fully qualified +// within the server address and port. +func DBNamespace(val string) attribute.KeyValue { + return DBNamespaceKey.String(val) +} + +// DBOperationBatchSize returns an attribute KeyValue conforming to the +// "db.operation.batch.size" semantic conventions. It represents the number of +// queries included in a batch operation. +func DBOperationBatchSize(val int) attribute.KeyValue { + return DBOperationBatchSizeKey.Int(val) +} + +// DBOperationName returns an attribute KeyValue conforming to the +// "db.operation.name" semantic conventions. It represents the name of the +// operation or command being executed. +func DBOperationName(val string) attribute.KeyValue { + return DBOperationNameKey.String(val) +} + +// DBQuerySummary returns an attribute KeyValue conforming to the +// "db.query.summary" semantic conventions. It represents the low cardinality +// representation of a database query text. +func DBQuerySummary(val string) attribute.KeyValue { + return DBQuerySummaryKey.String(val) +} + +// DBQueryText returns an attribute KeyValue conforming to the "db.query.text" +// semantic conventions. It represents the database query being executed. +func DBQueryText(val string) attribute.KeyValue { + return DBQueryTextKey.String(val) +} + +// DBResponseReturnedRows returns an attribute KeyValue conforming to the +// "db.response.returned_rows" semantic conventions. It represents the number of +// rows returned by the operation. +func DBResponseReturnedRows(val int) attribute.KeyValue { + return DBResponseReturnedRowsKey.Int(val) +} + +// DBResponseStatusCode returns an attribute KeyValue conforming to the +// "db.response.status_code" semantic conventions. It represents the database +// response status code. +func DBResponseStatusCode(val string) attribute.KeyValue { + return DBResponseStatusCodeKey.String(val) +} + +// Enum values for db.client.connection.state +var ( + // idle + // Stability: development + DBClientConnectionStateIdle = DBClientConnectionStateKey.String("idle") + // used + // Stability: development + DBClientConnectionStateUsed = DBClientConnectionStateKey.String("used") +) + +// Enum values for db.system.name +var ( + // Some other SQL database. Fallback only. + // Stability: development + DBSystemNameOtherSQL = DBSystemNameKey.String("other_sql") + // [Adabas (Adaptable Database System)] + // Stability: development + // + // [Adabas (Adaptable Database System)]: https://documentation.softwareag.com/?pf=adabas + DBSystemNameSoftwareagAdabas = DBSystemNameKey.String("softwareag.adabas") + // [Actian Ingres] + // Stability: development + // + // [Actian Ingres]: https://www.actian.com/databases/ingres/ + DBSystemNameActianIngres = DBSystemNameKey.String("actian.ingres") + // [Amazon DynamoDB] + // Stability: development + // + // [Amazon DynamoDB]: https://aws.amazon.com/pm/dynamodb/ + DBSystemNameAWSDynamoDB = DBSystemNameKey.String("aws.dynamodb") + // [Amazon Redshift] + // Stability: development + // + // [Amazon Redshift]: https://aws.amazon.com/redshift/ + DBSystemNameAWSRedshift = DBSystemNameKey.String("aws.redshift") + // [Azure Cosmos DB] + // Stability: development + // + // [Azure Cosmos DB]: https://learn.microsoft.com/azure/cosmos-db + DBSystemNameAzureCosmosDB = DBSystemNameKey.String("azure.cosmosdb") + // [InterSystems Caché] + // Stability: development + // + // [InterSystems Caché]: https://www.intersystems.com/products/cache/ + DBSystemNameIntersystemsCache = DBSystemNameKey.String("intersystems.cache") + // [Apache Cassandra] + // Stability: development + // + // [Apache Cassandra]: https://cassandra.apache.org/ + DBSystemNameCassandra = DBSystemNameKey.String("cassandra") + // [ClickHouse] + // Stability: development + // + // [ClickHouse]: https://clickhouse.com/ + DBSystemNameClickhouse = DBSystemNameKey.String("clickhouse") + // [CockroachDB] + // Stability: development + // + // [CockroachDB]: https://www.cockroachlabs.com/ + DBSystemNameCockroachdb = DBSystemNameKey.String("cockroachdb") + // [Couchbase] + // Stability: development + // + // [Couchbase]: https://www.couchbase.com/ + DBSystemNameCouchbase = DBSystemNameKey.String("couchbase") + // [Apache CouchDB] + // Stability: development + // + // [Apache CouchDB]: https://couchdb.apache.org/ + DBSystemNameCouchDB = DBSystemNameKey.String("couchdb") + // [Apache Derby] + // Stability: development + // + // [Apache Derby]: https://db.apache.org/derby/ + DBSystemNameDerby = DBSystemNameKey.String("derby") + // [Elasticsearch] + // Stability: development + // + // [Elasticsearch]: https://www.elastic.co/elasticsearch + DBSystemNameElasticsearch = DBSystemNameKey.String("elasticsearch") + // [Firebird] + // Stability: development + // + // [Firebird]: https://www.firebirdsql.org/ + DBSystemNameFirebirdsql = DBSystemNameKey.String("firebirdsql") + // [Google Cloud Spanner] + // Stability: development + // + // [Google Cloud Spanner]: https://cloud.google.com/spanner + DBSystemNameGCPSpanner = DBSystemNameKey.String("gcp.spanner") + // [Apache Geode] + // Stability: development + // + // [Apache Geode]: https://geode.apache.org/ + DBSystemNameGeode = DBSystemNameKey.String("geode") + // [H2 Database] + // Stability: development + // + // [H2 Database]: https://h2database.com/ + DBSystemNameH2database = DBSystemNameKey.String("h2database") + // [Apache HBase] + // Stability: development + // + // [Apache HBase]: https://hbase.apache.org/ + DBSystemNameHBase = DBSystemNameKey.String("hbase") + // [Apache Hive] + // Stability: development + // + // [Apache Hive]: https://hive.apache.org/ + DBSystemNameHive = DBSystemNameKey.String("hive") + // [HyperSQL Database] + // Stability: development + // + // [HyperSQL Database]: https://hsqldb.org/ + DBSystemNameHSQLDB = DBSystemNameKey.String("hsqldb") + // [IBM Db2] + // Stability: development + // + // [IBM Db2]: https://www.ibm.com/db2 + DBSystemNameIbmDb2 = DBSystemNameKey.String("ibm.db2") + // [IBM Informix] + // Stability: development + // + // [IBM Informix]: https://www.ibm.com/products/informix + DBSystemNameIbmInformix = DBSystemNameKey.String("ibm.informix") + // [IBM Netezza] + // Stability: development + // + // [IBM Netezza]: https://www.ibm.com/products/netezza + DBSystemNameIbmNetezza = DBSystemNameKey.String("ibm.netezza") + // [InfluxDB] + // Stability: development + // + // [InfluxDB]: https://www.influxdata.com/ + DBSystemNameInfluxdb = DBSystemNameKey.String("influxdb") + // [Instant] + // Stability: development + // + // [Instant]: https://www.instantdb.com/ + DBSystemNameInstantDB = DBSystemNameKey.String("instantdb") + // [MariaDB] + // Stability: release_candidate + // + // [MariaDB]: https://mariadb.org/ + DBSystemNameMariaDB = DBSystemNameKey.String("mariadb") + // [Memcached] + // Stability: development + // + // [Memcached]: https://memcached.org/ + DBSystemNameMemcached = DBSystemNameKey.String("memcached") + // [MongoDB] + // Stability: development + // + // [MongoDB]: https://www.mongodb.com/ + DBSystemNameMongoDB = DBSystemNameKey.String("mongodb") + // [Microsoft SQL Server] + // Stability: release_candidate + // + // [Microsoft SQL Server]: https://www.microsoft.com/sql-server + DBSystemNameMicrosoftSQLServer = DBSystemNameKey.String("microsoft.sql_server") + // [MySQL] + // Stability: release_candidate + // + // [MySQL]: https://www.mysql.com/ + DBSystemNameMySQL = DBSystemNameKey.String("mysql") + // [Neo4j] + // Stability: development + // + // [Neo4j]: https://neo4j.com/ + DBSystemNameNeo4j = DBSystemNameKey.String("neo4j") + // [OpenSearch] + // Stability: development + // + // [OpenSearch]: https://opensearch.org/ + DBSystemNameOpensearch = DBSystemNameKey.String("opensearch") + // [Oracle Database] + // Stability: development + // + // [Oracle Database]: https://www.oracle.com/database/ + DBSystemNameOracleDB = DBSystemNameKey.String("oracle.db") + // [PostgreSQL] + // Stability: release_candidate + // + // [PostgreSQL]: https://www.postgresql.org/ + DBSystemNamePostgreSQL = DBSystemNameKey.String("postgresql") + // [Redis] + // Stability: development + // + // [Redis]: https://redis.io/ + DBSystemNameRedis = DBSystemNameKey.String("redis") + // [SAP HANA] + // Stability: development + // + // [SAP HANA]: https://www.sap.com/products/technology-platform/hana/what-is-sap-hana.html + DBSystemNameSapHana = DBSystemNameKey.String("sap.hana") + // [SAP MaxDB] + // Stability: development + // + // [SAP MaxDB]: https://maxdb.sap.com/ + DBSystemNameSapMaxDB = DBSystemNameKey.String("sap.maxdb") + // [SQLite] + // Stability: development + // + // [SQLite]: https://www.sqlite.org/ + DBSystemNameSqlite = DBSystemNameKey.String("sqlite") + // [Teradata] + // Stability: development + // + // [Teradata]: https://www.teradata.com/ + DBSystemNameTeradata = DBSystemNameKey.String("teradata") + // [Trino] + // Stability: development + // + // [Trino]: https://trino.io/ + DBSystemNameTrino = DBSystemNameKey.String("trino") +) + +// Namespace: deployment +const ( + // DeploymentEnvironmentNameKey is the attribute Key conforming to the + // "deployment.environment.name" semantic conventions. It represents the name of + // the [deployment environment] (aka deployment tier). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "staging", "production" + // Note: `deployment.environment.name` does not affect the uniqueness + // constraints defined through + // the `service.namespace`, `service.name` and `service.instance.id` resource + // attributes. + // This implies that resources carrying the following attribute combinations + // MUST be + // considered to be identifying the same service: + // + // - `service.name=frontend`, `deployment.environment.name=production` + // - `service.name=frontend`, `deployment.environment.name=staging`. + // + // + // [deployment environment]: https://wikipedia.org/wiki/Deployment_environment + DeploymentEnvironmentNameKey = attribute.Key("deployment.environment.name") + + // DeploymentIDKey is the attribute Key conforming to the "deployment.id" + // semantic conventions. It represents the id of the deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1208" + DeploymentIDKey = attribute.Key("deployment.id") + + // DeploymentNameKey is the attribute Key conforming to the "deployment.name" + // semantic conventions. It represents the name of the deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "deploy my app", "deploy-frontend" + DeploymentNameKey = attribute.Key("deployment.name") + + // DeploymentStatusKey is the attribute Key conforming to the + // "deployment.status" semantic conventions. It represents the status of the + // deployment. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + DeploymentStatusKey = attribute.Key("deployment.status") +) + +// DeploymentEnvironmentName returns an attribute KeyValue conforming to the +// "deployment.environment.name" semantic conventions. It represents the name of +// the [deployment environment] (aka deployment tier). +// +// [deployment environment]: https://wikipedia.org/wiki/Deployment_environment +func DeploymentEnvironmentName(val string) attribute.KeyValue { + return DeploymentEnvironmentNameKey.String(val) +} + +// DeploymentID returns an attribute KeyValue conforming to the "deployment.id" +// semantic conventions. It represents the id of the deployment. +func DeploymentID(val string) attribute.KeyValue { + return DeploymentIDKey.String(val) +} + +// DeploymentName returns an attribute KeyValue conforming to the +// "deployment.name" semantic conventions. It represents the name of the +// deployment. +func DeploymentName(val string) attribute.KeyValue { + return DeploymentNameKey.String(val) +} + +// Enum values for deployment.status +var ( + // failed + // Stability: development + DeploymentStatusFailed = DeploymentStatusKey.String("failed") + // succeeded + // Stability: development + DeploymentStatusSucceeded = DeploymentStatusKey.String("succeeded") +) + +// Namespace: destination +const ( + // DestinationAddressKey is the attribute Key conforming to the + // "destination.address" semantic conventions. It represents the destination + // address - domain name if available without reverse DNS lookup; otherwise, IP + // address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "destination.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the source side, and when communicating through an + // intermediary, `destination.address` SHOULD represent the destination address + // behind any intermediaries, for example proxies, if it's available. + DestinationAddressKey = attribute.Key("destination.address") + + // DestinationPortKey is the attribute Key conforming to the "destination.port" + // semantic conventions. It represents the destination port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3389, 2888 + DestinationPortKey = attribute.Key("destination.port") +) + +// DestinationAddress returns an attribute KeyValue conforming to the +// "destination.address" semantic conventions. It represents the destination +// address - domain name if available without reverse DNS lookup; otherwise, IP +// address or Unix domain socket name. +func DestinationAddress(val string) attribute.KeyValue { + return DestinationAddressKey.String(val) +} + +// DestinationPort returns an attribute KeyValue conforming to the +// "destination.port" semantic conventions. It represents the destination port +// number. +func DestinationPort(val int) attribute.KeyValue { + return DestinationPortKey.Int(val) +} + +// Namespace: device +const ( + // DeviceIDKey is the attribute Key conforming to the "device.id" semantic + // conventions. It represents a unique identifier representing the device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2ab2916d-a51f-4ac8-80ee-45ac31a28092" + // Note: The device identifier MUST only be defined using the values outlined + // below. This value is not an advertising identifier and MUST NOT be used as + // such. On iOS (Swift or Objective-C), this value MUST be equal to the + // [vendor identifier]. On Android (Java or Kotlin), this value MUST be equal to + // the Firebase Installation ID or a globally unique UUID which is persisted + // across sessions in your application. More information can be found [here] on + // best practices and exact implementation details. Caution should be taken when + // storing personal data or anything which can identify a user. GDPR and data + // protection laws may apply, ensure you do your own due diligence. + // + // [vendor identifier]: https://developer.apple.com/documentation/uikit/uidevice/1620059-identifierforvendor + // [here]: https://developer.android.com/training/articles/user-data-ids + DeviceIDKey = attribute.Key("device.id") + + // DeviceManufacturerKey is the attribute Key conforming to the + // "device.manufacturer" semantic conventions. It represents the name of the + // device manufacturer. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Apple", "Samsung" + // Note: The Android OS provides this field via [Build]. iOS apps SHOULD + // hardcode the value `Apple`. + // + // [Build]: https://developer.android.com/reference/android/os/Build#MANUFACTURER + DeviceManufacturerKey = attribute.Key("device.manufacturer") + + // DeviceModelIdentifierKey is the attribute Key conforming to the + // "device.model.identifier" semantic conventions. It represents the model + // identifier for the device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iPhone3,4", "SM-G920F" + // Note: It's recommended this value represents a machine-readable version of + // the model identifier rather than the market or consumer-friendly name of the + // device. + DeviceModelIdentifierKey = attribute.Key("device.model.identifier") + + // DeviceModelNameKey is the attribute Key conforming to the "device.model.name" + // semantic conventions. It represents the marketing name for the device model. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iPhone 6s Plus", "Samsung Galaxy S6" + // Note: It's recommended this value represents a human-readable version of the + // device model rather than a machine-readable alternative. + DeviceModelNameKey = attribute.Key("device.model.name") +) + +// DeviceID returns an attribute KeyValue conforming to the "device.id" semantic +// conventions. It represents a unique identifier representing the device. +func DeviceID(val string) attribute.KeyValue { + return DeviceIDKey.String(val) +} + +// DeviceManufacturer returns an attribute KeyValue conforming to the +// "device.manufacturer" semantic conventions. It represents the name of the +// device manufacturer. +func DeviceManufacturer(val string) attribute.KeyValue { + return DeviceManufacturerKey.String(val) +} + +// DeviceModelIdentifier returns an attribute KeyValue conforming to the +// "device.model.identifier" semantic conventions. It represents the model +// identifier for the device. +func DeviceModelIdentifier(val string) attribute.KeyValue { + return DeviceModelIdentifierKey.String(val) +} + +// DeviceModelName returns an attribute KeyValue conforming to the +// "device.model.name" semantic conventions. It represents the marketing name for +// the device model. +func DeviceModelName(val string) attribute.KeyValue { + return DeviceModelNameKey.String(val) +} + +// Namespace: disk +const ( + // DiskIoDirectionKey is the attribute Key conforming to the "disk.io.direction" + // semantic conventions. It represents the disk IO operation direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "read" + DiskIoDirectionKey = attribute.Key("disk.io.direction") +) + +// Enum values for disk.io.direction +var ( + // read + // Stability: development + DiskIoDirectionRead = DiskIoDirectionKey.String("read") + // write + // Stability: development + DiskIoDirectionWrite = DiskIoDirectionKey.String("write") +) + +// Namespace: dns +const ( + // DNSQuestionNameKey is the attribute Key conforming to the "dns.question.name" + // semantic conventions. It represents the name being queried. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "www.example.com", "opentelemetry.io" + // Note: If the name field contains non-printable characters (below 32 or above + // 126), those characters should be represented as escaped base 10 integers + // (\DDD). Back slashes and quotes should be escaped. Tabs, carriage returns, + // and line feeds should be converted to \t, \r, and \n respectively. + DNSQuestionNameKey = attribute.Key("dns.question.name") +) + +// DNSQuestionName returns an attribute KeyValue conforming to the +// "dns.question.name" semantic conventions. It represents the name being +// queried. +func DNSQuestionName(val string) attribute.KeyValue { + return DNSQuestionNameKey.String(val) +} + +// Namespace: elasticsearch +const ( + // ElasticsearchNodeNameKey is the attribute Key conforming to the + // "elasticsearch.node.name" semantic conventions. It represents the represents + // the human-readable identifier of the node/instance to which a request was + // routed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "instance-0000000001" + ElasticsearchNodeNameKey = attribute.Key("elasticsearch.node.name") +) + +// ElasticsearchNodeName returns an attribute KeyValue conforming to the +// "elasticsearch.node.name" semantic conventions. It represents the represents +// the human-readable identifier of the node/instance to which a request was +// routed. +func ElasticsearchNodeName(val string) attribute.KeyValue { + return ElasticsearchNodeNameKey.String(val) +} + +// Namespace: error +const ( + // ErrorTypeKey is the attribute Key conforming to the "error.type" semantic + // conventions. It represents the describes a class of error the operation ended + // with. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "timeout", "java.net.UnknownHostException", + // "server_certificate_invalid", "500" + // Note: The `error.type` SHOULD be predictable, and SHOULD have low + // cardinality. + // + // When `error.type` is set to a type (e.g., an exception type), its + // canonical class name identifying the type within the artifact SHOULD be used. + // + // Instrumentations SHOULD document the list of errors they report. + // + // The cardinality of `error.type` within one instrumentation library SHOULD be + // low. + // Telemetry consumers that aggregate data from multiple instrumentation + // libraries and applications + // should be prepared for `error.type` to have high cardinality at query time + // when no + // additional filters are applied. + // + // If the operation has completed successfully, instrumentations SHOULD NOT set + // `error.type`. + // + // If a specific domain defines its own set of error identifiers (such as HTTP + // or gRPC status codes), + // it's RECOMMENDED to: + // + // - Use a domain-specific attribute + // - Set `error.type` to capture all errors, regardless of whether they are + // defined within the domain-specific set or not. + ErrorTypeKey = attribute.Key("error.type") +) + +// Enum values for error.type +var ( + // A fallback error value to be used when the instrumentation doesn't define a + // custom value. + // + // Stability: stable + ErrorTypeOther = ErrorTypeKey.String("_OTHER") +) + +// Namespace: exception +const ( + // ExceptionMessageKey is the attribute Key conforming to the + // "exception.message" semantic conventions. It represents the exception + // message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "Division by zero", "Can't convert 'int' object to str implicitly" + ExceptionMessageKey = attribute.Key("exception.message") + + // ExceptionStacktraceKey is the attribute Key conforming to the + // "exception.stacktrace" semantic conventions. It represents a stacktrace as a + // string in the natural representation for the language runtime. The + // representation is to be determined and documented by each language SIG. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: Exception in thread "main" java.lang.RuntimeException: Test + // exception\n at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at + // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at + // com.example.GenerateTrace.main(GenerateTrace.java:5) + ExceptionStacktraceKey = attribute.Key("exception.stacktrace") + + // ExceptionTypeKey is the attribute Key conforming to the "exception.type" + // semantic conventions. It represents the type of the exception (its + // fully-qualified class name, if applicable). The dynamic type of the exception + // should be preferred over the static type in languages that support it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "java.net.ConnectException", "OSError" + ExceptionTypeKey = attribute.Key("exception.type") +) + +// ExceptionMessage returns an attribute KeyValue conforming to the +// "exception.message" semantic conventions. It represents the exception message. +func ExceptionMessage(val string) attribute.KeyValue { + return ExceptionMessageKey.String(val) +} + +// ExceptionStacktrace returns an attribute KeyValue conforming to the +// "exception.stacktrace" semantic conventions. It represents a stacktrace as a +// string in the natural representation for the language runtime. The +// representation is to be determined and documented by each language SIG. +func ExceptionStacktrace(val string) attribute.KeyValue { + return ExceptionStacktraceKey.String(val) +} + +// ExceptionType returns an attribute KeyValue conforming to the "exception.type" +// semantic conventions. It represents the type of the exception (its +// fully-qualified class name, if applicable). The dynamic type of the exception +// should be preferred over the static type in languages that support it. +func ExceptionType(val string) attribute.KeyValue { + return ExceptionTypeKey.String(val) +} + +// Namespace: faas +const ( + // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart" + // semantic conventions. It represents a boolean that is true if the serverless + // function is executed for the first time (aka cold-start). + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSColdstartKey = attribute.Key("faas.coldstart") + + // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic + // conventions. It represents a string containing the schedule period as + // [Cron Expression]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0/5 * * * ? * + // + // [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm + FaaSCronKey = attribute.Key("faas.cron") + + // FaaSDocumentCollectionKey is the attribute Key conforming to the + // "faas.document.collection" semantic conventions. It represents the name of + // the source on which the triggering operation was performed. For example, in + // Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the + // database name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myBucketName", "myDbName" + FaaSDocumentCollectionKey = attribute.Key("faas.document.collection") + + // FaaSDocumentNameKey is the attribute Key conforming to the + // "faas.document.name" semantic conventions. It represents the document + // name/table subjected to the operation. For example, in Cloud Storage or S3 is + // the name of the file, and in Cosmos DB the table name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myFile.txt", "myTableName" + FaaSDocumentNameKey = attribute.Key("faas.document.name") + + // FaaSDocumentOperationKey is the attribute Key conforming to the + // "faas.document.operation" semantic conventions. It represents the describes + // the type of the operation that was performed on the data. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSDocumentOperationKey = attribute.Key("faas.document.operation") + + // FaaSDocumentTimeKey is the attribute Key conforming to the + // "faas.document.time" semantic conventions. It represents a string containing + // the time when the data was accessed in the [ISO 8601] format expressed in + // [UTC]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 2020-01-23T13:47:06Z + // + // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html + // [UTC]: https://www.w3.org/TR/NOTE-datetime + FaaSDocumentTimeKey = attribute.Key("faas.document.time") + + // FaaSInstanceKey is the attribute Key conforming to the "faas.instance" + // semantic conventions. It represents the execution environment ID as a string, + // that will be potentially reused for other invocations to the same + // function/function version. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021/06/28/[$LATEST]2f399eb14537447da05ab2a2e39309de" + // Note: - **AWS Lambda:** Use the (full) log stream name. + FaaSInstanceKey = attribute.Key("faas.instance") + + // FaaSInvocationIDKey is the attribute Key conforming to the + // "faas.invocation_id" semantic conventions. It represents the invocation ID of + // the current function invocation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: af9d5aa4-a685-4c5f-a22b-444f80b3cc28 + FaaSInvocationIDKey = attribute.Key("faas.invocation_id") + + // FaaSInvokedNameKey is the attribute Key conforming to the "faas.invoked_name" + // semantic conventions. It represents the name of the invoked function. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: my-function + // Note: SHOULD be equal to the `faas.name` resource attribute of the invoked + // function. + FaaSInvokedNameKey = attribute.Key("faas.invoked_name") + + // FaaSInvokedProviderKey is the attribute Key conforming to the + // "faas.invoked_provider" semantic conventions. It represents the cloud + // provider of the invoked function. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: SHOULD be equal to the `cloud.provider` resource attribute of the + // invoked function. + FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider") + + // FaaSInvokedRegionKey is the attribute Key conforming to the + // "faas.invoked_region" semantic conventions. It represents the cloud region of + // the invoked function. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: eu-central-1 + // Note: SHOULD be equal to the `cloud.region` resource attribute of the invoked + // function. + FaaSInvokedRegionKey = attribute.Key("faas.invoked_region") + + // FaaSMaxMemoryKey is the attribute Key conforming to the "faas.max_memory" + // semantic conventions. It represents the amount of memory available to the + // serverless function converted to Bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: It's recommended to set this attribute since e.g. too little memory can + // easily stop a Java AWS Lambda function from working correctly. On AWS Lambda, + // the environment variable `AWS_LAMBDA_FUNCTION_MEMORY_SIZE` provides this + // information (which must be multiplied by 1,048,576). + FaaSMaxMemoryKey = attribute.Key("faas.max_memory") + + // FaaSNameKey is the attribute Key conforming to the "faas.name" semantic + // conventions. It represents the name of the single function that this runtime + // instance executes. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-function", "myazurefunctionapp/some-function-name" + // Note: This is the name of the function as configured/deployed on the FaaS + // platform and is usually different from the name of the callback + // function (which may be stored in the + // [`code.namespace`/`code.function.name`] + // span attributes). + // + // For some cloud providers, the above definition is ambiguous. The following + // definition of function name MUST be used for this attribute + // (and consequently the span name) for the listed cloud providers/products: + // + // - **Azure:** The full name `/`, i.e., function app name + // followed by a forward slash followed by the function name (this form + // can also be seen in the resource JSON for the function). + // This means that a span attribute MUST be used, as an Azure function + // app can host multiple functions that would usually share + // a TracerProvider (see also the `cloud.resource_id` attribute). + // + // + // [`code.namespace`/`code.function.name`]: /docs/general/attributes.md#source-code-attributes + FaaSNameKey = attribute.Key("faas.name") + + // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic + // conventions. It represents a string containing the function invocation time + // in the [ISO 8601] format expressed in [UTC]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 2020-01-23T13:47:06Z + // + // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html + // [UTC]: https://www.w3.org/TR/NOTE-datetime + FaaSTimeKey = attribute.Key("faas.time") + + // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger" semantic + // conventions. It represents the type of the trigger which caused this function + // invocation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSTriggerKey = attribute.Key("faas.trigger") + + // FaaSVersionKey is the attribute Key conforming to the "faas.version" semantic + // conventions. It represents the immutable version of the function being + // executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "26", "pinkfroid-00002" + // Note: Depending on the cloud provider and platform, use: + // + // - **AWS Lambda:** The [function version] + // (an integer represented as a decimal string). + // - **Google Cloud Run (Services):** The [revision] + // (i.e., the function name plus the revision suffix). + // - **Google Cloud Functions:** The value of the + // [`K_REVISION` environment variable]. + // - **Azure Functions:** Not applicable. Do not set this attribute. + // + // + // [function version]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-versions.html + // [revision]: https://cloud.google.com/run/docs/managing/revisions + // [`K_REVISION` environment variable]: https://cloud.google.com/functions/docs/env-var#runtime_environment_variables_set_automatically + FaaSVersionKey = attribute.Key("faas.version") +) + +// FaaSColdstart returns an attribute KeyValue conforming to the "faas.coldstart" +// semantic conventions. It represents a boolean that is true if the serverless +// function is executed for the first time (aka cold-start). +func FaaSColdstart(val bool) attribute.KeyValue { + return FaaSColdstartKey.Bool(val) +} + +// FaaSCron returns an attribute KeyValue conforming to the "faas.cron" semantic +// conventions. It represents a string containing the schedule period as +// [Cron Expression]. +// +// [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm +func FaaSCron(val string) attribute.KeyValue { + return FaaSCronKey.String(val) +} + +// FaaSDocumentCollection returns an attribute KeyValue conforming to the +// "faas.document.collection" semantic conventions. It represents the name of the +// source on which the triggering operation was performed. For example, in Cloud +// Storage or S3 corresponds to the bucket name, and in Cosmos DB to the database +// name. +func FaaSDocumentCollection(val string) attribute.KeyValue { + return FaaSDocumentCollectionKey.String(val) +} + +// FaaSDocumentName returns an attribute KeyValue conforming to the +// "faas.document.name" semantic conventions. It represents the document +// name/table subjected to the operation. For example, in Cloud Storage or S3 is +// the name of the file, and in Cosmos DB the table name. +func FaaSDocumentName(val string) attribute.KeyValue { + return FaaSDocumentNameKey.String(val) +} + +// FaaSDocumentTime returns an attribute KeyValue conforming to the +// "faas.document.time" semantic conventions. It represents a string containing +// the time when the data was accessed in the [ISO 8601] format expressed in +// [UTC]. +// +// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html +// [UTC]: https://www.w3.org/TR/NOTE-datetime +func FaaSDocumentTime(val string) attribute.KeyValue { + return FaaSDocumentTimeKey.String(val) +} + +// FaaSInstance returns an attribute KeyValue conforming to the "faas.instance" +// semantic conventions. It represents the execution environment ID as a string, +// that will be potentially reused for other invocations to the same +// function/function version. +func FaaSInstance(val string) attribute.KeyValue { + return FaaSInstanceKey.String(val) +} + +// FaaSInvocationID returns an attribute KeyValue conforming to the +// "faas.invocation_id" semantic conventions. It represents the invocation ID of +// the current function invocation. +func FaaSInvocationID(val string) attribute.KeyValue { + return FaaSInvocationIDKey.String(val) +} + +// FaaSInvokedName returns an attribute KeyValue conforming to the +// "faas.invoked_name" semantic conventions. It represents the name of the +// invoked function. +func FaaSInvokedName(val string) attribute.KeyValue { + return FaaSInvokedNameKey.String(val) +} + +// FaaSInvokedRegion returns an attribute KeyValue conforming to the +// "faas.invoked_region" semantic conventions. It represents the cloud region of +// the invoked function. +func FaaSInvokedRegion(val string) attribute.KeyValue { + return FaaSInvokedRegionKey.String(val) +} + +// FaaSMaxMemory returns an attribute KeyValue conforming to the +// "faas.max_memory" semantic conventions. It represents the amount of memory +// available to the serverless function converted to Bytes. +func FaaSMaxMemory(val int) attribute.KeyValue { + return FaaSMaxMemoryKey.Int(val) +} + +// FaaSName returns an attribute KeyValue conforming to the "faas.name" semantic +// conventions. It represents the name of the single function that this runtime +// instance executes. +func FaaSName(val string) attribute.KeyValue { + return FaaSNameKey.String(val) +} + +// FaaSTime returns an attribute KeyValue conforming to the "faas.time" semantic +// conventions. It represents a string containing the function invocation time in +// the [ISO 8601] format expressed in [UTC]. +// +// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html +// [UTC]: https://www.w3.org/TR/NOTE-datetime +func FaaSTime(val string) attribute.KeyValue { + return FaaSTimeKey.String(val) +} + +// FaaSVersion returns an attribute KeyValue conforming to the "faas.version" +// semantic conventions. It represents the immutable version of the function +// being executed. +func FaaSVersion(val string) attribute.KeyValue { + return FaaSVersionKey.String(val) +} + +// Enum values for faas.document.operation +var ( + // When a new object is created. + // Stability: development + FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert") + // When an object is modified. + // Stability: development + FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit") + // When an object is deleted. + // Stability: development + FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete") +) + +// Enum values for faas.invoked_provider +var ( + // Alibaba Cloud + // Stability: development + FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud") + // Amazon Web Services + // Stability: development + FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws") + // Microsoft Azure + // Stability: development + FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure") + // Google Cloud Platform + // Stability: development + FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp") + // Tencent Cloud + // Stability: development + FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud") +) + +// Enum values for faas.trigger +var ( + // A response to some data source operation such as a database or filesystem + // read/write + // Stability: development + FaaSTriggerDatasource = FaaSTriggerKey.String("datasource") + // To provide an answer to an inbound HTTP request + // Stability: development + FaaSTriggerHTTP = FaaSTriggerKey.String("http") + // A function is set to be executed when messages are sent to a messaging system + // Stability: development + FaaSTriggerPubsub = FaaSTriggerKey.String("pubsub") + // A function is scheduled to be executed regularly + // Stability: development + FaaSTriggerTimer = FaaSTriggerKey.String("timer") + // If none of the others apply + // Stability: development + FaaSTriggerOther = FaaSTriggerKey.String("other") +) + +// Namespace: feature_flag +const ( + // FeatureFlagContextIDKey is the attribute Key conforming to the + // "feature_flag.context.id" semantic conventions. It represents the unique + // identifier for the flag evaluation context. For example, the targeting key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "5157782b-2203-4c80-a857-dbbd5e7761db" + FeatureFlagContextIDKey = attribute.Key("feature_flag.context.id") + + // FeatureFlagEvaluationErrorMessageKey is the attribute Key conforming to the + // "feature_flag.evaluation.error.message" semantic conventions. It represents a + // message explaining the nature of an error occurring during flag evaluation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Flag `header-color` expected type `string` but found type `number` + // " + FeatureFlagEvaluationErrorMessageKey = attribute.Key("feature_flag.evaluation.error.message") + + // FeatureFlagEvaluationReasonKey is the attribute Key conforming to the + // "feature_flag.evaluation.reason" semantic conventions. It represents the + // reason code which shows how a feature flag value was determined. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "static", "targeting_match", "error", "default" + FeatureFlagEvaluationReasonKey = attribute.Key("feature_flag.evaluation.reason") + + // FeatureFlagKeyKey is the attribute Key conforming to the "feature_flag.key" + // semantic conventions. It represents the lookup key of the feature flag. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "logo-color" + FeatureFlagKeyKey = attribute.Key("feature_flag.key") + + // FeatureFlagProviderNameKey is the attribute Key conforming to the + // "feature_flag.provider_name" semantic conventions. It represents the + // identifies the feature flag provider. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Flag Manager" + FeatureFlagProviderNameKey = attribute.Key("feature_flag.provider_name") + + // FeatureFlagSetIDKey is the attribute Key conforming to the + // "feature_flag.set.id" semantic conventions. It represents the identifier of + // the [flag set] to which the feature flag belongs. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "proj-1", "ab98sgs", "service1/dev" + // + // [flag set]: https://openfeature.dev/specification/glossary/#flag-set + FeatureFlagSetIDKey = attribute.Key("feature_flag.set.id") + + // FeatureFlagVariantKey is the attribute Key conforming to the + // "feature_flag.variant" semantic conventions. It represents a semantic + // identifier for an evaluated flag value. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "red", "true", "on" + // Note: A semantic identifier, commonly referred to as a variant, provides a + // means + // for referring to a value without including the value itself. This can + // provide additional context for understanding the meaning behind a value. + // For example, the variant `red` maybe be used for the value `#c05543`. + FeatureFlagVariantKey = attribute.Key("feature_flag.variant") + + // FeatureFlagVersionKey is the attribute Key conforming to the + // "feature_flag.version" semantic conventions. It represents the version of the + // ruleset used during the evaluation. This may be any stable value which + // uniquely identifies the ruleset. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1", "01ABCDEF" + FeatureFlagVersionKey = attribute.Key("feature_flag.version") +) + +// FeatureFlagContextID returns an attribute KeyValue conforming to the +// "feature_flag.context.id" semantic conventions. It represents the unique +// identifier for the flag evaluation context. For example, the targeting key. +func FeatureFlagContextID(val string) attribute.KeyValue { + return FeatureFlagContextIDKey.String(val) +} + +// FeatureFlagEvaluationErrorMessage returns an attribute KeyValue conforming to +// the "feature_flag.evaluation.error.message" semantic conventions. It +// represents a message explaining the nature of an error occurring during flag +// evaluation. +func FeatureFlagEvaluationErrorMessage(val string) attribute.KeyValue { + return FeatureFlagEvaluationErrorMessageKey.String(val) +} + +// FeatureFlagKey returns an attribute KeyValue conforming to the +// "feature_flag.key" semantic conventions. It represents the lookup key of the +// feature flag. +func FeatureFlagKey(val string) attribute.KeyValue { + return FeatureFlagKeyKey.String(val) +} + +// FeatureFlagProviderName returns an attribute KeyValue conforming to the +// "feature_flag.provider_name" semantic conventions. It represents the +// identifies the feature flag provider. +func FeatureFlagProviderName(val string) attribute.KeyValue { + return FeatureFlagProviderNameKey.String(val) +} + +// FeatureFlagSetID returns an attribute KeyValue conforming to the +// "feature_flag.set.id" semantic conventions. It represents the identifier of +// the [flag set] to which the feature flag belongs. +// +// [flag set]: https://openfeature.dev/specification/glossary/#flag-set +func FeatureFlagSetID(val string) attribute.KeyValue { + return FeatureFlagSetIDKey.String(val) +} + +// FeatureFlagVariant returns an attribute KeyValue conforming to the +// "feature_flag.variant" semantic conventions. It represents a semantic +// identifier for an evaluated flag value. +func FeatureFlagVariant(val string) attribute.KeyValue { + return FeatureFlagVariantKey.String(val) +} + +// FeatureFlagVersion returns an attribute KeyValue conforming to the +// "feature_flag.version" semantic conventions. It represents the version of the +// ruleset used during the evaluation. This may be any stable value which +// uniquely identifies the ruleset. +func FeatureFlagVersion(val string) attribute.KeyValue { + return FeatureFlagVersionKey.String(val) +} + +// Enum values for feature_flag.evaluation.reason +var ( + // The resolved value is static (no dynamic evaluation). + // Stability: development + FeatureFlagEvaluationReasonStatic = FeatureFlagEvaluationReasonKey.String("static") + // The resolved value fell back to a pre-configured value (no dynamic evaluation + // occurred or dynamic evaluation yielded no result). + // Stability: development + FeatureFlagEvaluationReasonDefault = FeatureFlagEvaluationReasonKey.String("default") + // The resolved value was the result of a dynamic evaluation, such as a rule or + // specific user-targeting. + // Stability: development + FeatureFlagEvaluationReasonTargetingMatch = FeatureFlagEvaluationReasonKey.String("targeting_match") + // The resolved value was the result of pseudorandom assignment. + // Stability: development + FeatureFlagEvaluationReasonSplit = FeatureFlagEvaluationReasonKey.String("split") + // The resolved value was retrieved from cache. + // Stability: development + FeatureFlagEvaluationReasonCached = FeatureFlagEvaluationReasonKey.String("cached") + // The resolved value was the result of the flag being disabled in the + // management system. + // Stability: development + FeatureFlagEvaluationReasonDisabled = FeatureFlagEvaluationReasonKey.String("disabled") + // The reason for the resolved value could not be determined. + // Stability: development + FeatureFlagEvaluationReasonUnknown = FeatureFlagEvaluationReasonKey.String("unknown") + // The resolved value is non-authoritative or possibly out of date + // Stability: development + FeatureFlagEvaluationReasonStale = FeatureFlagEvaluationReasonKey.String("stale") + // The resolved value was the result of an error. + // Stability: development + FeatureFlagEvaluationReasonError = FeatureFlagEvaluationReasonKey.String("error") +) + +// Namespace: file +const ( + // FileAccessedKey is the attribute Key conforming to the "file.accessed" + // semantic conventions. It represents the time when the file was last accessed, + // in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: This attribute might not be supported by some file systems — NFS, + // FAT32, in embedded OS, etc. + FileAccessedKey = attribute.Key("file.accessed") + + // FileAttributesKey is the attribute Key conforming to the "file.attributes" + // semantic conventions. It represents the array of file attributes. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "readonly", "hidden" + // Note: Attributes names depend on the OS or file system. Here’s a + // non-exhaustive list of values expected for this attribute: `archive`, + // `compressed`, `directory`, `encrypted`, `execute`, `hidden`, `immutable`, + // `journaled`, `read`, `readonly`, `symbolic link`, `system`, `temporary`, + // `write`. + FileAttributesKey = attribute.Key("file.attributes") + + // FileChangedKey is the attribute Key conforming to the "file.changed" semantic + // conventions. It represents the time when the file attributes or metadata was + // last changed, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: `file.changed` captures the time when any of the file's properties or + // attributes (including the content) are changed, while `file.modified` + // captures the timestamp when the file content is modified. + FileChangedKey = attribute.Key("file.changed") + + // FileCreatedKey is the attribute Key conforming to the "file.created" semantic + // conventions. It represents the time when the file was created, in ISO 8601 + // format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: This attribute might not be supported by some file systems — NFS, + // FAT32, in embedded OS, etc. + FileCreatedKey = attribute.Key("file.created") + + // FileDirectoryKey is the attribute Key conforming to the "file.directory" + // semantic conventions. It represents the directory where the file is located. + // It should include the drive letter, when appropriate. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/home/user", "C:\Program Files\MyApp" + FileDirectoryKey = attribute.Key("file.directory") + + // FileExtensionKey is the attribute Key conforming to the "file.extension" + // semantic conventions. It represents the file extension, excluding the leading + // dot. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "png", "gz" + // Note: When the file name has multiple extensions (example.tar.gz), only the + // last one should be captured ("gz", not "tar.gz"). + FileExtensionKey = attribute.Key("file.extension") + + // FileForkNameKey is the attribute Key conforming to the "file.fork_name" + // semantic conventions. It represents the name of the fork. A fork is + // additional data associated with a filesystem object. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Zone.Identifer" + // Note: On Linux, a resource fork is used to store additional data with a + // filesystem object. A file always has at least one fork for the data portion, + // and additional forks may exist. + // On NTFS, this is analogous to an Alternate Data Stream (ADS), and the default + // data stream for a file is just called $DATA. Zone.Identifier is commonly used + // by Windows to track contents downloaded from the Internet. An ADS is + // typically of the form: C:\path\to\filename.extension:some_fork_name, and + // some_fork_name is the value that should populate `fork_name`. + // `filename.extension` should populate `file.name`, and `extension` should + // populate `file.extension`. The full path, `file.path`, will include the fork + // name. + FileForkNameKey = attribute.Key("file.fork_name") + + // FileGroupIDKey is the attribute Key conforming to the "file.group.id" + // semantic conventions. It represents the primary Group ID (GID) of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1000" + FileGroupIDKey = attribute.Key("file.group.id") + + // FileGroupNameKey is the attribute Key conforming to the "file.group.name" + // semantic conventions. It represents the primary group name of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "users" + FileGroupNameKey = attribute.Key("file.group.name") + + // FileInodeKey is the attribute Key conforming to the "file.inode" semantic + // conventions. It represents the inode representing the file in the filesystem. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "256383" + FileInodeKey = attribute.Key("file.inode") + + // FileModeKey is the attribute Key conforming to the "file.mode" semantic + // conventions. It represents the mode of the file in octal representation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0640" + FileModeKey = attribute.Key("file.mode") + + // FileModifiedKey is the attribute Key conforming to the "file.modified" + // semantic conventions. It represents the time when the file content was last + // modified, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + FileModifiedKey = attribute.Key("file.modified") + + // FileNameKey is the attribute Key conforming to the "file.name" semantic + // conventions. It represents the name of the file including the extension, + // without the directory. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "example.png" + FileNameKey = attribute.Key("file.name") + + // FileOwnerIDKey is the attribute Key conforming to the "file.owner.id" + // semantic conventions. It represents the user ID (UID) or security identifier + // (SID) of the file owner. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1000" + FileOwnerIDKey = attribute.Key("file.owner.id") + + // FileOwnerNameKey is the attribute Key conforming to the "file.owner.name" + // semantic conventions. It represents the username of the file owner. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + FileOwnerNameKey = attribute.Key("file.owner.name") + + // FilePathKey is the attribute Key conforming to the "file.path" semantic + // conventions. It represents the full path to the file, including the file + // name. It should include the drive letter, when appropriate. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/home/alice/example.png", "C:\Program Files\MyApp\myapp.exe" + FilePathKey = attribute.Key("file.path") + + // FileSizeKey is the attribute Key conforming to the "file.size" semantic + // conventions. It represents the file size in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FileSizeKey = attribute.Key("file.size") + + // FileSymbolicLinkTargetPathKey is the attribute Key conforming to the + // "file.symbolic_link.target_path" semantic conventions. It represents the path + // to the target of a symbolic link. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/usr/bin/python3" + // Note: This attribute is only applicable to symbolic links. + FileSymbolicLinkTargetPathKey = attribute.Key("file.symbolic_link.target_path") +) + +// FileAccessed returns an attribute KeyValue conforming to the "file.accessed" +// semantic conventions. It represents the time when the file was last accessed, +// in ISO 8601 format. +func FileAccessed(val string) attribute.KeyValue { + return FileAccessedKey.String(val) +} + +// FileAttributes returns an attribute KeyValue conforming to the +// "file.attributes" semantic conventions. It represents the array of file +// attributes. +func FileAttributes(val ...string) attribute.KeyValue { + return FileAttributesKey.StringSlice(val) +} + +// FileChanged returns an attribute KeyValue conforming to the "file.changed" +// semantic conventions. It represents the time when the file attributes or +// metadata was last changed, in ISO 8601 format. +func FileChanged(val string) attribute.KeyValue { + return FileChangedKey.String(val) +} + +// FileCreated returns an attribute KeyValue conforming to the "file.created" +// semantic conventions. It represents the time when the file was created, in ISO +// 8601 format. +func FileCreated(val string) attribute.KeyValue { + return FileCreatedKey.String(val) +} + +// FileDirectory returns an attribute KeyValue conforming to the "file.directory" +// semantic conventions. It represents the directory where the file is located. +// It should include the drive letter, when appropriate. +func FileDirectory(val string) attribute.KeyValue { + return FileDirectoryKey.String(val) +} + +// FileExtension returns an attribute KeyValue conforming to the "file.extension" +// semantic conventions. It represents the file extension, excluding the leading +// dot. +func FileExtension(val string) attribute.KeyValue { + return FileExtensionKey.String(val) +} + +// FileForkName returns an attribute KeyValue conforming to the "file.fork_name" +// semantic conventions. It represents the name of the fork. A fork is additional +// data associated with a filesystem object. +func FileForkName(val string) attribute.KeyValue { + return FileForkNameKey.String(val) +} + +// FileGroupID returns an attribute KeyValue conforming to the "file.group.id" +// semantic conventions. It represents the primary Group ID (GID) of the file. +func FileGroupID(val string) attribute.KeyValue { + return FileGroupIDKey.String(val) +} + +// FileGroupName returns an attribute KeyValue conforming to the +// "file.group.name" semantic conventions. It represents the primary group name +// of the file. +func FileGroupName(val string) attribute.KeyValue { + return FileGroupNameKey.String(val) +} + +// FileInode returns an attribute KeyValue conforming to the "file.inode" +// semantic conventions. It represents the inode representing the file in the +// filesystem. +func FileInode(val string) attribute.KeyValue { + return FileInodeKey.String(val) +} + +// FileMode returns an attribute KeyValue conforming to the "file.mode" semantic +// conventions. It represents the mode of the file in octal representation. +func FileMode(val string) attribute.KeyValue { + return FileModeKey.String(val) +} + +// FileModified returns an attribute KeyValue conforming to the "file.modified" +// semantic conventions. It represents the time when the file content was last +// modified, in ISO 8601 format. +func FileModified(val string) attribute.KeyValue { + return FileModifiedKey.String(val) +} + +// FileName returns an attribute KeyValue conforming to the "file.name" semantic +// conventions. It represents the name of the file including the extension, +// without the directory. +func FileName(val string) attribute.KeyValue { + return FileNameKey.String(val) +} + +// FileOwnerID returns an attribute KeyValue conforming to the "file.owner.id" +// semantic conventions. It represents the user ID (UID) or security identifier +// (SID) of the file owner. +func FileOwnerID(val string) attribute.KeyValue { + return FileOwnerIDKey.String(val) +} + +// FileOwnerName returns an attribute KeyValue conforming to the +// "file.owner.name" semantic conventions. It represents the username of the file +// owner. +func FileOwnerName(val string) attribute.KeyValue { + return FileOwnerNameKey.String(val) +} + +// FilePath returns an attribute KeyValue conforming to the "file.path" semantic +// conventions. It represents the full path to the file, including the file name. +// It should include the drive letter, when appropriate. +func FilePath(val string) attribute.KeyValue { + return FilePathKey.String(val) +} + +// FileSize returns an attribute KeyValue conforming to the "file.size" semantic +// conventions. It represents the file size in bytes. +func FileSize(val int) attribute.KeyValue { + return FileSizeKey.Int(val) +} + +// FileSymbolicLinkTargetPath returns an attribute KeyValue conforming to the +// "file.symbolic_link.target_path" semantic conventions. It represents the path +// to the target of a symbolic link. +func FileSymbolicLinkTargetPath(val string) attribute.KeyValue { + return FileSymbolicLinkTargetPathKey.String(val) +} + +// Namespace: gcp +const ( + // GCPClientServiceKey is the attribute Key conforming to the + // "gcp.client.service" semantic conventions. It represents the identifies the + // Google Cloud service for which the official client library is intended. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "appengine", "run", "firestore", "alloydb", "spanner" + // Note: Intended to be a stable identifier for Google Cloud client libraries + // that is uniform across implementation languages. The value should be derived + // from the canonical service domain for the service; for example, + // 'foo.googleapis.com' should result in a value of 'foo'. + GCPClientServiceKey = attribute.Key("gcp.client.service") + + // GCPCloudRunJobExecutionKey is the attribute Key conforming to the + // "gcp.cloud_run.job.execution" semantic conventions. It represents the name of + // the Cloud Run [execution] being run for the Job, as set by the + // [`CLOUD_RUN_EXECUTION`] environment variable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "job-name-xxxx", "sample-job-mdw84" + // + // [execution]: https://cloud.google.com/run/docs/managing/job-executions + // [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars + GCPCloudRunJobExecutionKey = attribute.Key("gcp.cloud_run.job.execution") + + // GCPCloudRunJobTaskIndexKey is the attribute Key conforming to the + // "gcp.cloud_run.job.task_index" semantic conventions. It represents the index + // for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`] + // environment variable. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 1 + // + // [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars + GCPCloudRunJobTaskIndexKey = attribute.Key("gcp.cloud_run.job.task_index") + + // GCPGceInstanceHostnameKey is the attribute Key conforming to the + // "gcp.gce.instance.hostname" semantic conventions. It represents the hostname + // of a GCE instance. This is the full value of the default or [custom hostname] + // . + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-host1234.example.com", + // "sample-vm.us-west1-b.c.my-project.internal" + // + // [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm + GCPGceInstanceHostnameKey = attribute.Key("gcp.gce.instance.hostname") + + // GCPGceInstanceNameKey is the attribute Key conforming to the + // "gcp.gce.instance.name" semantic conventions. It represents the instance name + // of a GCE instance. This is the value provided by `host.name`, the visible + // name of the instance in the Cloud Console UI, and the prefix for the default + // hostname of the instance as defined by the [default internal DNS name]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "instance-1", "my-vm-name" + // + // [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names + GCPGceInstanceNameKey = attribute.Key("gcp.gce.instance.name") +) + +// GCPClientService returns an attribute KeyValue conforming to the +// "gcp.client.service" semantic conventions. It represents the identifies the +// Google Cloud service for which the official client library is intended. +func GCPClientService(val string) attribute.KeyValue { + return GCPClientServiceKey.String(val) +} + +// GCPCloudRunJobExecution returns an attribute KeyValue conforming to the +// "gcp.cloud_run.job.execution" semantic conventions. It represents the name of +// the Cloud Run [execution] being run for the Job, as set by the +// [`CLOUD_RUN_EXECUTION`] environment variable. +// +// [execution]: https://cloud.google.com/run/docs/managing/job-executions +// [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars +func GCPCloudRunJobExecution(val string) attribute.KeyValue { + return GCPCloudRunJobExecutionKey.String(val) +} + +// GCPCloudRunJobTaskIndex returns an attribute KeyValue conforming to the +// "gcp.cloud_run.job.task_index" semantic conventions. It represents the index +// for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`] +// environment variable. +// +// [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars +func GCPCloudRunJobTaskIndex(val int) attribute.KeyValue { + return GCPCloudRunJobTaskIndexKey.Int(val) +} + +// GCPGceInstanceHostname returns an attribute KeyValue conforming to the +// "gcp.gce.instance.hostname" semantic conventions. It represents the hostname +// of a GCE instance. This is the full value of the default or [custom hostname] +// . +// +// [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm +func GCPGceInstanceHostname(val string) attribute.KeyValue { + return GCPGceInstanceHostnameKey.String(val) +} + +// GCPGceInstanceName returns an attribute KeyValue conforming to the +// "gcp.gce.instance.name" semantic conventions. It represents the instance name +// of a GCE instance. This is the value provided by `host.name`, the visible name +// of the instance in the Cloud Console UI, and the prefix for the default +// hostname of the instance as defined by the [default internal DNS name]. +// +// [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names +func GCPGceInstanceName(val string) attribute.KeyValue { + return GCPGceInstanceNameKey.String(val) +} + +// Namespace: gen_ai +const ( + // GenAIOpenaiRequestResponseFormatKey is the attribute Key conforming to the + // "gen_ai.openai.request.response_format" semantic conventions. It represents + // the response format that is requested. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "json" + GenAIOpenaiRequestResponseFormatKey = attribute.Key("gen_ai.openai.request.response_format") + + // GenAIOpenaiRequestServiceTierKey is the attribute Key conforming to the + // "gen_ai.openai.request.service_tier" semantic conventions. It represents the + // service tier requested. May be a specific tier, default, or auto. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "auto", "default" + GenAIOpenaiRequestServiceTierKey = attribute.Key("gen_ai.openai.request.service_tier") + + // GenAIOpenaiResponseServiceTierKey is the attribute Key conforming to the + // "gen_ai.openai.response.service_tier" semantic conventions. It represents the + // service tier used for the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "scale", "default" + GenAIOpenaiResponseServiceTierKey = attribute.Key("gen_ai.openai.response.service_tier") + + // GenAIOpenaiResponseSystemFingerprintKey is the attribute Key conforming to + // the "gen_ai.openai.response.system_fingerprint" semantic conventions. It + // represents a fingerprint to track any eventual change in the Generative AI + // environment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "fp_44709d6fcb" + GenAIOpenaiResponseSystemFingerprintKey = attribute.Key("gen_ai.openai.response.system_fingerprint") + + // GenAIOperationNameKey is the attribute Key conforming to the + // "gen_ai.operation.name" semantic conventions. It represents the name of the + // operation being performed. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: If one of the predefined values applies, but specific system uses a + // different name it's RECOMMENDED to document it in the semantic conventions + // for specific GenAI system and use system-specific name in the + // instrumentation. If a different name is not documented, instrumentation + // libraries SHOULD use applicable predefined value. + GenAIOperationNameKey = attribute.Key("gen_ai.operation.name") + + // GenAIRequestEncodingFormatsKey is the attribute Key conforming to the + // "gen_ai.request.encoding_formats" semantic conventions. It represents the + // encoding formats requested in an embeddings operation, if specified. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "base64"], ["float", "binary" + // Note: In some GenAI systems the encoding formats are called embedding types. + // Also, some GenAI systems only accept a single format per request. + GenAIRequestEncodingFormatsKey = attribute.Key("gen_ai.request.encoding_formats") + + // GenAIRequestFrequencyPenaltyKey is the attribute Key conforming to the + // "gen_ai.request.frequency_penalty" semantic conventions. It represents the + // frequency penalty setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.1 + GenAIRequestFrequencyPenaltyKey = attribute.Key("gen_ai.request.frequency_penalty") + + // GenAIRequestMaxTokensKey is the attribute Key conforming to the + // "gen_ai.request.max_tokens" semantic conventions. It represents the maximum + // number of tokens the model generates for a request. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIRequestMaxTokensKey = attribute.Key("gen_ai.request.max_tokens") + + // GenAIRequestModelKey is the attribute Key conforming to the + // "gen_ai.request.model" semantic conventions. It represents the name of the + // GenAI model a request is being made to. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: gpt-4 + GenAIRequestModelKey = attribute.Key("gen_ai.request.model") + + // GenAIRequestPresencePenaltyKey is the attribute Key conforming to the + // "gen_ai.request.presence_penalty" semantic conventions. It represents the + // presence penalty setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.1 + GenAIRequestPresencePenaltyKey = attribute.Key("gen_ai.request.presence_penalty") + + // GenAIRequestSeedKey is the attribute Key conforming to the + // "gen_ai.request.seed" semantic conventions. It represents the requests with + // same seed value more likely to return same result. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIRequestSeedKey = attribute.Key("gen_ai.request.seed") + + // GenAIRequestStopSequencesKey is the attribute Key conforming to the + // "gen_ai.request.stop_sequences" semantic conventions. It represents the list + // of sequences that the model will use to stop generating further tokens. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "forest", "lived" + GenAIRequestStopSequencesKey = attribute.Key("gen_ai.request.stop_sequences") + + // GenAIRequestTemperatureKey is the attribute Key conforming to the + // "gen_ai.request.temperature" semantic conventions. It represents the + // temperature setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.0 + GenAIRequestTemperatureKey = attribute.Key("gen_ai.request.temperature") + + // GenAIRequestTopKKey is the attribute Key conforming to the + // "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling + // setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + GenAIRequestTopKKey = attribute.Key("gen_ai.request.top_k") + + // GenAIRequestTopPKey is the attribute Key conforming to the + // "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling + // setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + GenAIRequestTopPKey = attribute.Key("gen_ai.request.top_p") + + // GenAIResponseFinishReasonsKey is the attribute Key conforming to the + // "gen_ai.response.finish_reasons" semantic conventions. It represents the + // array of reasons the model stopped generating tokens, corresponding to each + // generation received. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "stop"], ["stop", "length" + GenAIResponseFinishReasonsKey = attribute.Key("gen_ai.response.finish_reasons") + + // GenAIResponseIDKey is the attribute Key conforming to the + // "gen_ai.response.id" semantic conventions. It represents the unique + // identifier for the completion. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "chatcmpl-123" + GenAIResponseIDKey = attribute.Key("gen_ai.response.id") + + // GenAIResponseModelKey is the attribute Key conforming to the + // "gen_ai.response.model" semantic conventions. It represents the name of the + // model that generated the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "gpt-4-0613" + GenAIResponseModelKey = attribute.Key("gen_ai.response.model") + + // GenAISystemKey is the attribute Key conforming to the "gen_ai.system" + // semantic conventions. It represents the Generative AI product as identified + // by the client or server instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: openai + // Note: The `gen_ai.system` describes a family of GenAI models with specific + // model identified + // by `gen_ai.request.model` and `gen_ai.response.model` attributes. + // + // The actual GenAI product may differ from the one identified by the client. + // Multiple systems, including Azure OpenAI and Gemini, are accessible by OpenAI + // client + // libraries. In such cases, the `gen_ai.system` is set to `openai` based on the + // instrumentation's best knowledge, instead of the actual system. The + // `server.address` + // attribute may help identify the actual system in use for `openai`. + // + // For custom model, a custom friendly name SHOULD be used. + // If none of these options apply, the `gen_ai.system` SHOULD be set to `_OTHER` + // . + GenAISystemKey = attribute.Key("gen_ai.system") + + // GenAITokenTypeKey is the attribute Key conforming to the "gen_ai.token.type" + // semantic conventions. It represents the type of token being counted. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "input", "output" + GenAITokenTypeKey = attribute.Key("gen_ai.token.type") + + // GenAIUsageInputTokensKey is the attribute Key conforming to the + // "gen_ai.usage.input_tokens" semantic conventions. It represents the number of + // tokens used in the GenAI input (prompt). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIUsageInputTokensKey = attribute.Key("gen_ai.usage.input_tokens") + + // GenAIUsageOutputTokensKey is the attribute Key conforming to the + // "gen_ai.usage.output_tokens" semantic conventions. It represents the number + // of tokens used in the GenAI response (completion). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 180 + GenAIUsageOutputTokensKey = attribute.Key("gen_ai.usage.output_tokens") +) + +// GenAIOpenaiResponseServiceTier returns an attribute KeyValue conforming to the +// "gen_ai.openai.response.service_tier" semantic conventions. It represents the +// service tier used for the response. +func GenAIOpenaiResponseServiceTier(val string) attribute.KeyValue { + return GenAIOpenaiResponseServiceTierKey.String(val) +} + +// GenAIOpenaiResponseSystemFingerprint returns an attribute KeyValue conforming +// to the "gen_ai.openai.response.system_fingerprint" semantic conventions. It +// represents a fingerprint to track any eventual change in the Generative AI +// environment. +func GenAIOpenaiResponseSystemFingerprint(val string) attribute.KeyValue { + return GenAIOpenaiResponseSystemFingerprintKey.String(val) +} + +// GenAIRequestEncodingFormats returns an attribute KeyValue conforming to the +// "gen_ai.request.encoding_formats" semantic conventions. It represents the +// encoding formats requested in an embeddings operation, if specified. +func GenAIRequestEncodingFormats(val ...string) attribute.KeyValue { + return GenAIRequestEncodingFormatsKey.StringSlice(val) +} + +// GenAIRequestFrequencyPenalty returns an attribute KeyValue conforming to the +// "gen_ai.request.frequency_penalty" semantic conventions. It represents the +// frequency penalty setting for the GenAI request. +func GenAIRequestFrequencyPenalty(val float64) attribute.KeyValue { + return GenAIRequestFrequencyPenaltyKey.Float64(val) +} + +// GenAIRequestMaxTokens returns an attribute KeyValue conforming to the +// "gen_ai.request.max_tokens" semantic conventions. It represents the maximum +// number of tokens the model generates for a request. +func GenAIRequestMaxTokens(val int) attribute.KeyValue { + return GenAIRequestMaxTokensKey.Int(val) +} + +// GenAIRequestModel returns an attribute KeyValue conforming to the +// "gen_ai.request.model" semantic conventions. It represents the name of the +// GenAI model a request is being made to. +func GenAIRequestModel(val string) attribute.KeyValue { + return GenAIRequestModelKey.String(val) +} + +// GenAIRequestPresencePenalty returns an attribute KeyValue conforming to the +// "gen_ai.request.presence_penalty" semantic conventions. It represents the +// presence penalty setting for the GenAI request. +func GenAIRequestPresencePenalty(val float64) attribute.KeyValue { + return GenAIRequestPresencePenaltyKey.Float64(val) +} + +// GenAIRequestSeed returns an attribute KeyValue conforming to the +// "gen_ai.request.seed" semantic conventions. It represents the requests with +// same seed value more likely to return same result. +func GenAIRequestSeed(val int) attribute.KeyValue { + return GenAIRequestSeedKey.Int(val) +} + +// GenAIRequestStopSequences returns an attribute KeyValue conforming to the +// "gen_ai.request.stop_sequences" semantic conventions. It represents the list +// of sequences that the model will use to stop generating further tokens. +func GenAIRequestStopSequences(val ...string) attribute.KeyValue { + return GenAIRequestStopSequencesKey.StringSlice(val) +} + +// GenAIRequestTemperature returns an attribute KeyValue conforming to the +// "gen_ai.request.temperature" semantic conventions. It represents the +// temperature setting for the GenAI request. +func GenAIRequestTemperature(val float64) attribute.KeyValue { + return GenAIRequestTemperatureKey.Float64(val) +} + +// GenAIRequestTopK returns an attribute KeyValue conforming to the +// "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling +// setting for the GenAI request. +func GenAIRequestTopK(val float64) attribute.KeyValue { + return GenAIRequestTopKKey.Float64(val) +} + +// GenAIRequestTopP returns an attribute KeyValue conforming to the +// "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling +// setting for the GenAI request. +func GenAIRequestTopP(val float64) attribute.KeyValue { + return GenAIRequestTopPKey.Float64(val) +} + +// GenAIResponseFinishReasons returns an attribute KeyValue conforming to the +// "gen_ai.response.finish_reasons" semantic conventions. It represents the array +// of reasons the model stopped generating tokens, corresponding to each +// generation received. +func GenAIResponseFinishReasons(val ...string) attribute.KeyValue { + return GenAIResponseFinishReasonsKey.StringSlice(val) +} + +// GenAIResponseID returns an attribute KeyValue conforming to the +// "gen_ai.response.id" semantic conventions. It represents the unique identifier +// for the completion. +func GenAIResponseID(val string) attribute.KeyValue { + return GenAIResponseIDKey.String(val) +} + +// GenAIResponseModel returns an attribute KeyValue conforming to the +// "gen_ai.response.model" semantic conventions. It represents the name of the +// model that generated the response. +func GenAIResponseModel(val string) attribute.KeyValue { + return GenAIResponseModelKey.String(val) +} + +// GenAIUsageInputTokens returns an attribute KeyValue conforming to the +// "gen_ai.usage.input_tokens" semantic conventions. It represents the number of +// tokens used in the GenAI input (prompt). +func GenAIUsageInputTokens(val int) attribute.KeyValue { + return GenAIUsageInputTokensKey.Int(val) +} + +// GenAIUsageOutputTokens returns an attribute KeyValue conforming to the +// "gen_ai.usage.output_tokens" semantic conventions. It represents the number of +// tokens used in the GenAI response (completion). +func GenAIUsageOutputTokens(val int) attribute.KeyValue { + return GenAIUsageOutputTokensKey.Int(val) +} + +// Enum values for gen_ai.openai.request.response_format +var ( + // Text response format + // Stability: development + GenAIOpenaiRequestResponseFormatText = GenAIOpenaiRequestResponseFormatKey.String("text") + // JSON object response format + // Stability: development + GenAIOpenaiRequestResponseFormatJSONObject = GenAIOpenaiRequestResponseFormatKey.String("json_object") + // JSON schema response format + // Stability: development + GenAIOpenaiRequestResponseFormatJSONSchema = GenAIOpenaiRequestResponseFormatKey.String("json_schema") +) + +// Enum values for gen_ai.openai.request.service_tier +var ( + // The system will utilize scale tier credits until they are exhausted. + // Stability: development + GenAIOpenaiRequestServiceTierAuto = GenAIOpenaiRequestServiceTierKey.String("auto") + // The system will utilize the default scale tier. + // Stability: development + GenAIOpenaiRequestServiceTierDefault = GenAIOpenaiRequestServiceTierKey.String("default") +) + +// Enum values for gen_ai.operation.name +var ( + // Chat completion operation such as [OpenAI Chat API] + // Stability: development + // + // [OpenAI Chat API]: https://platform.openai.com/docs/api-reference/chat + GenAIOperationNameChat = GenAIOperationNameKey.String("chat") + // Text completions operation such as [OpenAI Completions API (Legacy)] + // Stability: development + // + // [OpenAI Completions API (Legacy)]: https://platform.openai.com/docs/api-reference/completions + GenAIOperationNameTextCompletion = GenAIOperationNameKey.String("text_completion") + // Embeddings operation such as [OpenAI Create embeddings API] + // Stability: development + // + // [OpenAI Create embeddings API]: https://platform.openai.com/docs/api-reference/embeddings/create + GenAIOperationNameEmbeddings = GenAIOperationNameKey.String("embeddings") +) + +// Enum values for gen_ai.system +var ( + // OpenAI + // Stability: development + GenAISystemOpenai = GenAISystemKey.String("openai") + // Vertex AI + // Stability: development + GenAISystemVertexAI = GenAISystemKey.String("vertex_ai") + // Gemini + // Stability: development + GenAISystemGemini = GenAISystemKey.String("gemini") + // Anthropic + // Stability: development + GenAISystemAnthropic = GenAISystemKey.String("anthropic") + // Cohere + // Stability: development + GenAISystemCohere = GenAISystemKey.String("cohere") + // Azure AI Inference + // Stability: development + GenAISystemAzAIInference = GenAISystemKey.String("az.ai.inference") + // Azure OpenAI + // Stability: development + GenAISystemAzAIOpenai = GenAISystemKey.String("az.ai.openai") + // IBM Watsonx AI + // Stability: development + GenAISystemIbmWatsonxAI = GenAISystemKey.String("ibm.watsonx.ai") + // AWS Bedrock + // Stability: development + GenAISystemAWSBedrock = GenAISystemKey.String("aws.bedrock") + // Perplexity + // Stability: development + GenAISystemPerplexity = GenAISystemKey.String("perplexity") + // xAI + // Stability: development + GenAISystemXai = GenAISystemKey.String("xai") + // DeepSeek + // Stability: development + GenAISystemDeepseek = GenAISystemKey.String("deepseek") + // Groq + // Stability: development + GenAISystemGroq = GenAISystemKey.String("groq") + // Mistral AI + // Stability: development + GenAISystemMistralAI = GenAISystemKey.String("mistral_ai") +) + +// Enum values for gen_ai.token.type +var ( + // Input tokens (prompt, input, etc.) + // Stability: development + GenAITokenTypeInput = GenAITokenTypeKey.String("input") + // Output tokens (completion, response, etc.) + // Stability: development + GenAITokenTypeCompletion = GenAITokenTypeKey.String("output") +) + +// Namespace: geo +const ( + // GeoContinentCodeKey is the attribute Key conforming to the + // "geo.continent.code" semantic conventions. It represents the two-letter code + // representing continent’s name. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + GeoContinentCodeKey = attribute.Key("geo.continent.code") + + // GeoCountryIsoCodeKey is the attribute Key conforming to the + // "geo.country.iso_code" semantic conventions. It represents the two-letter ISO + // Country Code ([ISO 3166-1 alpha2]). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CA" + // + // [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes + GeoCountryIsoCodeKey = attribute.Key("geo.country.iso_code") + + // GeoLocalityNameKey is the attribute Key conforming to the "geo.locality.name" + // semantic conventions. It represents the locality name. Represents the name of + // a city, town, village, or similar populated place. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Montreal", "Berlin" + GeoLocalityNameKey = attribute.Key("geo.locality.name") + + // GeoLocationLatKey is the attribute Key conforming to the "geo.location.lat" + // semantic conventions. It represents the latitude of the geo location in + // [WGS84]. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 45.505918 + // + // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 + GeoLocationLatKey = attribute.Key("geo.location.lat") + + // GeoLocationLonKey is the attribute Key conforming to the "geo.location.lon" + // semantic conventions. It represents the longitude of the geo location in + // [WGS84]. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: -73.61483 + // + // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 + GeoLocationLonKey = attribute.Key("geo.location.lon") + + // GeoPostalCodeKey is the attribute Key conforming to the "geo.postal_code" + // semantic conventions. It represents the postal code associated with the + // location. Values appropriate for this field may also be known as a postcode + // or ZIP code and will vary widely from country to country. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "94040" + GeoPostalCodeKey = attribute.Key("geo.postal_code") + + // GeoRegionIsoCodeKey is the attribute Key conforming to the + // "geo.region.iso_code" semantic conventions. It represents the region ISO code + // ([ISO 3166-2]). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CA-QC" + // + // [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2 + GeoRegionIsoCodeKey = attribute.Key("geo.region.iso_code") +) + +// GeoCountryIsoCode returns an attribute KeyValue conforming to the +// "geo.country.iso_code" semantic conventions. It represents the two-letter ISO +// Country Code ([ISO 3166-1 alpha2]). +// +// [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes +func GeoCountryIsoCode(val string) attribute.KeyValue { + return GeoCountryIsoCodeKey.String(val) +} + +// GeoLocalityName returns an attribute KeyValue conforming to the +// "geo.locality.name" semantic conventions. It represents the locality name. +// Represents the name of a city, town, village, or similar populated place. +func GeoLocalityName(val string) attribute.KeyValue { + return GeoLocalityNameKey.String(val) +} + +// GeoLocationLat returns an attribute KeyValue conforming to the +// "geo.location.lat" semantic conventions. It represents the latitude of the geo +// location in [WGS84]. +// +// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 +func GeoLocationLat(val float64) attribute.KeyValue { + return GeoLocationLatKey.Float64(val) +} + +// GeoLocationLon returns an attribute KeyValue conforming to the +// "geo.location.lon" semantic conventions. It represents the longitude of the +// geo location in [WGS84]. +// +// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 +func GeoLocationLon(val float64) attribute.KeyValue { + return GeoLocationLonKey.Float64(val) +} + +// GeoPostalCode returns an attribute KeyValue conforming to the +// "geo.postal_code" semantic conventions. It represents the postal code +// associated with the location. Values appropriate for this field may also be +// known as a postcode or ZIP code and will vary widely from country to country. +func GeoPostalCode(val string) attribute.KeyValue { + return GeoPostalCodeKey.String(val) +} + +// GeoRegionIsoCode returns an attribute KeyValue conforming to the +// "geo.region.iso_code" semantic conventions. It represents the region ISO code +// ([ISO 3166-2]). +// +// [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2 +func GeoRegionIsoCode(val string) attribute.KeyValue { + return GeoRegionIsoCodeKey.String(val) +} + +// Enum values for geo.continent.code +var ( + // Africa + // Stability: development + GeoContinentCodeAf = GeoContinentCodeKey.String("AF") + // Antarctica + // Stability: development + GeoContinentCodeAn = GeoContinentCodeKey.String("AN") + // Asia + // Stability: development + GeoContinentCodeAs = GeoContinentCodeKey.String("AS") + // Europe + // Stability: development + GeoContinentCodeEu = GeoContinentCodeKey.String("EU") + // North America + // Stability: development + GeoContinentCodeNa = GeoContinentCodeKey.String("NA") + // Oceania + // Stability: development + GeoContinentCodeOc = GeoContinentCodeKey.String("OC") + // South America + // Stability: development + GeoContinentCodeSa = GeoContinentCodeKey.String("SA") +) + +// Namespace: go +const ( + // GoMemoryTypeKey is the attribute Key conforming to the "go.memory.type" + // semantic conventions. It represents the type of memory. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "other", "stack" + GoMemoryTypeKey = attribute.Key("go.memory.type") +) + +// Enum values for go.memory.type +var ( + // Memory allocated from the heap that is reserved for stack space, whether or + // not it is currently in-use. + // Stability: development + GoMemoryTypeStack = GoMemoryTypeKey.String("stack") + // Memory used by the Go runtime, excluding other categories of memory usage + // described in this enumeration. + // Stability: development + GoMemoryTypeOther = GoMemoryTypeKey.String("other") +) + +// Namespace: graphql +const ( + // GraphqlDocumentKey is the attribute Key conforming to the "graphql.document" + // semantic conventions. It represents the GraphQL document being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: query findBookById { bookById(id: ?) { name } } + // Note: The value may be sanitized to exclude sensitive information. + GraphqlDocumentKey = attribute.Key("graphql.document") + + // GraphqlOperationNameKey is the attribute Key conforming to the + // "graphql.operation.name" semantic conventions. It represents the name of the + // operation being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: findBookById + GraphqlOperationNameKey = attribute.Key("graphql.operation.name") + + // GraphqlOperationTypeKey is the attribute Key conforming to the + // "graphql.operation.type" semantic conventions. It represents the type of the + // operation being executed. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "query", "mutation", "subscription" + GraphqlOperationTypeKey = attribute.Key("graphql.operation.type") +) + +// GraphqlDocument returns an attribute KeyValue conforming to the +// "graphql.document" semantic conventions. It represents the GraphQL document +// being executed. +func GraphqlDocument(val string) attribute.KeyValue { + return GraphqlDocumentKey.String(val) +} + +// GraphqlOperationName returns an attribute KeyValue conforming to the +// "graphql.operation.name" semantic conventions. It represents the name of the +// operation being executed. +func GraphqlOperationName(val string) attribute.KeyValue { + return GraphqlOperationNameKey.String(val) +} + +// Enum values for graphql.operation.type +var ( + // GraphQL query + // Stability: development + GraphqlOperationTypeQuery = GraphqlOperationTypeKey.String("query") + // GraphQL mutation + // Stability: development + GraphqlOperationTypeMutation = GraphqlOperationTypeKey.String("mutation") + // GraphQL subscription + // Stability: development + GraphqlOperationTypeSubscription = GraphqlOperationTypeKey.String("subscription") +) + +// Namespace: heroku +const ( + // HerokuAppIDKey is the attribute Key conforming to the "heroku.app.id" + // semantic conventions. It represents the unique identifier for the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2daa2797-e42b-4624-9322-ec3f968df4da" + HerokuAppIDKey = attribute.Key("heroku.app.id") + + // HerokuReleaseCommitKey is the attribute Key conforming to the + // "heroku.release.commit" semantic conventions. It represents the commit hash + // for the current release. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "e6134959463efd8966b20e75b913cafe3f5ec" + HerokuReleaseCommitKey = attribute.Key("heroku.release.commit") + + // HerokuReleaseCreationTimestampKey is the attribute Key conforming to the + // "heroku.release.creation_timestamp" semantic conventions. It represents the + // time and date the release was created. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2022-10-23T18:00:42Z" + HerokuReleaseCreationTimestampKey = attribute.Key("heroku.release.creation_timestamp") +) + +// HerokuAppID returns an attribute KeyValue conforming to the "heroku.app.id" +// semantic conventions. It represents the unique identifier for the application. +func HerokuAppID(val string) attribute.KeyValue { + return HerokuAppIDKey.String(val) +} + +// HerokuReleaseCommit returns an attribute KeyValue conforming to the +// "heroku.release.commit" semantic conventions. It represents the commit hash +// for the current release. +func HerokuReleaseCommit(val string) attribute.KeyValue { + return HerokuReleaseCommitKey.String(val) +} + +// HerokuReleaseCreationTimestamp returns an attribute KeyValue conforming to the +// "heroku.release.creation_timestamp" semantic conventions. It represents the +// time and date the release was created. +func HerokuReleaseCreationTimestamp(val string) attribute.KeyValue { + return HerokuReleaseCreationTimestampKey.String(val) +} + +// Namespace: host +const ( + // HostArchKey is the attribute Key conforming to the "host.arch" semantic + // conventions. It represents the CPU architecture the host system is running + // on. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + HostArchKey = attribute.Key("host.arch") + + // HostCPUCacheL2SizeKey is the attribute Key conforming to the + // "host.cpu.cache.l2.size" semantic conventions. It represents the amount of + // level 2 memory cache available to the processor (in Bytes). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12288000 + HostCPUCacheL2SizeKey = attribute.Key("host.cpu.cache.l2.size") + + // HostCPUFamilyKey is the attribute Key conforming to the "host.cpu.family" + // semantic conventions. It represents the family or generation of the CPU. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "6", "PA-RISC 1.1e" + HostCPUFamilyKey = attribute.Key("host.cpu.family") + + // HostCPUModelIDKey is the attribute Key conforming to the "host.cpu.model.id" + // semantic conventions. It represents the model identifier. It provides more + // granular information about the CPU, distinguishing it from other CPUs within + // the same family. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "6", "9000/778/B180L" + HostCPUModelIDKey = attribute.Key("host.cpu.model.id") + + // HostCPUModelNameKey is the attribute Key conforming to the + // "host.cpu.model.name" semantic conventions. It represents the model + // designation of the processor. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "11th Gen Intel(R) Core(TM) i7-1185G7 @ 3.00GHz" + HostCPUModelNameKey = attribute.Key("host.cpu.model.name") + + // HostCPUSteppingKey is the attribute Key conforming to the "host.cpu.stepping" + // semantic conventions. It represents the stepping or core revisions. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1", "r1p1" + HostCPUSteppingKey = attribute.Key("host.cpu.stepping") + + // HostCPUVendorIDKey is the attribute Key conforming to the + // "host.cpu.vendor.id" semantic conventions. It represents the processor + // manufacturer identifier. A maximum 12-character string. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "GenuineIntel" + // Note: [CPUID] command returns the vendor ID string in EBX, EDX and ECX + // registers. Writing these to memory in this order results in a 12-character + // string. + // + // [CPUID]: https://wiki.osdev.org/CPUID + HostCPUVendorIDKey = attribute.Key("host.cpu.vendor.id") + + // HostIDKey is the attribute Key conforming to the "host.id" semantic + // conventions. It represents the unique host ID. For Cloud, this must be the + // instance_id assigned by the cloud provider. For non-containerized systems, + // this should be the `machine-id`. See the table below for the sources to use + // to determine the `machine-id` based on operating system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "fdbf79e8af94cb7f9e8df36789187052" + HostIDKey = attribute.Key("host.id") + + // HostImageIDKey is the attribute Key conforming to the "host.image.id" + // semantic conventions. It represents the vM image ID or host OS image ID. For + // Cloud, this value is from the provider. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ami-07b06b442921831e5" + HostImageIDKey = attribute.Key("host.image.id") + + // HostImageNameKey is the attribute Key conforming to the "host.image.name" + // semantic conventions. It represents the name of the VM image or OS install + // the host was instantiated from. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "infra-ami-eks-worker-node-7d4ec78312", "CentOS-8-x86_64-1905" + HostImageNameKey = attribute.Key("host.image.name") + + // HostImageVersionKey is the attribute Key conforming to the + // "host.image.version" semantic conventions. It represents the version string + // of the VM image or host OS as defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0.1" + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + HostImageVersionKey = attribute.Key("host.image.version") + + // HostIPKey is the attribute Key conforming to the "host.ip" semantic + // conventions. It represents the available IP addresses of the host, excluding + // loopback interfaces. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "192.168.1.140", "fe80::abc2:4a28:737a:609e" + // Note: IPv4 Addresses MUST be specified in dotted-quad notation. IPv6 + // addresses MUST be specified in the [RFC 5952] format. + // + // [RFC 5952]: https://www.rfc-editor.org/rfc/rfc5952.html + HostIPKey = attribute.Key("host.ip") + + // HostMacKey is the attribute Key conforming to the "host.mac" semantic + // conventions. It represents the available MAC addresses of the host, excluding + // loopback interfaces. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "AC-DE-48-23-45-67", "AC-DE-48-23-45-67-01-9F" + // Note: MAC Addresses MUST be represented in [IEEE RA hexadecimal form]: as + // hyphen-separated octets in uppercase hexadecimal form from most to least + // significant. + // + // [IEEE RA hexadecimal form]: https://standards.ieee.org/wp-content/uploads/import/documents/tutorials/eui.pdf + HostMacKey = attribute.Key("host.mac") + + // HostNameKey is the attribute Key conforming to the "host.name" semantic + // conventions. It represents the name of the host. On Unix systems, it may + // contain what the hostname command returns, or the fully qualified hostname, + // or another name specified by the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-test" + HostNameKey = attribute.Key("host.name") + + // HostTypeKey is the attribute Key conforming to the "host.type" semantic + // conventions. It represents the type of host. For Cloud, this must be the + // machine type. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "n1-standard-1" + HostTypeKey = attribute.Key("host.type") +) + +// HostCPUCacheL2Size returns an attribute KeyValue conforming to the +// "host.cpu.cache.l2.size" semantic conventions. It represents the amount of +// level 2 memory cache available to the processor (in Bytes). +func HostCPUCacheL2Size(val int) attribute.KeyValue { + return HostCPUCacheL2SizeKey.Int(val) +} + +// HostCPUFamily returns an attribute KeyValue conforming to the +// "host.cpu.family" semantic conventions. It represents the family or generation +// of the CPU. +func HostCPUFamily(val string) attribute.KeyValue { + return HostCPUFamilyKey.String(val) +} + +// HostCPUModelID returns an attribute KeyValue conforming to the +// "host.cpu.model.id" semantic conventions. It represents the model identifier. +// It provides more granular information about the CPU, distinguishing it from +// other CPUs within the same family. +func HostCPUModelID(val string) attribute.KeyValue { + return HostCPUModelIDKey.String(val) +} + +// HostCPUModelName returns an attribute KeyValue conforming to the +// "host.cpu.model.name" semantic conventions. It represents the model +// designation of the processor. +func HostCPUModelName(val string) attribute.KeyValue { + return HostCPUModelNameKey.String(val) +} + +// HostCPUStepping returns an attribute KeyValue conforming to the +// "host.cpu.stepping" semantic conventions. It represents the stepping or core +// revisions. +func HostCPUStepping(val string) attribute.KeyValue { + return HostCPUSteppingKey.String(val) +} + +// HostCPUVendorID returns an attribute KeyValue conforming to the +// "host.cpu.vendor.id" semantic conventions. It represents the processor +// manufacturer identifier. A maximum 12-character string. +func HostCPUVendorID(val string) attribute.KeyValue { + return HostCPUVendorIDKey.String(val) +} + +// HostID returns an attribute KeyValue conforming to the "host.id" semantic +// conventions. It represents the unique host ID. For Cloud, this must be the +// instance_id assigned by the cloud provider. For non-containerized systems, +// this should be the `machine-id`. See the table below for the sources to use to +// determine the `machine-id` based on operating system. +func HostID(val string) attribute.KeyValue { + return HostIDKey.String(val) +} + +// HostImageID returns an attribute KeyValue conforming to the "host.image.id" +// semantic conventions. It represents the vM image ID or host OS image ID. For +// Cloud, this value is from the provider. +func HostImageID(val string) attribute.KeyValue { + return HostImageIDKey.String(val) +} + +// HostImageName returns an attribute KeyValue conforming to the +// "host.image.name" semantic conventions. It represents the name of the VM image +// or OS install the host was instantiated from. +func HostImageName(val string) attribute.KeyValue { + return HostImageNameKey.String(val) +} + +// HostImageVersion returns an attribute KeyValue conforming to the +// "host.image.version" semantic conventions. It represents the version string of +// the VM image or host OS as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func HostImageVersion(val string) attribute.KeyValue { + return HostImageVersionKey.String(val) +} + +// HostIP returns an attribute KeyValue conforming to the "host.ip" semantic +// conventions. It represents the available IP addresses of the host, excluding +// loopback interfaces. +func HostIP(val ...string) attribute.KeyValue { + return HostIPKey.StringSlice(val) +} + +// HostMac returns an attribute KeyValue conforming to the "host.mac" semantic +// conventions. It represents the available MAC addresses of the host, excluding +// loopback interfaces. +func HostMac(val ...string) attribute.KeyValue { + return HostMacKey.StringSlice(val) +} + +// HostName returns an attribute KeyValue conforming to the "host.name" semantic +// conventions. It represents the name of the host. On Unix systems, it may +// contain what the hostname command returns, or the fully qualified hostname, or +// another name specified by the user. +func HostName(val string) attribute.KeyValue { + return HostNameKey.String(val) +} + +// HostType returns an attribute KeyValue conforming to the "host.type" semantic +// conventions. It represents the type of host. For Cloud, this must be the +// machine type. +func HostType(val string) attribute.KeyValue { + return HostTypeKey.String(val) +} + +// Enum values for host.arch +var ( + // AMD64 + // Stability: development + HostArchAMD64 = HostArchKey.String("amd64") + // ARM32 + // Stability: development + HostArchARM32 = HostArchKey.String("arm32") + // ARM64 + // Stability: development + HostArchARM64 = HostArchKey.String("arm64") + // Itanium + // Stability: development + HostArchIA64 = HostArchKey.String("ia64") + // 32-bit PowerPC + // Stability: development + HostArchPPC32 = HostArchKey.String("ppc32") + // 64-bit PowerPC + // Stability: development + HostArchPPC64 = HostArchKey.String("ppc64") + // IBM z/Architecture + // Stability: development + HostArchS390x = HostArchKey.String("s390x") + // 32-bit x86 + // Stability: development + HostArchX86 = HostArchKey.String("x86") +) + +// Namespace: http +const ( + // HTTPConnectionStateKey is the attribute Key conforming to the + // "http.connection.state" semantic conventions. It represents the state of the + // HTTP connection in the HTTP connection pool. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "active", "idle" + HTTPConnectionStateKey = attribute.Key("http.connection.state") + + // HTTPRequestBodySizeKey is the attribute Key conforming to the + // "http.request.body.size" semantic conventions. It represents the size of the + // request payload body in bytes. This is the number of bytes transferred + // excluding headers and is often, but not always, present as the + // [Content-Length] header. For requests using transport encoding, this should + // be the compressed size. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length + HTTPRequestBodySizeKey = attribute.Key("http.request.body.size") + + // HTTPRequestMethodKey is the attribute Key conforming to the + // "http.request.method" semantic conventions. It represents the hTTP request + // method. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GET", "POST", "HEAD" + // Note: HTTP request method value SHOULD be "known" to the instrumentation. + // By default, this convention defines "known" methods as the ones listed in + // [RFC9110] + // and the PATCH method defined in [RFC5789]. + // + // If the HTTP request method is not known to instrumentation, it MUST set the + // `http.request.method` attribute to `_OTHER`. + // + // If the HTTP instrumentation could end up converting valid HTTP request + // methods to `_OTHER`, then it MUST provide a way to override + // the list of known HTTP methods. If this override is done via environment + // variable, then the environment variable MUST be named + // OTEL_INSTRUMENTATION_HTTP_KNOWN_METHODS and support a comma-separated list of + // case-sensitive known HTTP methods + // (this list MUST be a full override of the default known method, it is not a + // list of known methods in addition to the defaults). + // + // HTTP method names are case-sensitive and `http.request.method` attribute + // value MUST match a known HTTP method name exactly. + // Instrumentations for specific web frameworks that consider HTTP methods to be + // case insensitive, SHOULD populate a canonical equivalent. + // Tracing instrumentations that do so, MUST also set + // `http.request.method_original` to the original value. + // + // [RFC9110]: https://www.rfc-editor.org/rfc/rfc9110.html#name-methods + // [RFC5789]: https://www.rfc-editor.org/rfc/rfc5789.html + HTTPRequestMethodKey = attribute.Key("http.request.method") + + // HTTPRequestMethodOriginalKey is the attribute Key conforming to the + // "http.request.method_original" semantic conventions. It represents the + // original HTTP method sent by the client in the request line. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GeT", "ACL", "foo" + HTTPRequestMethodOriginalKey = attribute.Key("http.request.method_original") + + // HTTPRequestResendCountKey is the attribute Key conforming to the + // "http.request.resend_count" semantic conventions. It represents the ordinal + // number of request resending attempt (for any reason, including redirects). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Note: The resend count SHOULD be updated each time an HTTP request gets + // resent by the client, regardless of what was the cause of the resending (e.g. + // redirection, authorization failure, 503 Server Unavailable, network issues, + // or any other). + HTTPRequestResendCountKey = attribute.Key("http.request.resend_count") + + // HTTPRequestSizeKey is the attribute Key conforming to the "http.request.size" + // semantic conventions. It represents the total size of the request in bytes. + // This should be the total number of bytes sent over the wire, including the + // request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, and request + // body if any. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + HTTPRequestSizeKey = attribute.Key("http.request.size") + + // HTTPResponseBodySizeKey is the attribute Key conforming to the + // "http.response.body.size" semantic conventions. It represents the size of the + // response payload body in bytes. This is the number of bytes transferred + // excluding headers and is often, but not always, present as the + // [Content-Length] header. For requests using transport encoding, this should + // be the compressed size. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length + HTTPResponseBodySizeKey = attribute.Key("http.response.body.size") + + // HTTPResponseSizeKey is the attribute Key conforming to the + // "http.response.size" semantic conventions. It represents the total size of + // the response in bytes. This should be the total number of bytes sent over the + // wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3), + // headers, and response body and trailers if any. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + HTTPResponseSizeKey = attribute.Key("http.response.size") + + // HTTPResponseStatusCodeKey is the attribute Key conforming to the + // "http.response.status_code" semantic conventions. It represents the + // [HTTP response status code]. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 200 + // + // [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6 + HTTPResponseStatusCodeKey = attribute.Key("http.response.status_code") + + // HTTPRouteKey is the attribute Key conforming to the "http.route" semantic + // conventions. It represents the matched route, that is, the path template in + // the format used by the respective server framework. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "/users/:userID?", "{controller}/{action}/{id?}" + // Note: MUST NOT be populated when this is not supported by the HTTP server + // framework as the route attribute should have low-cardinality and the URI path + // can NOT substitute it. + // SHOULD include the [application root] if there is one. + // + // [application root]: /docs/http/http-spans.md#http-server-definitions + HTTPRouteKey = attribute.Key("http.route") +) + +// HTTPRequestBodySize returns an attribute KeyValue conforming to the +// "http.request.body.size" semantic conventions. It represents the size of the +// request payload body in bytes. This is the number of bytes transferred +// excluding headers and is often, but not always, present as the +// [Content-Length] header. For requests using transport encoding, this should be +// the compressed size. +// +// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length +func HTTPRequestBodySize(val int) attribute.KeyValue { + return HTTPRequestBodySizeKey.Int(val) +} + +// HTTPRequestMethodOriginal returns an attribute KeyValue conforming to the +// "http.request.method_original" semantic conventions. It represents the +// original HTTP method sent by the client in the request line. +func HTTPRequestMethodOriginal(val string) attribute.KeyValue { + return HTTPRequestMethodOriginalKey.String(val) +} + +// HTTPRequestResendCount returns an attribute KeyValue conforming to the +// "http.request.resend_count" semantic conventions. It represents the ordinal +// number of request resending attempt (for any reason, including redirects). +func HTTPRequestResendCount(val int) attribute.KeyValue { + return HTTPRequestResendCountKey.Int(val) +} + +// HTTPRequestSize returns an attribute KeyValue conforming to the +// "http.request.size" semantic conventions. It represents the total size of the +// request in bytes. This should be the total number of bytes sent over the wire, +// including the request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, +// and request body if any. +func HTTPRequestSize(val int) attribute.KeyValue { + return HTTPRequestSizeKey.Int(val) +} + +// HTTPResponseBodySize returns an attribute KeyValue conforming to the +// "http.response.body.size" semantic conventions. It represents the size of the +// response payload body in bytes. This is the number of bytes transferred +// excluding headers and is often, but not always, present as the +// [Content-Length] header. For requests using transport encoding, this should be +// the compressed size. +// +// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length +func HTTPResponseBodySize(val int) attribute.KeyValue { + return HTTPResponseBodySizeKey.Int(val) +} + +// HTTPResponseSize returns an attribute KeyValue conforming to the +// "http.response.size" semantic conventions. It represents the total size of the +// response in bytes. This should be the total number of bytes sent over the +// wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3), +// headers, and response body and trailers if any. +func HTTPResponseSize(val int) attribute.KeyValue { + return HTTPResponseSizeKey.Int(val) +} + +// HTTPResponseStatusCode returns an attribute KeyValue conforming to the +// "http.response.status_code" semantic conventions. It represents the +// [HTTP response status code]. +// +// [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6 +func HTTPResponseStatusCode(val int) attribute.KeyValue { + return HTTPResponseStatusCodeKey.Int(val) +} + +// HTTPRoute returns an attribute KeyValue conforming to the "http.route" +// semantic conventions. It represents the matched route, that is, the path +// template in the format used by the respective server framework. +func HTTPRoute(val string) attribute.KeyValue { + return HTTPRouteKey.String(val) +} + +// Enum values for http.connection.state +var ( + // active state. + // Stability: development + HTTPConnectionStateActive = HTTPConnectionStateKey.String("active") + // idle state. + // Stability: development + HTTPConnectionStateIdle = HTTPConnectionStateKey.String("idle") +) + +// Enum values for http.request.method +var ( + // CONNECT method. + // Stability: stable + HTTPRequestMethodConnect = HTTPRequestMethodKey.String("CONNECT") + // DELETE method. + // Stability: stable + HTTPRequestMethodDelete = HTTPRequestMethodKey.String("DELETE") + // GET method. + // Stability: stable + HTTPRequestMethodGet = HTTPRequestMethodKey.String("GET") + // HEAD method. + // Stability: stable + HTTPRequestMethodHead = HTTPRequestMethodKey.String("HEAD") + // OPTIONS method. + // Stability: stable + HTTPRequestMethodOptions = HTTPRequestMethodKey.String("OPTIONS") + // PATCH method. + // Stability: stable + HTTPRequestMethodPatch = HTTPRequestMethodKey.String("PATCH") + // POST method. + // Stability: stable + HTTPRequestMethodPost = HTTPRequestMethodKey.String("POST") + // PUT method. + // Stability: stable + HTTPRequestMethodPut = HTTPRequestMethodKey.String("PUT") + // TRACE method. + // Stability: stable + HTTPRequestMethodTrace = HTTPRequestMethodKey.String("TRACE") + // Any HTTP method that the instrumentation has no prior knowledge of. + // Stability: stable + HTTPRequestMethodOther = HTTPRequestMethodKey.String("_OTHER") +) + +// Namespace: hw +const ( + // HwIDKey is the attribute Key conforming to the "hw.id" semantic conventions. + // It represents an identifier for the hardware component, unique within the + // monitored host. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "win32battery_battery_testsysa33_1" + HwIDKey = attribute.Key("hw.id") + + // HwNameKey is the attribute Key conforming to the "hw.name" semantic + // conventions. It represents an easily-recognizable name for the hardware + // component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "eth0" + HwNameKey = attribute.Key("hw.name") + + // HwParentKey is the attribute Key conforming to the "hw.parent" semantic + // conventions. It represents the unique identifier of the parent component + // (typically the `hw.id` attribute of the enclosure, or disk controller). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "dellStorage_perc_0" + HwParentKey = attribute.Key("hw.parent") + + // HwStateKey is the attribute Key conforming to the "hw.state" semantic + // conventions. It represents the current state of the component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + HwStateKey = attribute.Key("hw.state") + + // HwTypeKey is the attribute Key conforming to the "hw.type" semantic + // conventions. It represents the type of the component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: Describes the category of the hardware component for which `hw.state` + // is being reported. For example, `hw.type=temperature` along with + // `hw.state=degraded` would indicate that the temperature of the hardware + // component has been reported as `degraded`. + HwTypeKey = attribute.Key("hw.type") +) + +// HwID returns an attribute KeyValue conforming to the "hw.id" semantic +// conventions. It represents an identifier for the hardware component, unique +// within the monitored host. +func HwID(val string) attribute.KeyValue { + return HwIDKey.String(val) +} + +// HwName returns an attribute KeyValue conforming to the "hw.name" semantic +// conventions. It represents an easily-recognizable name for the hardware +// component. +func HwName(val string) attribute.KeyValue { + return HwNameKey.String(val) +} + +// HwParent returns an attribute KeyValue conforming to the "hw.parent" semantic +// conventions. It represents the unique identifier of the parent component +// (typically the `hw.id` attribute of the enclosure, or disk controller). +func HwParent(val string) attribute.KeyValue { + return HwParentKey.String(val) +} + +// Enum values for hw.state +var ( + // Ok + // Stability: development + HwStateOk = HwStateKey.String("ok") + // Degraded + // Stability: development + HwStateDegraded = HwStateKey.String("degraded") + // Failed + // Stability: development + HwStateFailed = HwStateKey.String("failed") +) + +// Enum values for hw.type +var ( + // Battery + // Stability: development + HwTypeBattery = HwTypeKey.String("battery") + // CPU + // Stability: development + HwTypeCPU = HwTypeKey.String("cpu") + // Disk controller + // Stability: development + HwTypeDiskController = HwTypeKey.String("disk_controller") + // Enclosure + // Stability: development + HwTypeEnclosure = HwTypeKey.String("enclosure") + // Fan + // Stability: development + HwTypeFan = HwTypeKey.String("fan") + // GPU + // Stability: development + HwTypeGpu = HwTypeKey.String("gpu") + // Logical disk + // Stability: development + HwTypeLogicalDisk = HwTypeKey.String("logical_disk") + // Memory + // Stability: development + HwTypeMemory = HwTypeKey.String("memory") + // Network + // Stability: development + HwTypeNetwork = HwTypeKey.String("network") + // Physical disk + // Stability: development + HwTypePhysicalDisk = HwTypeKey.String("physical_disk") + // Power supply + // Stability: development + HwTypePowerSupply = HwTypeKey.String("power_supply") + // Tape drive + // Stability: development + HwTypeTapeDrive = HwTypeKey.String("tape_drive") + // Temperature + // Stability: development + HwTypeTemperature = HwTypeKey.String("temperature") + // Voltage + // Stability: development + HwTypeVoltage = HwTypeKey.String("voltage") +) + +// Namespace: k8s +const ( + // K8SClusterNameKey is the attribute Key conforming to the "k8s.cluster.name" + // semantic conventions. It represents the name of the cluster. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-cluster" + K8SClusterNameKey = attribute.Key("k8s.cluster.name") + + // K8SClusterUIDKey is the attribute Key conforming to the "k8s.cluster.uid" + // semantic conventions. It represents a pseudo-ID for the cluster, set to the + // UID of the `kube-system` namespace. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: K8s doesn't have support for obtaining a cluster ID. If this is ever + // added, we will recommend collecting the `k8s.cluster.uid` through the + // official APIs. In the meantime, we are able to use the `uid` of the + // `kube-system` namespace as a proxy for cluster ID. Read on for the + // rationale. + // + // Every object created in a K8s cluster is assigned a distinct UID. The + // `kube-system` namespace is used by Kubernetes itself and will exist + // for the lifetime of the cluster. Using the `uid` of the `kube-system` + // namespace is a reasonable proxy for the K8s ClusterID as it will only + // change if the cluster is rebuilt. Furthermore, Kubernetes UIDs are + // UUIDs as standardized by + // [ISO/IEC 9834-8 and ITU-T X.667]. + // Which states: + // + // > If generated according to one of the mechanisms defined in Rec. + // > ITU-T X.667 | ISO/IEC 9834-8, a UUID is either guaranteed to be + // > different from all other UUIDs generated before 3603 A.D., or is + // > extremely likely to be different (depending on the mechanism chosen). + // + // Therefore, UIDs between clusters should be extremely unlikely to + // conflict. + // + // [ISO/IEC 9834-8 and ITU-T X.667]: https://www.itu.int/ITU-T/studygroups/com17/oid.html + K8SClusterUIDKey = attribute.Key("k8s.cluster.uid") + + // K8SContainerNameKey is the attribute Key conforming to the + // "k8s.container.name" semantic conventions. It represents the name of the + // Container from Pod specification, must be unique within a Pod. Container + // runtime usually uses different globally unique name (`container.name`). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "redis" + K8SContainerNameKey = attribute.Key("k8s.container.name") + + // K8SContainerRestartCountKey is the attribute Key conforming to the + // "k8s.container.restart_count" semantic conventions. It represents the number + // of times the container was restarted. This attribute can be used to identify + // a particular container (running or stopped) within a container spec. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + K8SContainerRestartCountKey = attribute.Key("k8s.container.restart_count") + + // K8SContainerStatusLastTerminatedReasonKey is the attribute Key conforming to + // the "k8s.container.status.last_terminated_reason" semantic conventions. It + // represents the last terminated reason of the Container. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Evicted", "Error" + K8SContainerStatusLastTerminatedReasonKey = attribute.Key("k8s.container.status.last_terminated_reason") + + // K8SCronJobNameKey is the attribute Key conforming to the "k8s.cronjob.name" + // semantic conventions. It represents the name of the CronJob. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SCronJobNameKey = attribute.Key("k8s.cronjob.name") + + // K8SCronJobUIDKey is the attribute Key conforming to the "k8s.cronjob.uid" + // semantic conventions. It represents the UID of the CronJob. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SCronJobUIDKey = attribute.Key("k8s.cronjob.uid") + + // K8SDaemonSetNameKey is the attribute Key conforming to the + // "k8s.daemonset.name" semantic conventions. It represents the name of the + // DaemonSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SDaemonSetNameKey = attribute.Key("k8s.daemonset.name") + + // K8SDaemonSetUIDKey is the attribute Key conforming to the "k8s.daemonset.uid" + // semantic conventions. It represents the UID of the DaemonSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SDaemonSetUIDKey = attribute.Key("k8s.daemonset.uid") + + // K8SDeploymentNameKey is the attribute Key conforming to the + // "k8s.deployment.name" semantic conventions. It represents the name of the + // Deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SDeploymentNameKey = attribute.Key("k8s.deployment.name") + + // K8SDeploymentUIDKey is the attribute Key conforming to the + // "k8s.deployment.uid" semantic conventions. It represents the UID of the + // Deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SDeploymentUIDKey = attribute.Key("k8s.deployment.uid") + + // K8SJobNameKey is the attribute Key conforming to the "k8s.job.name" semantic + // conventions. It represents the name of the Job. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SJobNameKey = attribute.Key("k8s.job.name") + + // K8SJobUIDKey is the attribute Key conforming to the "k8s.job.uid" semantic + // conventions. It represents the UID of the Job. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SJobUIDKey = attribute.Key("k8s.job.uid") + + // K8SNamespaceNameKey is the attribute Key conforming to the + // "k8s.namespace.name" semantic conventions. It represents the name of the + // namespace that the pod is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "default" + K8SNamespaceNameKey = attribute.Key("k8s.namespace.name") + + // K8SNamespacePhaseKey is the attribute Key conforming to the + // "k8s.namespace.phase" semantic conventions. It represents the phase of the + // K8s namespace. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "active", "terminating" + // Note: This attribute aligns with the `phase` field of the + // [K8s NamespaceStatus] + // + // [K8s NamespaceStatus]: https://kubernetes.io/docs/reference/generated/kubernetes-api/v1.30/#namespacestatus-v1-core + K8SNamespacePhaseKey = attribute.Key("k8s.namespace.phase") + + // K8SNodeNameKey is the attribute Key conforming to the "k8s.node.name" + // semantic conventions. It represents the name of the Node. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "node-1" + K8SNodeNameKey = attribute.Key("k8s.node.name") + + // K8SNodeUIDKey is the attribute Key conforming to the "k8s.node.uid" semantic + // conventions. It represents the UID of the Node. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1eb3a0c6-0477-4080-a9cb-0cb7db65c6a2" + K8SNodeUIDKey = attribute.Key("k8s.node.uid") + + // K8SPodNameKey is the attribute Key conforming to the "k8s.pod.name" semantic + // conventions. It represents the name of the Pod. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-pod-autoconf" + K8SPodNameKey = attribute.Key("k8s.pod.name") + + // K8SPodUIDKey is the attribute Key conforming to the "k8s.pod.uid" semantic + // conventions. It represents the UID of the Pod. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SPodUIDKey = attribute.Key("k8s.pod.uid") + + // K8SReplicaSetNameKey is the attribute Key conforming to the + // "k8s.replicaset.name" semantic conventions. It represents the name of the + // ReplicaSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SReplicaSetNameKey = attribute.Key("k8s.replicaset.name") + + // K8SReplicaSetUIDKey is the attribute Key conforming to the + // "k8s.replicaset.uid" semantic conventions. It represents the UID of the + // ReplicaSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SReplicaSetUIDKey = attribute.Key("k8s.replicaset.uid") + + // K8SStatefulSetNameKey is the attribute Key conforming to the + // "k8s.statefulset.name" semantic conventions. It represents the name of the + // StatefulSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SStatefulSetNameKey = attribute.Key("k8s.statefulset.name") + + // K8SStatefulSetUIDKey is the attribute Key conforming to the + // "k8s.statefulset.uid" semantic conventions. It represents the UID of the + // StatefulSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SStatefulSetUIDKey = attribute.Key("k8s.statefulset.uid") + + // K8SVolumeNameKey is the attribute Key conforming to the "k8s.volume.name" + // semantic conventions. It represents the name of the K8s volume. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "volume0" + K8SVolumeNameKey = attribute.Key("k8s.volume.name") + + // K8SVolumeTypeKey is the attribute Key conforming to the "k8s.volume.type" + // semantic conventions. It represents the type of the K8s volume. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "emptyDir", "persistentVolumeClaim" + K8SVolumeTypeKey = attribute.Key("k8s.volume.type") +) + +// K8SClusterName returns an attribute KeyValue conforming to the +// "k8s.cluster.name" semantic conventions. It represents the name of the +// cluster. +func K8SClusterName(val string) attribute.KeyValue { + return K8SClusterNameKey.String(val) +} + +// K8SClusterUID returns an attribute KeyValue conforming to the +// "k8s.cluster.uid" semantic conventions. It represents a pseudo-ID for the +// cluster, set to the UID of the `kube-system` namespace. +func K8SClusterUID(val string) attribute.KeyValue { + return K8SClusterUIDKey.String(val) +} + +// K8SContainerName returns an attribute KeyValue conforming to the +// "k8s.container.name" semantic conventions. It represents the name of the +// Container from Pod specification, must be unique within a Pod. Container +// runtime usually uses different globally unique name (`container.name`). +func K8SContainerName(val string) attribute.KeyValue { + return K8SContainerNameKey.String(val) +} + +// K8SContainerRestartCount returns an attribute KeyValue conforming to the +// "k8s.container.restart_count" semantic conventions. It represents the number +// of times the container was restarted. This attribute can be used to identify a +// particular container (running or stopped) within a container spec. +func K8SContainerRestartCount(val int) attribute.KeyValue { + return K8SContainerRestartCountKey.Int(val) +} + +// K8SContainerStatusLastTerminatedReason returns an attribute KeyValue +// conforming to the "k8s.container.status.last_terminated_reason" semantic +// conventions. It represents the last terminated reason of the Container. +func K8SContainerStatusLastTerminatedReason(val string) attribute.KeyValue { + return K8SContainerStatusLastTerminatedReasonKey.String(val) +} + +// K8SCronJobName returns an attribute KeyValue conforming to the +// "k8s.cronjob.name" semantic conventions. It represents the name of the +// CronJob. +func K8SCronJobName(val string) attribute.KeyValue { + return K8SCronJobNameKey.String(val) +} + +// K8SCronJobUID returns an attribute KeyValue conforming to the +// "k8s.cronjob.uid" semantic conventions. It represents the UID of the CronJob. +func K8SCronJobUID(val string) attribute.KeyValue { + return K8SCronJobUIDKey.String(val) +} + +// K8SDaemonSetName returns an attribute KeyValue conforming to the +// "k8s.daemonset.name" semantic conventions. It represents the name of the +// DaemonSet. +func K8SDaemonSetName(val string) attribute.KeyValue { + return K8SDaemonSetNameKey.String(val) +} + +// K8SDaemonSetUID returns an attribute KeyValue conforming to the +// "k8s.daemonset.uid" semantic conventions. It represents the UID of the +// DaemonSet. +func K8SDaemonSetUID(val string) attribute.KeyValue { + return K8SDaemonSetUIDKey.String(val) +} + +// K8SDeploymentName returns an attribute KeyValue conforming to the +// "k8s.deployment.name" semantic conventions. It represents the name of the +// Deployment. +func K8SDeploymentName(val string) attribute.KeyValue { + return K8SDeploymentNameKey.String(val) +} + +// K8SDeploymentUID returns an attribute KeyValue conforming to the +// "k8s.deployment.uid" semantic conventions. It represents the UID of the +// Deployment. +func K8SDeploymentUID(val string) attribute.KeyValue { + return K8SDeploymentUIDKey.String(val) +} + +// K8SJobName returns an attribute KeyValue conforming to the "k8s.job.name" +// semantic conventions. It represents the name of the Job. +func K8SJobName(val string) attribute.KeyValue { + return K8SJobNameKey.String(val) +} + +// K8SJobUID returns an attribute KeyValue conforming to the "k8s.job.uid" +// semantic conventions. It represents the UID of the Job. +func K8SJobUID(val string) attribute.KeyValue { + return K8SJobUIDKey.String(val) +} + +// K8SNamespaceName returns an attribute KeyValue conforming to the +// "k8s.namespace.name" semantic conventions. It represents the name of the +// namespace that the pod is running in. +func K8SNamespaceName(val string) attribute.KeyValue { + return K8SNamespaceNameKey.String(val) +} + +// K8SNodeName returns an attribute KeyValue conforming to the "k8s.node.name" +// semantic conventions. It represents the name of the Node. +func K8SNodeName(val string) attribute.KeyValue { + return K8SNodeNameKey.String(val) +} + +// K8SNodeUID returns an attribute KeyValue conforming to the "k8s.node.uid" +// semantic conventions. It represents the UID of the Node. +func K8SNodeUID(val string) attribute.KeyValue { + return K8SNodeUIDKey.String(val) +} + +// K8SPodName returns an attribute KeyValue conforming to the "k8s.pod.name" +// semantic conventions. It represents the name of the Pod. +func K8SPodName(val string) attribute.KeyValue { + return K8SPodNameKey.String(val) +} + +// K8SPodUID returns an attribute KeyValue conforming to the "k8s.pod.uid" +// semantic conventions. It represents the UID of the Pod. +func K8SPodUID(val string) attribute.KeyValue { + return K8SPodUIDKey.String(val) +} + +// K8SReplicaSetName returns an attribute KeyValue conforming to the +// "k8s.replicaset.name" semantic conventions. It represents the name of the +// ReplicaSet. +func K8SReplicaSetName(val string) attribute.KeyValue { + return K8SReplicaSetNameKey.String(val) +} + +// K8SReplicaSetUID returns an attribute KeyValue conforming to the +// "k8s.replicaset.uid" semantic conventions. It represents the UID of the +// ReplicaSet. +func K8SReplicaSetUID(val string) attribute.KeyValue { + return K8SReplicaSetUIDKey.String(val) +} + +// K8SStatefulSetName returns an attribute KeyValue conforming to the +// "k8s.statefulset.name" semantic conventions. It represents the name of the +// StatefulSet. +func K8SStatefulSetName(val string) attribute.KeyValue { + return K8SStatefulSetNameKey.String(val) +} + +// K8SStatefulSetUID returns an attribute KeyValue conforming to the +// "k8s.statefulset.uid" semantic conventions. It represents the UID of the +// StatefulSet. +func K8SStatefulSetUID(val string) attribute.KeyValue { + return K8SStatefulSetUIDKey.String(val) +} + +// K8SVolumeName returns an attribute KeyValue conforming to the +// "k8s.volume.name" semantic conventions. It represents the name of the K8s +// volume. +func K8SVolumeName(val string) attribute.KeyValue { + return K8SVolumeNameKey.String(val) +} + +// Enum values for k8s.namespace.phase +var ( + // Active namespace phase as described by [K8s API] + // Stability: development + // + // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase + K8SNamespacePhaseActive = K8SNamespacePhaseKey.String("active") + // Terminating namespace phase as described by [K8s API] + // Stability: development + // + // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase + K8SNamespacePhaseTerminating = K8SNamespacePhaseKey.String("terminating") +) + +// Enum values for k8s.volume.type +var ( + // A [persistentVolumeClaim] volume + // Stability: development + // + // [persistentVolumeClaim]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#persistentvolumeclaim + K8SVolumeTypePersistentVolumeClaim = K8SVolumeTypeKey.String("persistentVolumeClaim") + // A [configMap] volume + // Stability: development + // + // [configMap]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#configmap + K8SVolumeTypeConfigMap = K8SVolumeTypeKey.String("configMap") + // A [downwardAPI] volume + // Stability: development + // + // [downwardAPI]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#downwardapi + K8SVolumeTypeDownwardAPI = K8SVolumeTypeKey.String("downwardAPI") + // An [emptyDir] volume + // Stability: development + // + // [emptyDir]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#emptydir + K8SVolumeTypeEmptyDir = K8SVolumeTypeKey.String("emptyDir") + // A [secret] volume + // Stability: development + // + // [secret]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#secret + K8SVolumeTypeSecret = K8SVolumeTypeKey.String("secret") + // A [local] volume + // Stability: development + // + // [local]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#local + K8SVolumeTypeLocal = K8SVolumeTypeKey.String("local") +) + +// Namespace: linux +const ( + // LinuxMemorySlabStateKey is the attribute Key conforming to the + // "linux.memory.slab.state" semantic conventions. It represents the Linux Slab + // memory state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "reclaimable", "unreclaimable" + LinuxMemorySlabStateKey = attribute.Key("linux.memory.slab.state") +) + +// Enum values for linux.memory.slab.state +var ( + // reclaimable + // Stability: development + LinuxMemorySlabStateReclaimable = LinuxMemorySlabStateKey.String("reclaimable") + // unreclaimable + // Stability: development + LinuxMemorySlabStateUnreclaimable = LinuxMemorySlabStateKey.String("unreclaimable") +) + +// Namespace: log +const ( + // LogFileNameKey is the attribute Key conforming to the "log.file.name" + // semantic conventions. It represents the basename of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "audit.log" + LogFileNameKey = attribute.Key("log.file.name") + + // LogFileNameResolvedKey is the attribute Key conforming to the + // "log.file.name_resolved" semantic conventions. It represents the basename of + // the file, with symlinks resolved. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "uuid.log" + LogFileNameResolvedKey = attribute.Key("log.file.name_resolved") + + // LogFilePathKey is the attribute Key conforming to the "log.file.path" + // semantic conventions. It represents the full path to the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/var/log/mysql/audit.log" + LogFilePathKey = attribute.Key("log.file.path") + + // LogFilePathResolvedKey is the attribute Key conforming to the + // "log.file.path_resolved" semantic conventions. It represents the full path to + // the file, with symlinks resolved. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/var/lib/docker/uuid.log" + LogFilePathResolvedKey = attribute.Key("log.file.path_resolved") + + // LogIostreamKey is the attribute Key conforming to the "log.iostream" semantic + // conventions. It represents the stream associated with the log. See below for + // a list of well-known values. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + LogIostreamKey = attribute.Key("log.iostream") + + // LogRecordOriginalKey is the attribute Key conforming to the + // "log.record.original" semantic conventions. It represents the complete + // original Log Record. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "77 <86>1 2015-08-06T21:58:59.694Z 192.168.2.133 inactive - - - + // Something happened", "[INFO] 8/3/24 12:34:56 Something happened" + // Note: This value MAY be added when processing a Log Record which was + // originally transmitted as a string or equivalent data type AND the Body field + // of the Log Record does not contain the same value. (e.g. a syslog or a log + // record read from a file.) + LogRecordOriginalKey = attribute.Key("log.record.original") + + // LogRecordUIDKey is the attribute Key conforming to the "log.record.uid" + // semantic conventions. It represents a unique identifier for the Log Record. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "01ARZ3NDEKTSV4RRFFQ69G5FAV" + // Note: If an id is provided, other log records with the same id will be + // considered duplicates and can be removed safely. This means, that two + // distinguishable log records MUST have different values. + // The id MAY be an + // [Universally Unique Lexicographically Sortable Identifier (ULID)], but other + // identifiers (e.g. UUID) may be used as needed. + // + // [Universally Unique Lexicographically Sortable Identifier (ULID)]: https://github.com/ulid/spec + LogRecordUIDKey = attribute.Key("log.record.uid") +) + +// LogFileName returns an attribute KeyValue conforming to the "log.file.name" +// semantic conventions. It represents the basename of the file. +func LogFileName(val string) attribute.KeyValue { + return LogFileNameKey.String(val) +} + +// LogFileNameResolved returns an attribute KeyValue conforming to the +// "log.file.name_resolved" semantic conventions. It represents the basename of +// the file, with symlinks resolved. +func LogFileNameResolved(val string) attribute.KeyValue { + return LogFileNameResolvedKey.String(val) +} + +// LogFilePath returns an attribute KeyValue conforming to the "log.file.path" +// semantic conventions. It represents the full path to the file. +func LogFilePath(val string) attribute.KeyValue { + return LogFilePathKey.String(val) +} + +// LogFilePathResolved returns an attribute KeyValue conforming to the +// "log.file.path_resolved" semantic conventions. It represents the full path to +// the file, with symlinks resolved. +func LogFilePathResolved(val string) attribute.KeyValue { + return LogFilePathResolvedKey.String(val) +} + +// LogRecordOriginal returns an attribute KeyValue conforming to the +// "log.record.original" semantic conventions. It represents the complete +// original Log Record. +func LogRecordOriginal(val string) attribute.KeyValue { + return LogRecordOriginalKey.String(val) +} + +// LogRecordUID returns an attribute KeyValue conforming to the "log.record.uid" +// semantic conventions. It represents a unique identifier for the Log Record. +func LogRecordUID(val string) attribute.KeyValue { + return LogRecordUIDKey.String(val) +} + +// Enum values for log.iostream +var ( + // Logs from stdout stream + // Stability: development + LogIostreamStdout = LogIostreamKey.String("stdout") + // Events from stderr stream + // Stability: development + LogIostreamStderr = LogIostreamKey.String("stderr") +) + +// Namespace: messaging +const ( + // MessagingBatchMessageCountKey is the attribute Key conforming to the + // "messaging.batch.message_count" semantic conventions. It represents the + // number of messages sent, received, or processed in the scope of the batching + // operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 1, 2 + // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on + // spans that operate with a single message. When a messaging client library + // supports both batch and single-message API for the same operation, + // instrumentations SHOULD use `messaging.batch.message_count` for batching APIs + // and SHOULD NOT use it for single-message APIs. + MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count") + + // MessagingClientIDKey is the attribute Key conforming to the + // "messaging.client.id" semantic conventions. It represents a unique identifier + // for the client that consumes or produces a message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "client-5", "myhost@8742@s8083jm" + MessagingClientIDKey = attribute.Key("messaging.client.id") + + // MessagingConsumerGroupNameKey is the attribute Key conforming to the + // "messaging.consumer.group.name" semantic conventions. It represents the name + // of the consumer group with which a consumer is associated. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-group", "indexer" + // Note: Semantic conventions for individual messaging systems SHOULD document + // whether `messaging.consumer.group.name` is applicable and what it means in + // the context of that system. + MessagingConsumerGroupNameKey = attribute.Key("messaging.consumer.group.name") + + // MessagingDestinationAnonymousKey is the attribute Key conforming to the + // "messaging.destination.anonymous" semantic conventions. It represents a + // boolean that is true if the message destination is anonymous (could be + // unnamed or have auto-generated name). + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingDestinationAnonymousKey = attribute.Key("messaging.destination.anonymous") + + // MessagingDestinationNameKey is the attribute Key conforming to the + // "messaging.destination.name" semantic conventions. It represents the message + // destination name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MyQueue", "MyTopic" + // Note: Destination name SHOULD uniquely identify a specific queue, topic or + // other entity within the broker. If + // the broker doesn't have such notion, the destination name SHOULD uniquely + // identify the broker. + MessagingDestinationNameKey = attribute.Key("messaging.destination.name") + + // MessagingDestinationPartitionIDKey is the attribute Key conforming to the + // "messaging.destination.partition.id" semantic conventions. It represents the + // identifier of the partition messages are sent to or received from, unique + // within the `messaging.destination.name`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + MessagingDestinationPartitionIDKey = attribute.Key("messaging.destination.partition.id") + + // MessagingDestinationSubscriptionNameKey is the attribute Key conforming to + // the "messaging.destination.subscription.name" semantic conventions. It + // represents the name of the destination subscription from which a message is + // consumed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "subscription-a" + // Note: Semantic conventions for individual messaging systems SHOULD document + // whether `messaging.destination.subscription.name` is applicable and what it + // means in the context of that system. + MessagingDestinationSubscriptionNameKey = attribute.Key("messaging.destination.subscription.name") + + // MessagingDestinationTemplateKey is the attribute Key conforming to the + // "messaging.destination.template" semantic conventions. It represents the low + // cardinality representation of the messaging destination name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/customers/{customerId}" + // Note: Destination names could be constructed from templates. An example would + // be a destination name involving a user name or product id. Although the + // destination name in this case is of high cardinality, the underlying template + // is of low cardinality and can be effectively used for grouping and + // aggregation. + MessagingDestinationTemplateKey = attribute.Key("messaging.destination.template") + + // MessagingDestinationTemporaryKey is the attribute Key conforming to the + // "messaging.destination.temporary" semantic conventions. It represents a + // boolean that is true if the message destination is temporary and might not + // exist anymore after messages are processed. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingDestinationTemporaryKey = attribute.Key("messaging.destination.temporary") + + // MessagingEventhubsMessageEnqueuedTimeKey is the attribute Key conforming to + // the "messaging.eventhubs.message.enqueued_time" semantic conventions. It + // represents the UTC epoch seconds at which the message has been accepted and + // stored in the entity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingEventhubsMessageEnqueuedTimeKey = attribute.Key("messaging.eventhubs.message.enqueued_time") + + // MessagingGCPPubsubMessageAckDeadlineKey is the attribute Key conforming to + // the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It + // represents the ack deadline in seconds set for the modify ack deadline + // request. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingGCPPubsubMessageAckDeadlineKey = attribute.Key("messaging.gcp_pubsub.message.ack_deadline") + + // MessagingGCPPubsubMessageAckIDKey is the attribute Key conforming to the + // "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the + // ack id for a given message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: ack_id + MessagingGCPPubsubMessageAckIDKey = attribute.Key("messaging.gcp_pubsub.message.ack_id") + + // MessagingGCPPubsubMessageDeliveryAttemptKey is the attribute Key conforming + // to the "messaging.gcp_pubsub.message.delivery_attempt" semantic conventions. + // It represents the delivery attempt for a given message. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingGCPPubsubMessageDeliveryAttemptKey = attribute.Key("messaging.gcp_pubsub.message.delivery_attempt") + + // MessagingGCPPubsubMessageOrderingKeyKey is the attribute Key conforming to + // the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It + // represents the ordering key for a given message. If the attribute is not + // present, the message does not have an ordering key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: ordering_key + MessagingGCPPubsubMessageOrderingKeyKey = attribute.Key("messaging.gcp_pubsub.message.ordering_key") + + // MessagingKafkaMessageKeyKey is the attribute Key conforming to the + // "messaging.kafka.message.key" semantic conventions. It represents the message + // keys in Kafka are used for grouping alike messages to ensure they're + // processed on the same partition. They differ from `messaging.message.id` in + // that they're not unique. If the key is `null`, the attribute MUST NOT be set. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myKey + // Note: If the key type is not string, it's string representation has to be + // supplied for the attribute. If the key has no unambiguous, canonical string + // form, don't include its value. + MessagingKafkaMessageKeyKey = attribute.Key("messaging.kafka.message.key") + + // MessagingKafkaMessageTombstoneKey is the attribute Key conforming to the + // "messaging.kafka.message.tombstone" semantic conventions. It represents a + // boolean that is true if the message is a tombstone. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingKafkaMessageTombstoneKey = attribute.Key("messaging.kafka.message.tombstone") + + // MessagingKafkaOffsetKey is the attribute Key conforming to the + // "messaging.kafka.offset" semantic conventions. It represents the offset of a + // record in the corresponding Kafka partition. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingKafkaOffsetKey = attribute.Key("messaging.kafka.offset") + + // MessagingMessageBodySizeKey is the attribute Key conforming to the + // "messaging.message.body.size" semantic conventions. It represents the size of + // the message body in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: This can refer to both the compressed or uncompressed body size. If + // both sizes are known, the uncompressed + // body size should be used. + MessagingMessageBodySizeKey = attribute.Key("messaging.message.body.size") + + // MessagingMessageConversationIDKey is the attribute Key conforming to the + // "messaging.message.conversation_id" semantic conventions. It represents the + // conversation ID identifying the conversation to which the message belongs, + // represented as a string. Sometimes called "Correlation ID". + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: MyConversationId + MessagingMessageConversationIDKey = attribute.Key("messaging.message.conversation_id") + + // MessagingMessageEnvelopeSizeKey is the attribute Key conforming to the + // "messaging.message.envelope.size" semantic conventions. It represents the + // size of the message body and metadata in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: This can refer to both the compressed or uncompressed size. If both + // sizes are known, the uncompressed + // size should be used. + MessagingMessageEnvelopeSizeKey = attribute.Key("messaging.message.envelope.size") + + // MessagingMessageIDKey is the attribute Key conforming to the + // "messaging.message.id" semantic conventions. It represents a value used by + // the messaging system as an identifier for the message, represented as a + // string. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 452a7c7c7c7048c2f887f61572b18fc2 + MessagingMessageIDKey = attribute.Key("messaging.message.id") + + // MessagingOperationNameKey is the attribute Key conforming to the + // "messaging.operation.name" semantic conventions. It represents the + // system-specific name of the messaging operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ack", "nack", "send" + MessagingOperationNameKey = attribute.Key("messaging.operation.name") + + // MessagingOperationTypeKey is the attribute Key conforming to the + // "messaging.operation.type" semantic conventions. It represents a string + // identifying the type of the messaging operation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: If a custom value is used, it MUST be of low cardinality. + MessagingOperationTypeKey = attribute.Key("messaging.operation.type") + + // MessagingRabbitmqDestinationRoutingKeyKey is the attribute Key conforming to + // the "messaging.rabbitmq.destination.routing_key" semantic conventions. It + // represents the rabbitMQ message routing key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myKey + MessagingRabbitmqDestinationRoutingKeyKey = attribute.Key("messaging.rabbitmq.destination.routing_key") + + // MessagingRabbitmqMessageDeliveryTagKey is the attribute Key conforming to the + // "messaging.rabbitmq.message.delivery_tag" semantic conventions. It represents + // the rabbitMQ message delivery tag. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRabbitmqMessageDeliveryTagKey = attribute.Key("messaging.rabbitmq.message.delivery_tag") + + // MessagingRocketmqConsumptionModelKey is the attribute Key conforming to the + // "messaging.rocketmq.consumption_model" semantic conventions. It represents + // the model of message consumption. This only applies to consumer spans. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingRocketmqConsumptionModelKey = attribute.Key("messaging.rocketmq.consumption_model") + + // MessagingRocketmqMessageDelayTimeLevelKey is the attribute Key conforming to + // the "messaging.rocketmq.message.delay_time_level" semantic conventions. It + // represents the delay time level for delay message, which determines the + // message delay time. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRocketmqMessageDelayTimeLevelKey = attribute.Key("messaging.rocketmq.message.delay_time_level") + + // MessagingRocketmqMessageDeliveryTimestampKey is the attribute Key conforming + // to the "messaging.rocketmq.message.delivery_timestamp" semantic conventions. + // It represents the timestamp in milliseconds that the delay message is + // expected to be delivered to consumer. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRocketmqMessageDeliveryTimestampKey = attribute.Key("messaging.rocketmq.message.delivery_timestamp") + + // MessagingRocketmqMessageGroupKey is the attribute Key conforming to the + // "messaging.rocketmq.message.group" semantic conventions. It represents the it + // is essential for FIFO message. Messages that belong to the same message group + // are always processed one by one within the same consumer group. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myMessageGroup + MessagingRocketmqMessageGroupKey = attribute.Key("messaging.rocketmq.message.group") + + // MessagingRocketmqMessageKeysKey is the attribute Key conforming to the + // "messaging.rocketmq.message.keys" semantic conventions. It represents the + // key(s) of message, another way to mark message besides message id. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "keyA", "keyB" + MessagingRocketmqMessageKeysKey = attribute.Key("messaging.rocketmq.message.keys") + + // MessagingRocketmqMessageTagKey is the attribute Key conforming to the + // "messaging.rocketmq.message.tag" semantic conventions. It represents the + // secondary classifier of message besides topic. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: tagA + MessagingRocketmqMessageTagKey = attribute.Key("messaging.rocketmq.message.tag") + + // MessagingRocketmqMessageTypeKey is the attribute Key conforming to the + // "messaging.rocketmq.message.type" semantic conventions. It represents the + // type of message. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingRocketmqMessageTypeKey = attribute.Key("messaging.rocketmq.message.type") + + // MessagingRocketmqNamespaceKey is the attribute Key conforming to the + // "messaging.rocketmq.namespace" semantic conventions. It represents the + // namespace of RocketMQ resources, resources in different namespaces are + // individual. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myNamespace + MessagingRocketmqNamespaceKey = attribute.Key("messaging.rocketmq.namespace") + + // MessagingServicebusDispositionStatusKey is the attribute Key conforming to + // the "messaging.servicebus.disposition_status" semantic conventions. It + // represents the describes the [settlement type]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [settlement type]: https://learn.microsoft.com/azure/service-bus-messaging/message-transfers-locks-settlement#peeklock + MessagingServicebusDispositionStatusKey = attribute.Key("messaging.servicebus.disposition_status") + + // MessagingServicebusMessageDeliveryCountKey is the attribute Key conforming to + // the "messaging.servicebus.message.delivery_count" semantic conventions. It + // represents the number of deliveries that have been attempted for this + // message. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingServicebusMessageDeliveryCountKey = attribute.Key("messaging.servicebus.message.delivery_count") + + // MessagingServicebusMessageEnqueuedTimeKey is the attribute Key conforming to + // the "messaging.servicebus.message.enqueued_time" semantic conventions. It + // represents the UTC epoch seconds at which the message has been accepted and + // stored in the entity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingServicebusMessageEnqueuedTimeKey = attribute.Key("messaging.servicebus.message.enqueued_time") + + // MessagingSystemKey is the attribute Key conforming to the "messaging.system" + // semantic conventions. It represents the messaging system as identified by the + // client instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The actual messaging system may differ from the one known by the + // client. For example, when using Kafka client libraries to communicate with + // Azure Event Hubs, the `messaging.system` is set to `kafka` based on the + // instrumentation's best knowledge. + MessagingSystemKey = attribute.Key("messaging.system") +) + +// MessagingBatchMessageCount returns an attribute KeyValue conforming to the +// "messaging.batch.message_count" semantic conventions. It represents the number +// of messages sent, received, or processed in the scope of the batching +// operation. +func MessagingBatchMessageCount(val int) attribute.KeyValue { + return MessagingBatchMessageCountKey.Int(val) +} + +// MessagingClientID returns an attribute KeyValue conforming to the +// "messaging.client.id" semantic conventions. It represents a unique identifier +// for the client that consumes or produces a message. +func MessagingClientID(val string) attribute.KeyValue { + return MessagingClientIDKey.String(val) +} + +// MessagingConsumerGroupName returns an attribute KeyValue conforming to the +// "messaging.consumer.group.name" semantic conventions. It represents the name +// of the consumer group with which a consumer is associated. +func MessagingConsumerGroupName(val string) attribute.KeyValue { + return MessagingConsumerGroupNameKey.String(val) +} + +// MessagingDestinationAnonymous returns an attribute KeyValue conforming to the +// "messaging.destination.anonymous" semantic conventions. It represents a +// boolean that is true if the message destination is anonymous (could be unnamed +// or have auto-generated name). +func MessagingDestinationAnonymous(val bool) attribute.KeyValue { + return MessagingDestinationAnonymousKey.Bool(val) +} + +// MessagingDestinationName returns an attribute KeyValue conforming to the +// "messaging.destination.name" semantic conventions. It represents the message +// destination name. +func MessagingDestinationName(val string) attribute.KeyValue { + return MessagingDestinationNameKey.String(val) +} + +// MessagingDestinationPartitionID returns an attribute KeyValue conforming to +// the "messaging.destination.partition.id" semantic conventions. It represents +// the identifier of the partition messages are sent to or received from, unique +// within the `messaging.destination.name`. +func MessagingDestinationPartitionID(val string) attribute.KeyValue { + return MessagingDestinationPartitionIDKey.String(val) +} + +// MessagingDestinationSubscriptionName returns an attribute KeyValue conforming +// to the "messaging.destination.subscription.name" semantic conventions. It +// represents the name of the destination subscription from which a message is +// consumed. +func MessagingDestinationSubscriptionName(val string) attribute.KeyValue { + return MessagingDestinationSubscriptionNameKey.String(val) +} + +// MessagingDestinationTemplate returns an attribute KeyValue conforming to the +// "messaging.destination.template" semantic conventions. It represents the low +// cardinality representation of the messaging destination name. +func MessagingDestinationTemplate(val string) attribute.KeyValue { + return MessagingDestinationTemplateKey.String(val) +} + +// MessagingDestinationTemporary returns an attribute KeyValue conforming to the +// "messaging.destination.temporary" semantic conventions. It represents a +// boolean that is true if the message destination is temporary and might not +// exist anymore after messages are processed. +func MessagingDestinationTemporary(val bool) attribute.KeyValue { + return MessagingDestinationTemporaryKey.Bool(val) +} + +// MessagingEventhubsMessageEnqueuedTime returns an attribute KeyValue conforming +// to the "messaging.eventhubs.message.enqueued_time" semantic conventions. It +// represents the UTC epoch seconds at which the message has been accepted and +// stored in the entity. +func MessagingEventhubsMessageEnqueuedTime(val int) attribute.KeyValue { + return MessagingEventhubsMessageEnqueuedTimeKey.Int(val) +} + +// MessagingGCPPubsubMessageAckDeadline returns an attribute KeyValue conforming +// to the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It +// represents the ack deadline in seconds set for the modify ack deadline +// request. +func MessagingGCPPubsubMessageAckDeadline(val int) attribute.KeyValue { + return MessagingGCPPubsubMessageAckDeadlineKey.Int(val) +} + +// MessagingGCPPubsubMessageAckID returns an attribute KeyValue conforming to the +// "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the +// ack id for a given message. +func MessagingGCPPubsubMessageAckID(val string) attribute.KeyValue { + return MessagingGCPPubsubMessageAckIDKey.String(val) +} + +// MessagingGCPPubsubMessageDeliveryAttempt returns an attribute KeyValue +// conforming to the "messaging.gcp_pubsub.message.delivery_attempt" semantic +// conventions. It represents the delivery attempt for a given message. +func MessagingGCPPubsubMessageDeliveryAttempt(val int) attribute.KeyValue { + return MessagingGCPPubsubMessageDeliveryAttemptKey.Int(val) +} + +// MessagingGCPPubsubMessageOrderingKey returns an attribute KeyValue conforming +// to the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It +// represents the ordering key for a given message. If the attribute is not +// present, the message does not have an ordering key. +func MessagingGCPPubsubMessageOrderingKey(val string) attribute.KeyValue { + return MessagingGCPPubsubMessageOrderingKeyKey.String(val) +} + +// MessagingKafkaMessageKey returns an attribute KeyValue conforming to the +// "messaging.kafka.message.key" semantic conventions. It represents the message +// keys in Kafka are used for grouping alike messages to ensure they're processed +// on the same partition. They differ from `messaging.message.id` in that they're +// not unique. If the key is `null`, the attribute MUST NOT be set. +func MessagingKafkaMessageKey(val string) attribute.KeyValue { + return MessagingKafkaMessageKeyKey.String(val) +} + +// MessagingKafkaMessageTombstone returns an attribute KeyValue conforming to the +// "messaging.kafka.message.tombstone" semantic conventions. It represents a +// boolean that is true if the message is a tombstone. +func MessagingKafkaMessageTombstone(val bool) attribute.KeyValue { + return MessagingKafkaMessageTombstoneKey.Bool(val) +} + +// MessagingKafkaOffset returns an attribute KeyValue conforming to the +// "messaging.kafka.offset" semantic conventions. It represents the offset of a +// record in the corresponding Kafka partition. +func MessagingKafkaOffset(val int) attribute.KeyValue { + return MessagingKafkaOffsetKey.Int(val) +} + +// MessagingMessageBodySize returns an attribute KeyValue conforming to the +// "messaging.message.body.size" semantic conventions. It represents the size of +// the message body in bytes. +func MessagingMessageBodySize(val int) attribute.KeyValue { + return MessagingMessageBodySizeKey.Int(val) +} + +// MessagingMessageConversationID returns an attribute KeyValue conforming to the +// "messaging.message.conversation_id" semantic conventions. It represents the +// conversation ID identifying the conversation to which the message belongs, +// represented as a string. Sometimes called "Correlation ID". +func MessagingMessageConversationID(val string) attribute.KeyValue { + return MessagingMessageConversationIDKey.String(val) +} + +// MessagingMessageEnvelopeSize returns an attribute KeyValue conforming to the +// "messaging.message.envelope.size" semantic conventions. It represents the size +// of the message body and metadata in bytes. +func MessagingMessageEnvelopeSize(val int) attribute.KeyValue { + return MessagingMessageEnvelopeSizeKey.Int(val) +} + +// MessagingMessageID returns an attribute KeyValue conforming to the +// "messaging.message.id" semantic conventions. It represents a value used by the +// messaging system as an identifier for the message, represented as a string. +func MessagingMessageID(val string) attribute.KeyValue { + return MessagingMessageIDKey.String(val) +} + +// MessagingOperationName returns an attribute KeyValue conforming to the +// "messaging.operation.name" semantic conventions. It represents the +// system-specific name of the messaging operation. +func MessagingOperationName(val string) attribute.KeyValue { + return MessagingOperationNameKey.String(val) +} + +// MessagingRabbitmqDestinationRoutingKey returns an attribute KeyValue +// conforming to the "messaging.rabbitmq.destination.routing_key" semantic +// conventions. It represents the rabbitMQ message routing key. +func MessagingRabbitmqDestinationRoutingKey(val string) attribute.KeyValue { + return MessagingRabbitmqDestinationRoutingKeyKey.String(val) +} + +// MessagingRabbitmqMessageDeliveryTag returns an attribute KeyValue conforming +// to the "messaging.rabbitmq.message.delivery_tag" semantic conventions. It +// represents the rabbitMQ message delivery tag. +func MessagingRabbitmqMessageDeliveryTag(val int) attribute.KeyValue { + return MessagingRabbitmqMessageDeliveryTagKey.Int(val) +} + +// MessagingRocketmqMessageDelayTimeLevel returns an attribute KeyValue +// conforming to the "messaging.rocketmq.message.delay_time_level" semantic +// conventions. It represents the delay time level for delay message, which +// determines the message delay time. +func MessagingRocketmqMessageDelayTimeLevel(val int) attribute.KeyValue { + return MessagingRocketmqMessageDelayTimeLevelKey.Int(val) +} + +// MessagingRocketmqMessageDeliveryTimestamp returns an attribute KeyValue +// conforming to the "messaging.rocketmq.message.delivery_timestamp" semantic +// conventions. It represents the timestamp in milliseconds that the delay +// message is expected to be delivered to consumer. +func MessagingRocketmqMessageDeliveryTimestamp(val int) attribute.KeyValue { + return MessagingRocketmqMessageDeliveryTimestampKey.Int(val) +} + +// MessagingRocketmqMessageGroup returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.group" semantic conventions. It represents the it +// is essential for FIFO message. Messages that belong to the same message group +// are always processed one by one within the same consumer group. +func MessagingRocketmqMessageGroup(val string) attribute.KeyValue { + return MessagingRocketmqMessageGroupKey.String(val) +} + +// MessagingRocketmqMessageKeys returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.keys" semantic conventions. It represents the +// key(s) of message, another way to mark message besides message id. +func MessagingRocketmqMessageKeys(val ...string) attribute.KeyValue { + return MessagingRocketmqMessageKeysKey.StringSlice(val) +} + +// MessagingRocketmqMessageTag returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.tag" semantic conventions. It represents the +// secondary classifier of message besides topic. +func MessagingRocketmqMessageTag(val string) attribute.KeyValue { + return MessagingRocketmqMessageTagKey.String(val) +} + +// MessagingRocketmqNamespace returns an attribute KeyValue conforming to the +// "messaging.rocketmq.namespace" semantic conventions. It represents the +// namespace of RocketMQ resources, resources in different namespaces are +// individual. +func MessagingRocketmqNamespace(val string) attribute.KeyValue { + return MessagingRocketmqNamespaceKey.String(val) +} + +// MessagingServicebusMessageDeliveryCount returns an attribute KeyValue +// conforming to the "messaging.servicebus.message.delivery_count" semantic +// conventions. It represents the number of deliveries that have been attempted +// for this message. +func MessagingServicebusMessageDeliveryCount(val int) attribute.KeyValue { + return MessagingServicebusMessageDeliveryCountKey.Int(val) +} + +// MessagingServicebusMessageEnqueuedTime returns an attribute KeyValue +// conforming to the "messaging.servicebus.message.enqueued_time" semantic +// conventions. It represents the UTC epoch seconds at which the message has been +// accepted and stored in the entity. +func MessagingServicebusMessageEnqueuedTime(val int) attribute.KeyValue { + return MessagingServicebusMessageEnqueuedTimeKey.Int(val) +} + +// Enum values for messaging.operation.type +var ( + // A message is created. "Create" spans always refer to a single message and are + // used to provide a unique creation context for messages in batch sending + // scenarios. + // + // Stability: development + MessagingOperationTypeCreate = MessagingOperationTypeKey.String("create") + // One or more messages are provided for sending to an intermediary. If a single + // message is sent, the context of the "Send" span can be used as the creation + // context and no "Create" span needs to be created. + // + // Stability: development + MessagingOperationTypeSend = MessagingOperationTypeKey.String("send") + // One or more messages are requested by a consumer. This operation refers to + // pull-based scenarios, where consumers explicitly call methods of messaging + // SDKs to receive messages. + // + // Stability: development + MessagingOperationTypeReceive = MessagingOperationTypeKey.String("receive") + // One or more messages are processed by a consumer. + // + // Stability: development + MessagingOperationTypeProcess = MessagingOperationTypeKey.String("process") + // One or more messages are settled. + // + // Stability: development + MessagingOperationTypeSettle = MessagingOperationTypeKey.String("settle") + // Deprecated: Replaced by `process`. + MessagingOperationTypeDeliver = MessagingOperationTypeKey.String("deliver") + // Deprecated: Replaced by `send`. + MessagingOperationTypePublish = MessagingOperationTypeKey.String("publish") +) + +// Enum values for messaging.rocketmq.consumption_model +var ( + // Clustering consumption model + // Stability: development + MessagingRocketmqConsumptionModelClustering = MessagingRocketmqConsumptionModelKey.String("clustering") + // Broadcasting consumption model + // Stability: development + MessagingRocketmqConsumptionModelBroadcasting = MessagingRocketmqConsumptionModelKey.String("broadcasting") +) + +// Enum values for messaging.rocketmq.message.type +var ( + // Normal message + // Stability: development + MessagingRocketmqMessageTypeNormal = MessagingRocketmqMessageTypeKey.String("normal") + // FIFO message + // Stability: development + MessagingRocketmqMessageTypeFifo = MessagingRocketmqMessageTypeKey.String("fifo") + // Delay message + // Stability: development + MessagingRocketmqMessageTypeDelay = MessagingRocketmqMessageTypeKey.String("delay") + // Transaction message + // Stability: development + MessagingRocketmqMessageTypeTransaction = MessagingRocketmqMessageTypeKey.String("transaction") +) + +// Enum values for messaging.servicebus.disposition_status +var ( + // Message is completed + // Stability: development + MessagingServicebusDispositionStatusComplete = MessagingServicebusDispositionStatusKey.String("complete") + // Message is abandoned + // Stability: development + MessagingServicebusDispositionStatusAbandon = MessagingServicebusDispositionStatusKey.String("abandon") + // Message is sent to dead letter queue + // Stability: development + MessagingServicebusDispositionStatusDeadLetter = MessagingServicebusDispositionStatusKey.String("dead_letter") + // Message is deferred + // Stability: development + MessagingServicebusDispositionStatusDefer = MessagingServicebusDispositionStatusKey.String("defer") +) + +// Enum values for messaging.system +var ( + // Apache ActiveMQ + // Stability: development + MessagingSystemActivemq = MessagingSystemKey.String("activemq") + // Amazon Simple Queue Service (SQS) + // Stability: development + MessagingSystemAWSSqs = MessagingSystemKey.String("aws_sqs") + // Azure Event Grid + // Stability: development + MessagingSystemEventgrid = MessagingSystemKey.String("eventgrid") + // Azure Event Hubs + // Stability: development + MessagingSystemEventhubs = MessagingSystemKey.String("eventhubs") + // Azure Service Bus + // Stability: development + MessagingSystemServicebus = MessagingSystemKey.String("servicebus") + // Google Cloud Pub/Sub + // Stability: development + MessagingSystemGCPPubsub = MessagingSystemKey.String("gcp_pubsub") + // Java Message Service + // Stability: development + MessagingSystemJms = MessagingSystemKey.String("jms") + // Apache Kafka + // Stability: development + MessagingSystemKafka = MessagingSystemKey.String("kafka") + // RabbitMQ + // Stability: development + MessagingSystemRabbitmq = MessagingSystemKey.String("rabbitmq") + // Apache RocketMQ + // Stability: development + MessagingSystemRocketmq = MessagingSystemKey.String("rocketmq") + // Apache Pulsar + // Stability: development + MessagingSystemPulsar = MessagingSystemKey.String("pulsar") +) + +// Namespace: network +const ( + // NetworkCarrierIccKey is the attribute Key conforming to the + // "network.carrier.icc" semantic conventions. It represents the ISO 3166-1 + // alpha-2 2-character country code associated with the mobile carrier network. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: DE + NetworkCarrierIccKey = attribute.Key("network.carrier.icc") + + // NetworkCarrierMccKey is the attribute Key conforming to the + // "network.carrier.mcc" semantic conventions. It represents the mobile carrier + // country code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 310 + NetworkCarrierMccKey = attribute.Key("network.carrier.mcc") + + // NetworkCarrierMncKey is the attribute Key conforming to the + // "network.carrier.mnc" semantic conventions. It represents the mobile carrier + // network code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 001 + NetworkCarrierMncKey = attribute.Key("network.carrier.mnc") + + // NetworkCarrierNameKey is the attribute Key conforming to the + // "network.carrier.name" semantic conventions. It represents the name of the + // mobile carrier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: sprint + NetworkCarrierNameKey = attribute.Key("network.carrier.name") + + // NetworkConnectionStateKey is the attribute Key conforming to the + // "network.connection.state" semantic conventions. It represents the state of + // network connection. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "close_wait" + // Note: Connection states are defined as part of the [rfc9293] + // + // [rfc9293]: https://datatracker.ietf.org/doc/html/rfc9293#section-3.3.2 + NetworkConnectionStateKey = attribute.Key("network.connection.state") + + // NetworkConnectionSubtypeKey is the attribute Key conforming to the + // "network.connection.subtype" semantic conventions. It represents the this + // describes more details regarding the connection.type. It may be the type of + // cell technology connection, but it could be used for describing details about + // a wifi connection. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: LTE + NetworkConnectionSubtypeKey = attribute.Key("network.connection.subtype") + + // NetworkConnectionTypeKey is the attribute Key conforming to the + // "network.connection.type" semantic conventions. It represents the internet + // connection type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: wifi + NetworkConnectionTypeKey = attribute.Key("network.connection.type") + + // NetworkInterfaceNameKey is the attribute Key conforming to the + // "network.interface.name" semantic conventions. It represents the network + // interface name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "lo", "eth0" + NetworkInterfaceNameKey = attribute.Key("network.interface.name") + + // NetworkIoDirectionKey is the attribute Key conforming to the + // "network.io.direction" semantic conventions. It represents the network IO + // operation direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "transmit" + NetworkIoDirectionKey = attribute.Key("network.io.direction") + + // NetworkLocalAddressKey is the attribute Key conforming to the + // "network.local.address" semantic conventions. It represents the local address + // of the network connection - IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "10.1.2.80", "/tmp/my.sock" + NetworkLocalAddressKey = attribute.Key("network.local.address") + + // NetworkLocalPortKey is the attribute Key conforming to the + // "network.local.port" semantic conventions. It represents the local port + // number of the network connection. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + NetworkLocalPortKey = attribute.Key("network.local.port") + + // NetworkPeerAddressKey is the attribute Key conforming to the + // "network.peer.address" semantic conventions. It represents the peer address + // of the network connection - IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "10.1.2.80", "/tmp/my.sock" + NetworkPeerAddressKey = attribute.Key("network.peer.address") + + // NetworkPeerPortKey is the attribute Key conforming to the "network.peer.port" + // semantic conventions. It represents the peer port number of the network + // connection. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + NetworkPeerPortKey = attribute.Key("network.peer.port") + + // NetworkProtocolNameKey is the attribute Key conforming to the + // "network.protocol.name" semantic conventions. It represents the + // [OSI application layer] or non-OSI equivalent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "amqp", "http", "mqtt" + // Note: The value SHOULD be normalized to lowercase. + // + // [OSI application layer]: https://wikipedia.org/wiki/Application_layer + NetworkProtocolNameKey = attribute.Key("network.protocol.name") + + // NetworkProtocolVersionKey is the attribute Key conforming to the + // "network.protocol.version" semantic conventions. It represents the actual + // version of the protocol used for network communication. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.1", "2" + // Note: If protocol version is subject to negotiation (for example using [ALPN] + // ), this attribute SHOULD be set to the negotiated version. If the actual + // protocol version is not known, this attribute SHOULD NOT be set. + // + // [ALPN]: https://www.rfc-editor.org/rfc/rfc7301.html + NetworkProtocolVersionKey = attribute.Key("network.protocol.version") + + // NetworkTransportKey is the attribute Key conforming to the + // "network.transport" semantic conventions. It represents the + // [OSI transport layer] or [inter-process communication method]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "tcp", "udp" + // Note: The value SHOULD be normalized to lowercase. + // + // Consider always setting the transport when setting a port number, since + // a port number is ambiguous without knowing the transport. For example + // different processes could be listening on TCP port 12345 and UDP port 12345. + // + // [OSI transport layer]: https://wikipedia.org/wiki/Transport_layer + // [inter-process communication method]: https://wikipedia.org/wiki/Inter-process_communication + NetworkTransportKey = attribute.Key("network.transport") + + // NetworkTypeKey is the attribute Key conforming to the "network.type" semantic + // conventions. It represents the [OSI network layer] or non-OSI equivalent. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "ipv4", "ipv6" + // Note: The value SHOULD be normalized to lowercase. + // + // [OSI network layer]: https://wikipedia.org/wiki/Network_layer + NetworkTypeKey = attribute.Key("network.type") +) + +// NetworkCarrierIcc returns an attribute KeyValue conforming to the +// "network.carrier.icc" semantic conventions. It represents the ISO 3166-1 +// alpha-2 2-character country code associated with the mobile carrier network. +func NetworkCarrierIcc(val string) attribute.KeyValue { + return NetworkCarrierIccKey.String(val) +} + +// NetworkCarrierMcc returns an attribute KeyValue conforming to the +// "network.carrier.mcc" semantic conventions. It represents the mobile carrier +// country code. +func NetworkCarrierMcc(val string) attribute.KeyValue { + return NetworkCarrierMccKey.String(val) +} + +// NetworkCarrierMnc returns an attribute KeyValue conforming to the +// "network.carrier.mnc" semantic conventions. It represents the mobile carrier +// network code. +func NetworkCarrierMnc(val string) attribute.KeyValue { + return NetworkCarrierMncKey.String(val) +} + +// NetworkCarrierName returns an attribute KeyValue conforming to the +// "network.carrier.name" semantic conventions. It represents the name of the +// mobile carrier. +func NetworkCarrierName(val string) attribute.KeyValue { + return NetworkCarrierNameKey.String(val) +} + +// NetworkInterfaceName returns an attribute KeyValue conforming to the +// "network.interface.name" semantic conventions. It represents the network +// interface name. +func NetworkInterfaceName(val string) attribute.KeyValue { + return NetworkInterfaceNameKey.String(val) +} + +// NetworkLocalAddress returns an attribute KeyValue conforming to the +// "network.local.address" semantic conventions. It represents the local address +// of the network connection - IP address or Unix domain socket name. +func NetworkLocalAddress(val string) attribute.KeyValue { + return NetworkLocalAddressKey.String(val) +} + +// NetworkLocalPort returns an attribute KeyValue conforming to the +// "network.local.port" semantic conventions. It represents the local port number +// of the network connection. +func NetworkLocalPort(val int) attribute.KeyValue { + return NetworkLocalPortKey.Int(val) +} + +// NetworkPeerAddress returns an attribute KeyValue conforming to the +// "network.peer.address" semantic conventions. It represents the peer address of +// the network connection - IP address or Unix domain socket name. +func NetworkPeerAddress(val string) attribute.KeyValue { + return NetworkPeerAddressKey.String(val) +} + +// NetworkPeerPort returns an attribute KeyValue conforming to the +// "network.peer.port" semantic conventions. It represents the peer port number +// of the network connection. +func NetworkPeerPort(val int) attribute.KeyValue { + return NetworkPeerPortKey.Int(val) +} + +// NetworkProtocolName returns an attribute KeyValue conforming to the +// "network.protocol.name" semantic conventions. It represents the +// [OSI application layer] or non-OSI equivalent. +// +// [OSI application layer]: https://wikipedia.org/wiki/Application_layer +func NetworkProtocolName(val string) attribute.KeyValue { + return NetworkProtocolNameKey.String(val) +} + +// NetworkProtocolVersion returns an attribute KeyValue conforming to the +// "network.protocol.version" semantic conventions. It represents the actual +// version of the protocol used for network communication. +func NetworkProtocolVersion(val string) attribute.KeyValue { + return NetworkProtocolVersionKey.String(val) +} + +// Enum values for network.connection.state +var ( + // closed + // Stability: development + NetworkConnectionStateClosed = NetworkConnectionStateKey.String("closed") + // close_wait + // Stability: development + NetworkConnectionStateCloseWait = NetworkConnectionStateKey.String("close_wait") + // closing + // Stability: development + NetworkConnectionStateClosing = NetworkConnectionStateKey.String("closing") + // established + // Stability: development + NetworkConnectionStateEstablished = NetworkConnectionStateKey.String("established") + // fin_wait_1 + // Stability: development + NetworkConnectionStateFinWait1 = NetworkConnectionStateKey.String("fin_wait_1") + // fin_wait_2 + // Stability: development + NetworkConnectionStateFinWait2 = NetworkConnectionStateKey.String("fin_wait_2") + // last_ack + // Stability: development + NetworkConnectionStateLastAck = NetworkConnectionStateKey.String("last_ack") + // listen + // Stability: development + NetworkConnectionStateListen = NetworkConnectionStateKey.String("listen") + // syn_received + // Stability: development + NetworkConnectionStateSynReceived = NetworkConnectionStateKey.String("syn_received") + // syn_sent + // Stability: development + NetworkConnectionStateSynSent = NetworkConnectionStateKey.String("syn_sent") + // time_wait + // Stability: development + NetworkConnectionStateTimeWait = NetworkConnectionStateKey.String("time_wait") +) + +// Enum values for network.connection.subtype +var ( + // GPRS + // Stability: development + NetworkConnectionSubtypeGprs = NetworkConnectionSubtypeKey.String("gprs") + // EDGE + // Stability: development + NetworkConnectionSubtypeEdge = NetworkConnectionSubtypeKey.String("edge") + // UMTS + // Stability: development + NetworkConnectionSubtypeUmts = NetworkConnectionSubtypeKey.String("umts") + // CDMA + // Stability: development + NetworkConnectionSubtypeCdma = NetworkConnectionSubtypeKey.String("cdma") + // EVDO Rel. 0 + // Stability: development + NetworkConnectionSubtypeEvdo0 = NetworkConnectionSubtypeKey.String("evdo_0") + // EVDO Rev. A + // Stability: development + NetworkConnectionSubtypeEvdoA = NetworkConnectionSubtypeKey.String("evdo_a") + // CDMA2000 1XRTT + // Stability: development + NetworkConnectionSubtypeCdma20001xrtt = NetworkConnectionSubtypeKey.String("cdma2000_1xrtt") + // HSDPA + // Stability: development + NetworkConnectionSubtypeHsdpa = NetworkConnectionSubtypeKey.String("hsdpa") + // HSUPA + // Stability: development + NetworkConnectionSubtypeHsupa = NetworkConnectionSubtypeKey.String("hsupa") + // HSPA + // Stability: development + NetworkConnectionSubtypeHspa = NetworkConnectionSubtypeKey.String("hspa") + // IDEN + // Stability: development + NetworkConnectionSubtypeIden = NetworkConnectionSubtypeKey.String("iden") + // EVDO Rev. B + // Stability: development + NetworkConnectionSubtypeEvdoB = NetworkConnectionSubtypeKey.String("evdo_b") + // LTE + // Stability: development + NetworkConnectionSubtypeLte = NetworkConnectionSubtypeKey.String("lte") + // EHRPD + // Stability: development + NetworkConnectionSubtypeEhrpd = NetworkConnectionSubtypeKey.String("ehrpd") + // HSPAP + // Stability: development + NetworkConnectionSubtypeHspap = NetworkConnectionSubtypeKey.String("hspap") + // GSM + // Stability: development + NetworkConnectionSubtypeGsm = NetworkConnectionSubtypeKey.String("gsm") + // TD-SCDMA + // Stability: development + NetworkConnectionSubtypeTdScdma = NetworkConnectionSubtypeKey.String("td_scdma") + // IWLAN + // Stability: development + NetworkConnectionSubtypeIwlan = NetworkConnectionSubtypeKey.String("iwlan") + // 5G NR (New Radio) + // Stability: development + NetworkConnectionSubtypeNr = NetworkConnectionSubtypeKey.String("nr") + // 5G NRNSA (New Radio Non-Standalone) + // Stability: development + NetworkConnectionSubtypeNrnsa = NetworkConnectionSubtypeKey.String("nrnsa") + // LTE CA + // Stability: development + NetworkConnectionSubtypeLteCa = NetworkConnectionSubtypeKey.String("lte_ca") +) + +// Enum values for network.connection.type +var ( + // wifi + // Stability: development + NetworkConnectionTypeWifi = NetworkConnectionTypeKey.String("wifi") + // wired + // Stability: development + NetworkConnectionTypeWired = NetworkConnectionTypeKey.String("wired") + // cell + // Stability: development + NetworkConnectionTypeCell = NetworkConnectionTypeKey.String("cell") + // unavailable + // Stability: development + NetworkConnectionTypeUnavailable = NetworkConnectionTypeKey.String("unavailable") + // unknown + // Stability: development + NetworkConnectionTypeUnknown = NetworkConnectionTypeKey.String("unknown") +) + +// Enum values for network.io.direction +var ( + // transmit + // Stability: development + NetworkIoDirectionTransmit = NetworkIoDirectionKey.String("transmit") + // receive + // Stability: development + NetworkIoDirectionReceive = NetworkIoDirectionKey.String("receive") +) + +// Enum values for network.transport +var ( + // TCP + // Stability: stable + NetworkTransportTCP = NetworkTransportKey.String("tcp") + // UDP + // Stability: stable + NetworkTransportUDP = NetworkTransportKey.String("udp") + // Named or anonymous pipe. + // Stability: stable + NetworkTransportPipe = NetworkTransportKey.String("pipe") + // Unix domain socket + // Stability: stable + NetworkTransportUnix = NetworkTransportKey.String("unix") + // QUIC + // Stability: development + NetworkTransportQUIC = NetworkTransportKey.String("quic") +) + +// Enum values for network.type +var ( + // IPv4 + // Stability: stable + NetworkTypeIpv4 = NetworkTypeKey.String("ipv4") + // IPv6 + // Stability: stable + NetworkTypeIpv6 = NetworkTypeKey.String("ipv6") +) + +// Namespace: oci +const ( + // OciManifestDigestKey is the attribute Key conforming to the + // "oci.manifest.digest" semantic conventions. It represents the digest of the + // OCI image manifest. For container images specifically is the digest by which + // the container image is known. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "sha256:e4ca62c0d62f3e886e684806dfe9d4e0cda60d54986898173c1083856cfda0f4" + // Note: Follows [OCI Image Manifest Specification], and specifically the + // [Digest property]. + // An example can be found in [Example Image Manifest]. + // + // [OCI Image Manifest Specification]: https://github.com/opencontainers/image-spec/blob/main/manifest.md + // [Digest property]: https://github.com/opencontainers/image-spec/blob/main/descriptor.md#digests + // [Example Image Manifest]: https://docs.docker.com/registry/spec/manifest-v2-2/#example-image-manifest + OciManifestDigestKey = attribute.Key("oci.manifest.digest") +) + +// OciManifestDigest returns an attribute KeyValue conforming to the +// "oci.manifest.digest" semantic conventions. It represents the digest of the +// OCI image manifest. For container images specifically is the digest by which +// the container image is known. +func OciManifestDigest(val string) attribute.KeyValue { + return OciManifestDigestKey.String(val) +} + +// Namespace: opentracing +const ( + // OpentracingRefTypeKey is the attribute Key conforming to the + // "opentracing.ref_type" semantic conventions. It represents the parent-child + // Reference type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The causal relationship between a child Span and a parent Span. + OpentracingRefTypeKey = attribute.Key("opentracing.ref_type") +) + +// Enum values for opentracing.ref_type +var ( + // The parent Span depends on the child Span in some capacity + // Stability: development + OpentracingRefTypeChildOf = OpentracingRefTypeKey.String("child_of") + // The parent Span doesn't depend in any way on the result of the child Span + // Stability: development + OpentracingRefTypeFollowsFrom = OpentracingRefTypeKey.String("follows_from") +) + +// Namespace: os +const ( + // OSBuildIDKey is the attribute Key conforming to the "os.build_id" semantic + // conventions. It represents the unique identifier for a particular build or + // compilation of the operating system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TQ3C.230805.001.B2", "20E247", "22621" + OSBuildIDKey = attribute.Key("os.build_id") + + // OSDescriptionKey is the attribute Key conforming to the "os.description" + // semantic conventions. It represents the human readable (not intended to be + // parsed) OS version information, like e.g. reported by `ver` or + // `lsb_release -a` commands. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Microsoft Windows [Version 10.0.18363.778]", "Ubuntu 18.04.1 LTS" + OSDescriptionKey = attribute.Key("os.description") + + // OSNameKey is the attribute Key conforming to the "os.name" semantic + // conventions. It represents the human readable operating system name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iOS", "Android", "Ubuntu" + OSNameKey = attribute.Key("os.name") + + // OSTypeKey is the attribute Key conforming to the "os.type" semantic + // conventions. It represents the operating system type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + OSTypeKey = attribute.Key("os.type") + + // OSVersionKey is the attribute Key conforming to the "os.version" semantic + // conventions. It represents the version string of the operating system as + // defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.2.1", "18.04.1" + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + OSVersionKey = attribute.Key("os.version") +) + +// OSBuildID returns an attribute KeyValue conforming to the "os.build_id" +// semantic conventions. It represents the unique identifier for a particular +// build or compilation of the operating system. +func OSBuildID(val string) attribute.KeyValue { + return OSBuildIDKey.String(val) +} + +// OSDescription returns an attribute KeyValue conforming to the "os.description" +// semantic conventions. It represents the human readable (not intended to be +// parsed) OS version information, like e.g. reported by `ver` or +// `lsb_release -a` commands. +func OSDescription(val string) attribute.KeyValue { + return OSDescriptionKey.String(val) +} + +// OSName returns an attribute KeyValue conforming to the "os.name" semantic +// conventions. It represents the human readable operating system name. +func OSName(val string) attribute.KeyValue { + return OSNameKey.String(val) +} + +// OSVersion returns an attribute KeyValue conforming to the "os.version" +// semantic conventions. It represents the version string of the operating system +// as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func OSVersion(val string) attribute.KeyValue { + return OSVersionKey.String(val) +} + +// Enum values for os.type +var ( + // Microsoft Windows + // Stability: development + OSTypeWindows = OSTypeKey.String("windows") + // Linux + // Stability: development + OSTypeLinux = OSTypeKey.String("linux") + // Apple Darwin + // Stability: development + OSTypeDarwin = OSTypeKey.String("darwin") + // FreeBSD + // Stability: development + OSTypeFreeBSD = OSTypeKey.String("freebsd") + // NetBSD + // Stability: development + OSTypeNetBSD = OSTypeKey.String("netbsd") + // OpenBSD + // Stability: development + OSTypeOpenBSD = OSTypeKey.String("openbsd") + // DragonFly BSD + // Stability: development + OSTypeDragonflyBSD = OSTypeKey.String("dragonflybsd") + // HP-UX (Hewlett Packard Unix) + // Stability: development + OSTypeHPUX = OSTypeKey.String("hpux") + // AIX (Advanced Interactive eXecutive) + // Stability: development + OSTypeAIX = OSTypeKey.String("aix") + // SunOS, Oracle Solaris + // Stability: development + OSTypeSolaris = OSTypeKey.String("solaris") + // IBM z/OS + // Stability: development + OSTypeZOS = OSTypeKey.String("z_os") +) + +// Namespace: otel +const ( + // OTelScopeNameKey is the attribute Key conforming to the "otel.scope.name" + // semantic conventions. It represents the name of the instrumentation scope - ( + // `InstrumentationScope.Name` in OTLP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "io.opentelemetry.contrib.mongodb" + OTelScopeNameKey = attribute.Key("otel.scope.name") + + // OTelScopeVersionKey is the attribute Key conforming to the + // "otel.scope.version" semantic conventions. It represents the version of the + // instrumentation scope - (`InstrumentationScope.Version` in OTLP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.0.0" + OTelScopeVersionKey = attribute.Key("otel.scope.version") + + // OTelStatusCodeKey is the attribute Key conforming to the "otel.status_code" + // semantic conventions. It represents the name of the code, either "OK" or + // "ERROR". MUST NOT be set if the status code is UNSET. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + OTelStatusCodeKey = attribute.Key("otel.status_code") + + // OTelStatusDescriptionKey is the attribute Key conforming to the + // "otel.status_description" semantic conventions. It represents the description + // of the Status if it has a value, otherwise not set. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "resource not found" + OTelStatusDescriptionKey = attribute.Key("otel.status_description") +) + +// OTelScopeName returns an attribute KeyValue conforming to the +// "otel.scope.name" semantic conventions. It represents the name of the +// instrumentation scope - (`InstrumentationScope.Name` in OTLP). +func OTelScopeName(val string) attribute.KeyValue { + return OTelScopeNameKey.String(val) +} + +// OTelScopeVersion returns an attribute KeyValue conforming to the +// "otel.scope.version" semantic conventions. It represents the version of the +// instrumentation scope - (`InstrumentationScope.Version` in OTLP). +func OTelScopeVersion(val string) attribute.KeyValue { + return OTelScopeVersionKey.String(val) +} + +// OTelStatusDescription returns an attribute KeyValue conforming to the +// "otel.status_description" semantic conventions. It represents the description +// of the Status if it has a value, otherwise not set. +func OTelStatusDescription(val string) attribute.KeyValue { + return OTelStatusDescriptionKey.String(val) +} + +// Enum values for otel.status_code +var ( + // The operation has been validated by an Application developer or Operator to + // have completed successfully. + // Stability: stable + OTelStatusCodeOk = OTelStatusCodeKey.String("OK") + // The operation contains an error. + // Stability: stable + OTelStatusCodeError = OTelStatusCodeKey.String("ERROR") +) + +// Namespace: peer +const ( + // PeerServiceKey is the attribute Key conforming to the "peer.service" semantic + // conventions. It represents the [`service.name`] of the remote service. SHOULD + // be equal to the actual `service.name` resource attribute of the remote + // service if any. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: AuthTokenCache + // + // [`service.name`]: /docs/resource/README.md#service + PeerServiceKey = attribute.Key("peer.service") +) + +// PeerService returns an attribute KeyValue conforming to the "peer.service" +// semantic conventions. It represents the [`service.name`] of the remote +// service. SHOULD be equal to the actual `service.name` resource attribute of +// the remote service if any. +// +// [`service.name`]: /docs/resource/README.md#service +func PeerService(val string) attribute.KeyValue { + return PeerServiceKey.String(val) +} + +// Namespace: process +const ( + // ProcessArgsCountKey is the attribute Key conforming to the + // "process.args_count" semantic conventions. It represents the length of the + // process.command_args array. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 4 + // Note: This field can be useful for querying or performing bucket analysis on + // how many arguments were provided to start a process. More arguments may be an + // indication of suspicious activity. + ProcessArgsCountKey = attribute.Key("process.args_count") + + // ProcessCommandKey is the attribute Key conforming to the "process.command" + // semantic conventions. It represents the command used to launch the process + // (i.e. the command name). On Linux based systems, can be set to the zeroth + // string in `proc/[pid]/cmdline`. On Windows, can be set to the first parameter + // extracted from `GetCommandLineW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cmd/otelcol" + ProcessCommandKey = attribute.Key("process.command") + + // ProcessCommandArgsKey is the attribute Key conforming to the + // "process.command_args" semantic conventions. It represents the all the + // command arguments (including the command/executable itself) as received by + // the process. On Linux-based systems (and some other Unixoid systems + // supporting procfs), can be set according to the list of null-delimited + // strings extracted from `proc/[pid]/cmdline`. For libc-based executables, this + // would be the full argv vector passed to `main`. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cmd/otecol", "--config=config.yaml" + ProcessCommandArgsKey = attribute.Key("process.command_args") + + // ProcessCommandLineKey is the attribute Key conforming to the + // "process.command_line" semantic conventions. It represents the full command + // used to launch the process as a single string representing the full command. + // On Windows, can be set to the result of `GetCommandLineW`. Do not set this if + // you have to assemble it just for monitoring; use `process.command_args` + // instead. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "C:\cmd\otecol --config="my directory\config.yaml"" + ProcessCommandLineKey = attribute.Key("process.command_line") + + // ProcessContextSwitchTypeKey is the attribute Key conforming to the + // "process.context_switch_type" semantic conventions. It represents the + // specifies whether the context switches for this data point were voluntary or + // involuntary. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessContextSwitchTypeKey = attribute.Key("process.context_switch_type") + + // ProcessCreationTimeKey is the attribute Key conforming to the + // "process.creation.time" semantic conventions. It represents the date and time + // the process was created, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2023-11-21T09:25:34.853Z" + ProcessCreationTimeKey = attribute.Key("process.creation.time") + + // ProcessExecutableBuildIDGnuKey is the attribute Key conforming to the + // "process.executable.build_id.gnu" semantic conventions. It represents the GNU + // build ID as found in the `.note.gnu.build-id` ELF section (hex string). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "c89b11207f6479603b0d49bf291c092c2b719293" + ProcessExecutableBuildIDGnuKey = attribute.Key("process.executable.build_id.gnu") + + // ProcessExecutableBuildIDGoKey is the attribute Key conforming to the + // "process.executable.build_id.go" semantic conventions. It represents the Go + // build ID as retrieved by `go tool buildid `. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "foh3mEXu7BLZjsN9pOwG/kATcXlYVCDEFouRMQed_/WwRFB1hPo9LBkekthSPG/x8hMC8emW2cCjXD0_1aY" + ProcessExecutableBuildIDGoKey = attribute.Key("process.executable.build_id.go") + + // ProcessExecutableBuildIDHtlhashKey is the attribute Key conforming to the + // "process.executable.build_id.htlhash" semantic conventions. It represents the + // profiling specific build ID for executables. See the OTel specification for + // Profiles for more information. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "600DCAFE4A110000F2BF38C493F5FB92" + ProcessExecutableBuildIDHtlhashKey = attribute.Key("process.executable.build_id.htlhash") + + // ProcessExecutableNameKey is the attribute Key conforming to the + // "process.executable.name" semantic conventions. It represents the name of the + // process executable. On Linux based systems, can be set to the `Name` in + // `proc/[pid]/status`. On Windows, can be set to the base name of + // `GetProcessImageFileNameW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcol" + ProcessExecutableNameKey = attribute.Key("process.executable.name") + + // ProcessExecutablePathKey is the attribute Key conforming to the + // "process.executable.path" semantic conventions. It represents the full path + // to the process executable. On Linux based systems, can be set to the target + // of `proc/[pid]/exe`. On Windows, can be set to the result of + // `GetProcessImageFileNameW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/usr/bin/cmd/otelcol" + ProcessExecutablePathKey = attribute.Key("process.executable.path") + + // ProcessExitCodeKey is the attribute Key conforming to the "process.exit.code" + // semantic conventions. It represents the exit code of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 127 + ProcessExitCodeKey = attribute.Key("process.exit.code") + + // ProcessExitTimeKey is the attribute Key conforming to the "process.exit.time" + // semantic conventions. It represents the date and time the process exited, in + // ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2023-11-21T09:26:12.315Z" + ProcessExitTimeKey = attribute.Key("process.exit.time") + + // ProcessGroupLeaderPIDKey is the attribute Key conforming to the + // "process.group_leader.pid" semantic conventions. It represents the PID of the + // process's group leader. This is also the process group ID (PGID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 23 + ProcessGroupLeaderPIDKey = attribute.Key("process.group_leader.pid") + + // ProcessInteractiveKey is the attribute Key conforming to the + // "process.interactive" semantic conventions. It represents the whether the + // process is connected to an interactive shell. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessInteractiveKey = attribute.Key("process.interactive") + + // ProcessLinuxCgroupKey is the attribute Key conforming to the + // "process.linux.cgroup" semantic conventions. It represents the control group + // associated with the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1:name=systemd:/user.slice/user-1000.slice/session-3.scope", + // "0::/user.slice/user-1000.slice/user@1000.service/tmux-spawn-0267755b-4639-4a27-90ed-f19f88e53748.scope" + // Note: Control groups (cgroups) are a kernel feature used to organize and + // manage process resources. This attribute provides the path(s) to the + // cgroup(s) associated with the process, which should match the contents of the + // [/proc/[PID]/cgroup] file. + // + // [/proc/[PID]/cgroup]: https://man7.org/linux/man-pages/man7/cgroups.7.html + ProcessLinuxCgroupKey = attribute.Key("process.linux.cgroup") + + // ProcessOwnerKey is the attribute Key conforming to the "process.owner" + // semantic conventions. It represents the username of the user that owns the + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + ProcessOwnerKey = attribute.Key("process.owner") + + // ProcessPagingFaultTypeKey is the attribute Key conforming to the + // "process.paging.fault_type" semantic conventions. It represents the type of + // page fault for this data point. Type `major` is for major/hard page faults, + // and `minor` is for minor/soft page faults. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessPagingFaultTypeKey = attribute.Key("process.paging.fault_type") + + // ProcessParentPIDKey is the attribute Key conforming to the + // "process.parent_pid" semantic conventions. It represents the parent Process + // identifier (PPID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 111 + ProcessParentPIDKey = attribute.Key("process.parent_pid") + + // ProcessPIDKey is the attribute Key conforming to the "process.pid" semantic + // conventions. It represents the process identifier (PID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1234 + ProcessPIDKey = attribute.Key("process.pid") + + // ProcessRealUserIDKey is the attribute Key conforming to the + // "process.real_user.id" semantic conventions. It represents the real user ID + // (RUID) of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1000 + ProcessRealUserIDKey = attribute.Key("process.real_user.id") + + // ProcessRealUserNameKey is the attribute Key conforming to the + // "process.real_user.name" semantic conventions. It represents the username of + // the real user of the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "operator" + ProcessRealUserNameKey = attribute.Key("process.real_user.name") + + // ProcessRuntimeDescriptionKey is the attribute Key conforming to the + // "process.runtime.description" semantic conventions. It represents an + // additional description about the runtime of the process, for example a + // specific vendor customization of the runtime environment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: Eclipse OpenJ9 Eclipse OpenJ9 VM openj9-0.21.0 + ProcessRuntimeDescriptionKey = attribute.Key("process.runtime.description") + + // ProcessRuntimeNameKey is the attribute Key conforming to the + // "process.runtime.name" semantic conventions. It represents the name of the + // runtime of this process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "OpenJDK Runtime Environment" + ProcessRuntimeNameKey = attribute.Key("process.runtime.name") + + // ProcessRuntimeVersionKey is the attribute Key conforming to the + // "process.runtime.version" semantic conventions. It represents the version of + // the runtime of this process, as returned by the runtime without modification. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 14.0.2 + ProcessRuntimeVersionKey = attribute.Key("process.runtime.version") + + // ProcessSavedUserIDKey is the attribute Key conforming to the + // "process.saved_user.id" semantic conventions. It represents the saved user ID + // (SUID) of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1002 + ProcessSavedUserIDKey = attribute.Key("process.saved_user.id") + + // ProcessSavedUserNameKey is the attribute Key conforming to the + // "process.saved_user.name" semantic conventions. It represents the username of + // the saved user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "operator" + ProcessSavedUserNameKey = attribute.Key("process.saved_user.name") + + // ProcessSessionLeaderPIDKey is the attribute Key conforming to the + // "process.session_leader.pid" semantic conventions. It represents the PID of + // the process's session leader. This is also the session ID (SID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 14 + ProcessSessionLeaderPIDKey = attribute.Key("process.session_leader.pid") + + // ProcessTitleKey is the attribute Key conforming to the "process.title" + // semantic conventions. It represents the process title (proctitle). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cat /etc/hostname", "xfce4-session", "bash" + // Note: In many Unix-like systems, process title (proctitle), is the string + // that represents the name or command line of a running process, displayed by + // system monitoring tools like ps, top, and htop. + ProcessTitleKey = attribute.Key("process.title") + + // ProcessUserIDKey is the attribute Key conforming to the "process.user.id" + // semantic conventions. It represents the effective user ID (EUID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1001 + ProcessUserIDKey = attribute.Key("process.user.id") + + // ProcessUserNameKey is the attribute Key conforming to the "process.user.name" + // semantic conventions. It represents the username of the effective user of the + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + ProcessUserNameKey = attribute.Key("process.user.name") + + // ProcessVpidKey is the attribute Key conforming to the "process.vpid" semantic + // conventions. It represents the virtual process identifier. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12 + // Note: The process ID within a PID namespace. This is not necessarily unique + // across all processes on the host but it is unique within the process + // namespace that the process exists within. + ProcessVpidKey = attribute.Key("process.vpid") + + // ProcessWorkingDirectoryKey is the attribute Key conforming to the + // "process.working_directory" semantic conventions. It represents the working + // directory of the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/root" + ProcessWorkingDirectoryKey = attribute.Key("process.working_directory") +) + +// ProcessArgsCount returns an attribute KeyValue conforming to the +// "process.args_count" semantic conventions. It represents the length of the +// process.command_args array. +func ProcessArgsCount(val int) attribute.KeyValue { + return ProcessArgsCountKey.Int(val) +} + +// ProcessCommand returns an attribute KeyValue conforming to the +// "process.command" semantic conventions. It represents the command used to +// launch the process (i.e. the command name). On Linux based systems, can be set +// to the zeroth string in `proc/[pid]/cmdline`. On Windows, can be set to the +// first parameter extracted from `GetCommandLineW`. +func ProcessCommand(val string) attribute.KeyValue { + return ProcessCommandKey.String(val) +} + +// ProcessCommandArgs returns an attribute KeyValue conforming to the +// "process.command_args" semantic conventions. It represents the all the command +// arguments (including the command/executable itself) as received by the +// process. On Linux-based systems (and some other Unixoid systems supporting +// procfs), can be set according to the list of null-delimited strings extracted +// from `proc/[pid]/cmdline`. For libc-based executables, this would be the full +// argv vector passed to `main`. +func ProcessCommandArgs(val ...string) attribute.KeyValue { + return ProcessCommandArgsKey.StringSlice(val) +} + +// ProcessCommandLine returns an attribute KeyValue conforming to the +// "process.command_line" semantic conventions. It represents the full command +// used to launch the process as a single string representing the full command. +// On Windows, can be set to the result of `GetCommandLineW`. Do not set this if +// you have to assemble it just for monitoring; use `process.command_args` +// instead. +func ProcessCommandLine(val string) attribute.KeyValue { + return ProcessCommandLineKey.String(val) +} + +// ProcessCreationTime returns an attribute KeyValue conforming to the +// "process.creation.time" semantic conventions. It represents the date and time +// the process was created, in ISO 8601 format. +func ProcessCreationTime(val string) attribute.KeyValue { + return ProcessCreationTimeKey.String(val) +} + +// ProcessExecutableBuildIDGnu returns an attribute KeyValue conforming to the +// "process.executable.build_id.gnu" semantic conventions. It represents the GNU +// build ID as found in the `.note.gnu.build-id` ELF section (hex string). +func ProcessExecutableBuildIDGnu(val string) attribute.KeyValue { + return ProcessExecutableBuildIDGnuKey.String(val) +} + +// ProcessExecutableBuildIDGo returns an attribute KeyValue conforming to the +// "process.executable.build_id.go" semantic conventions. It represents the Go +// build ID as retrieved by `go tool buildid `. +func ProcessExecutableBuildIDGo(val string) attribute.KeyValue { + return ProcessExecutableBuildIDGoKey.String(val) +} + +// ProcessExecutableBuildIDHtlhash returns an attribute KeyValue conforming to +// the "process.executable.build_id.htlhash" semantic conventions. It represents +// the profiling specific build ID for executables. See the OTel specification +// for Profiles for more information. +func ProcessExecutableBuildIDHtlhash(val string) attribute.KeyValue { + return ProcessExecutableBuildIDHtlhashKey.String(val) +} + +// ProcessExecutableName returns an attribute KeyValue conforming to the +// "process.executable.name" semantic conventions. It represents the name of the +// process executable. On Linux based systems, can be set to the `Name` in +// `proc/[pid]/status`. On Windows, can be set to the base name of +// `GetProcessImageFileNameW`. +func ProcessExecutableName(val string) attribute.KeyValue { + return ProcessExecutableNameKey.String(val) +} + +// ProcessExecutablePath returns an attribute KeyValue conforming to the +// "process.executable.path" semantic conventions. It represents the full path to +// the process executable. On Linux based systems, can be set to the target of +// `proc/[pid]/exe`. On Windows, can be set to the result of +// `GetProcessImageFileNameW`. +func ProcessExecutablePath(val string) attribute.KeyValue { + return ProcessExecutablePathKey.String(val) +} + +// ProcessExitCode returns an attribute KeyValue conforming to the +// "process.exit.code" semantic conventions. It represents the exit code of the +// process. +func ProcessExitCode(val int) attribute.KeyValue { + return ProcessExitCodeKey.Int(val) +} + +// ProcessExitTime returns an attribute KeyValue conforming to the +// "process.exit.time" semantic conventions. It represents the date and time the +// process exited, in ISO 8601 format. +func ProcessExitTime(val string) attribute.KeyValue { + return ProcessExitTimeKey.String(val) +} + +// ProcessGroupLeaderPID returns an attribute KeyValue conforming to the +// "process.group_leader.pid" semantic conventions. It represents the PID of the +// process's group leader. This is also the process group ID (PGID) of the +// process. +func ProcessGroupLeaderPID(val int) attribute.KeyValue { + return ProcessGroupLeaderPIDKey.Int(val) +} + +// ProcessInteractive returns an attribute KeyValue conforming to the +// "process.interactive" semantic conventions. It represents the whether the +// process is connected to an interactive shell. +func ProcessInteractive(val bool) attribute.KeyValue { + return ProcessInteractiveKey.Bool(val) +} + +// ProcessLinuxCgroup returns an attribute KeyValue conforming to the +// "process.linux.cgroup" semantic conventions. It represents the control group +// associated with the process. +func ProcessLinuxCgroup(val string) attribute.KeyValue { + return ProcessLinuxCgroupKey.String(val) +} + +// ProcessOwner returns an attribute KeyValue conforming to the "process.owner" +// semantic conventions. It represents the username of the user that owns the +// process. +func ProcessOwner(val string) attribute.KeyValue { + return ProcessOwnerKey.String(val) +} + +// ProcessParentPID returns an attribute KeyValue conforming to the +// "process.parent_pid" semantic conventions. It represents the parent Process +// identifier (PPID). +func ProcessParentPID(val int) attribute.KeyValue { + return ProcessParentPIDKey.Int(val) +} + +// ProcessPID returns an attribute KeyValue conforming to the "process.pid" +// semantic conventions. It represents the process identifier (PID). +func ProcessPID(val int) attribute.KeyValue { + return ProcessPIDKey.Int(val) +} + +// ProcessRealUserID returns an attribute KeyValue conforming to the +// "process.real_user.id" semantic conventions. It represents the real user ID +// (RUID) of the process. +func ProcessRealUserID(val int) attribute.KeyValue { + return ProcessRealUserIDKey.Int(val) +} + +// ProcessRealUserName returns an attribute KeyValue conforming to the +// "process.real_user.name" semantic conventions. It represents the username of +// the real user of the process. +func ProcessRealUserName(val string) attribute.KeyValue { + return ProcessRealUserNameKey.String(val) +} + +// ProcessRuntimeDescription returns an attribute KeyValue conforming to the +// "process.runtime.description" semantic conventions. It represents an +// additional description about the runtime of the process, for example a +// specific vendor customization of the runtime environment. +func ProcessRuntimeDescription(val string) attribute.KeyValue { + return ProcessRuntimeDescriptionKey.String(val) +} + +// ProcessRuntimeName returns an attribute KeyValue conforming to the +// "process.runtime.name" semantic conventions. It represents the name of the +// runtime of this process. +func ProcessRuntimeName(val string) attribute.KeyValue { + return ProcessRuntimeNameKey.String(val) +} + +// ProcessRuntimeVersion returns an attribute KeyValue conforming to the +// "process.runtime.version" semantic conventions. It represents the version of +// the runtime of this process, as returned by the runtime without modification. +func ProcessRuntimeVersion(val string) attribute.KeyValue { + return ProcessRuntimeVersionKey.String(val) +} + +// ProcessSavedUserID returns an attribute KeyValue conforming to the +// "process.saved_user.id" semantic conventions. It represents the saved user ID +// (SUID) of the process. +func ProcessSavedUserID(val int) attribute.KeyValue { + return ProcessSavedUserIDKey.Int(val) +} + +// ProcessSavedUserName returns an attribute KeyValue conforming to the +// "process.saved_user.name" semantic conventions. It represents the username of +// the saved user. +func ProcessSavedUserName(val string) attribute.KeyValue { + return ProcessSavedUserNameKey.String(val) +} + +// ProcessSessionLeaderPID returns an attribute KeyValue conforming to the +// "process.session_leader.pid" semantic conventions. It represents the PID of +// the process's session leader. This is also the session ID (SID) of the +// process. +func ProcessSessionLeaderPID(val int) attribute.KeyValue { + return ProcessSessionLeaderPIDKey.Int(val) +} + +// ProcessTitle returns an attribute KeyValue conforming to the "process.title" +// semantic conventions. It represents the process title (proctitle). +func ProcessTitle(val string) attribute.KeyValue { + return ProcessTitleKey.String(val) +} + +// ProcessUserID returns an attribute KeyValue conforming to the +// "process.user.id" semantic conventions. It represents the effective user ID +// (EUID) of the process. +func ProcessUserID(val int) attribute.KeyValue { + return ProcessUserIDKey.Int(val) +} + +// ProcessUserName returns an attribute KeyValue conforming to the +// "process.user.name" semantic conventions. It represents the username of the +// effective user of the process. +func ProcessUserName(val string) attribute.KeyValue { + return ProcessUserNameKey.String(val) +} + +// ProcessVpid returns an attribute KeyValue conforming to the "process.vpid" +// semantic conventions. It represents the virtual process identifier. +func ProcessVpid(val int) attribute.KeyValue { + return ProcessVpidKey.Int(val) +} + +// ProcessWorkingDirectory returns an attribute KeyValue conforming to the +// "process.working_directory" semantic conventions. It represents the working +// directory of the process. +func ProcessWorkingDirectory(val string) attribute.KeyValue { + return ProcessWorkingDirectoryKey.String(val) +} + +// Enum values for process.context_switch_type +var ( + // voluntary + // Stability: development + ProcessContextSwitchTypeVoluntary = ProcessContextSwitchTypeKey.String("voluntary") + // involuntary + // Stability: development + ProcessContextSwitchTypeInvoluntary = ProcessContextSwitchTypeKey.String("involuntary") +) + +// Enum values for process.paging.fault_type +var ( + // major + // Stability: development + ProcessPagingFaultTypeMajor = ProcessPagingFaultTypeKey.String("major") + // minor + // Stability: development + ProcessPagingFaultTypeMinor = ProcessPagingFaultTypeKey.String("minor") +) + +// Namespace: profile +const ( + // ProfileFrameTypeKey is the attribute Key conforming to the + // "profile.frame.type" semantic conventions. It represents the describes the + // interpreter or compiler of a single frame. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cpython" + ProfileFrameTypeKey = attribute.Key("profile.frame.type") +) + +// Enum values for profile.frame.type +var ( + // [.NET] + // + // Stability: development + // + // [.NET]: https://wikipedia.org/wiki/.NET + ProfileFrameTypeDotnet = ProfileFrameTypeKey.String("dotnet") + // [JVM] + // + // Stability: development + // + // [JVM]: https://wikipedia.org/wiki/Java_virtual_machine + ProfileFrameTypeJVM = ProfileFrameTypeKey.String("jvm") + // [Kernel] + // + // Stability: development + // + // [Kernel]: https://wikipedia.org/wiki/Kernel_(operating_system) + ProfileFrameTypeKernel = ProfileFrameTypeKey.String("kernel") + // [C], [C++], [Go], [Rust] + // + // Stability: development + // + // [C]: https://wikipedia.org/wiki/C_(programming_language) + // [C++]: https://wikipedia.org/wiki/C%2B%2B + // [Go]: https://wikipedia.org/wiki/Go_(programming_language) + // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language) + ProfileFrameTypeNative = ProfileFrameTypeKey.String("native") + // [Perl] + // + // Stability: development + // + // [Perl]: https://wikipedia.org/wiki/Perl + ProfileFrameTypePerl = ProfileFrameTypeKey.String("perl") + // [PHP] + // + // Stability: development + // + // [PHP]: https://wikipedia.org/wiki/PHP + ProfileFrameTypePHP = ProfileFrameTypeKey.String("php") + // [Python] + // + // Stability: development + // + // [Python]: https://wikipedia.org/wiki/Python_(programming_language) + ProfileFrameTypeCpython = ProfileFrameTypeKey.String("cpython") + // [Ruby] + // + // Stability: development + // + // [Ruby]: https://wikipedia.org/wiki/Ruby_(programming_language) + ProfileFrameTypeRuby = ProfileFrameTypeKey.String("ruby") + // [V8JS] + // + // Stability: development + // + // [V8JS]: https://wikipedia.org/wiki/V8_(JavaScript_engine) + ProfileFrameTypeV8JS = ProfileFrameTypeKey.String("v8js") + // [Erlang] + // + // Stability: development + // + // [Erlang]: https://en.wikipedia.org/wiki/BEAM_(Erlang_virtual_machine) + ProfileFrameTypeBeam = ProfileFrameTypeKey.String("beam") +) + +// Namespace: rpc +const ( + // RPCConnectRPCErrorCodeKey is the attribute Key conforming to the + // "rpc.connect_rpc.error_code" semantic conventions. It represents the + // [error codes] of the Connect request. Error codes are always string values. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [error codes]: https://connect.build/docs/protocol/#error-codes + RPCConnectRPCErrorCodeKey = attribute.Key("rpc.connect_rpc.error_code") + + // RPCGRPCStatusCodeKey is the attribute Key conforming to the + // "rpc.grpc.status_code" semantic conventions. It represents the + // [numeric status code] of the gRPC request. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [numeric status code]: https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md + RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code") + + // RPCJsonrpcErrorCodeKey is the attribute Key conforming to the + // "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code` + // property of response if it is an error response. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: -32700, 100 + RPCJsonrpcErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code") + + // RPCJsonrpcErrorMessageKey is the attribute Key conforming to the + // "rpc.jsonrpc.error_message" semantic conventions. It represents the + // `error.message` property of response if it is an error response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Parse error", "User already exists" + RPCJsonrpcErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message") + + // RPCJsonrpcRequestIDKey is the attribute Key conforming to the + // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` + // property of request or response. Since protocol allows id to be int, string, + // `null` or missing (for notifications), value is expected to be cast to string + // for simplicity. Use empty string in case of `null` value. Omit entirely if + // this is a notification. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "10", "request-7", "" + RPCJsonrpcRequestIDKey = attribute.Key("rpc.jsonrpc.request_id") + + // RPCJsonrpcVersionKey is the attribute Key conforming to the + // "rpc.jsonrpc.version" semantic conventions. It represents the protocol + // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 + // doesn't specify this, the value can be omitted. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2.0", "1.0" + RPCJsonrpcVersionKey = attribute.Key("rpc.jsonrpc.version") + + // RPCMessageCompressedSizeKey is the attribute Key conforming to the + // "rpc.message.compressed_size" semantic conventions. It represents the + // compressed size of the message in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageCompressedSizeKey = attribute.Key("rpc.message.compressed_size") + + // RPCMessageIDKey is the attribute Key conforming to the "rpc.message.id" + // semantic conventions. It represents the mUST be calculated as two different + // counters starting from `1` one for sent messages and one for received + // message. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This way we guarantee that the values will be consistent between + // different implementations. + RPCMessageIDKey = attribute.Key("rpc.message.id") + + // RPCMessageTypeKey is the attribute Key conforming to the "rpc.message.type" + // semantic conventions. It represents the whether this is a received or sent + // message. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageTypeKey = attribute.Key("rpc.message.type") + + // RPCMessageUncompressedSizeKey is the attribute Key conforming to the + // "rpc.message.uncompressed_size" semantic conventions. It represents the + // uncompressed size of the message in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageUncompressedSizeKey = attribute.Key("rpc.message.uncompressed_size") + + // RPCMethodKey is the attribute Key conforming to the "rpc.method" semantic + // conventions. It represents the name of the (logical) method being called, + // must be equal to the $method part in the span name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: exampleMethod + // Note: This is the logical name of the method from the RPC interface + // perspective, which can be different from the name of any implementing + // method/function. The `code.function.name` attribute may be used to store the + // latter (e.g., method actually executing the call on the server side, RPC + // client stub method on the client side). + RPCMethodKey = attribute.Key("rpc.method") + + // RPCServiceKey is the attribute Key conforming to the "rpc.service" semantic + // conventions. It represents the full (logical) name of the service being + // called, including its package name, if applicable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myservice.EchoService + // Note: This is the logical name of the service from the RPC interface + // perspective, which can be different from the name of any implementing class. + // The `code.namespace` attribute may be used to store the latter (despite the + // attribute name, it may include a class name; e.g., class with method actually + // executing the call on the server side, RPC client stub class on the client + // side). + RPCServiceKey = attribute.Key("rpc.service") + + // RPCSystemKey is the attribute Key conforming to the "rpc.system" semantic + // conventions. It represents a string identifying the remoting system. See + // below for a list of well-known identifiers. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCSystemKey = attribute.Key("rpc.system") +) + +// RPCJsonrpcErrorCode returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code` +// property of response if it is an error response. +func RPCJsonrpcErrorCode(val int) attribute.KeyValue { + return RPCJsonrpcErrorCodeKey.Int(val) +} + +// RPCJsonrpcErrorMessage returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.error_message" semantic conventions. It represents the +// `error.message` property of response if it is an error response. +func RPCJsonrpcErrorMessage(val string) attribute.KeyValue { + return RPCJsonrpcErrorMessageKey.String(val) +} + +// RPCJsonrpcRequestID returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` property +// of request or response. Since protocol allows id to be int, string, `null` or +// missing (for notifications), value is expected to be cast to string for +// simplicity. Use empty string in case of `null` value. Omit entirely if this is +// a notification. +func RPCJsonrpcRequestID(val string) attribute.KeyValue { + return RPCJsonrpcRequestIDKey.String(val) +} + +// RPCJsonrpcVersion returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.version" semantic conventions. It represents the protocol version +// as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 doesn't +// specify this, the value can be omitted. +func RPCJsonrpcVersion(val string) attribute.KeyValue { + return RPCJsonrpcVersionKey.String(val) +} + +// RPCMessageCompressedSize returns an attribute KeyValue conforming to the +// "rpc.message.compressed_size" semantic conventions. It represents the +// compressed size of the message in bytes. +func RPCMessageCompressedSize(val int) attribute.KeyValue { + return RPCMessageCompressedSizeKey.Int(val) +} + +// RPCMessageID returns an attribute KeyValue conforming to the "rpc.message.id" +// semantic conventions. It represents the mUST be calculated as two different +// counters starting from `1` one for sent messages and one for received message. +func RPCMessageID(val int) attribute.KeyValue { + return RPCMessageIDKey.Int(val) +} + +// RPCMessageUncompressedSize returns an attribute KeyValue conforming to the +// "rpc.message.uncompressed_size" semantic conventions. It represents the +// uncompressed size of the message in bytes. +func RPCMessageUncompressedSize(val int) attribute.KeyValue { + return RPCMessageUncompressedSizeKey.Int(val) +} + +// RPCMethod returns an attribute KeyValue conforming to the "rpc.method" +// semantic conventions. It represents the name of the (logical) method being +// called, must be equal to the $method part in the span name. +func RPCMethod(val string) attribute.KeyValue { + return RPCMethodKey.String(val) +} + +// RPCService returns an attribute KeyValue conforming to the "rpc.service" +// semantic conventions. It represents the full (logical) name of the service +// being called, including its package name, if applicable. +func RPCService(val string) attribute.KeyValue { + return RPCServiceKey.String(val) +} + +// Enum values for rpc.connect_rpc.error_code +var ( + // cancelled + // Stability: development + RPCConnectRPCErrorCodeCancelled = RPCConnectRPCErrorCodeKey.String("cancelled") + // unknown + // Stability: development + RPCConnectRPCErrorCodeUnknown = RPCConnectRPCErrorCodeKey.String("unknown") + // invalid_argument + // Stability: development + RPCConnectRPCErrorCodeInvalidArgument = RPCConnectRPCErrorCodeKey.String("invalid_argument") + // deadline_exceeded + // Stability: development + RPCConnectRPCErrorCodeDeadlineExceeded = RPCConnectRPCErrorCodeKey.String("deadline_exceeded") + // not_found + // Stability: development + RPCConnectRPCErrorCodeNotFound = RPCConnectRPCErrorCodeKey.String("not_found") + // already_exists + // Stability: development + RPCConnectRPCErrorCodeAlreadyExists = RPCConnectRPCErrorCodeKey.String("already_exists") + // permission_denied + // Stability: development + RPCConnectRPCErrorCodePermissionDenied = RPCConnectRPCErrorCodeKey.String("permission_denied") + // resource_exhausted + // Stability: development + RPCConnectRPCErrorCodeResourceExhausted = RPCConnectRPCErrorCodeKey.String("resource_exhausted") + // failed_precondition + // Stability: development + RPCConnectRPCErrorCodeFailedPrecondition = RPCConnectRPCErrorCodeKey.String("failed_precondition") + // aborted + // Stability: development + RPCConnectRPCErrorCodeAborted = RPCConnectRPCErrorCodeKey.String("aborted") + // out_of_range + // Stability: development + RPCConnectRPCErrorCodeOutOfRange = RPCConnectRPCErrorCodeKey.String("out_of_range") + // unimplemented + // Stability: development + RPCConnectRPCErrorCodeUnimplemented = RPCConnectRPCErrorCodeKey.String("unimplemented") + // internal + // Stability: development + RPCConnectRPCErrorCodeInternal = RPCConnectRPCErrorCodeKey.String("internal") + // unavailable + // Stability: development + RPCConnectRPCErrorCodeUnavailable = RPCConnectRPCErrorCodeKey.String("unavailable") + // data_loss + // Stability: development + RPCConnectRPCErrorCodeDataLoss = RPCConnectRPCErrorCodeKey.String("data_loss") + // unauthenticated + // Stability: development + RPCConnectRPCErrorCodeUnauthenticated = RPCConnectRPCErrorCodeKey.String("unauthenticated") +) + +// Enum values for rpc.grpc.status_code +var ( + // OK + // Stability: development + RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0) + // CANCELLED + // Stability: development + RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1) + // UNKNOWN + // Stability: development + RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2) + // INVALID_ARGUMENT + // Stability: development + RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3) + // DEADLINE_EXCEEDED + // Stability: development + RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4) + // NOT_FOUND + // Stability: development + RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5) + // ALREADY_EXISTS + // Stability: development + RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6) + // PERMISSION_DENIED + // Stability: development + RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7) + // RESOURCE_EXHAUSTED + // Stability: development + RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8) + // FAILED_PRECONDITION + // Stability: development + RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9) + // ABORTED + // Stability: development + RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10) + // OUT_OF_RANGE + // Stability: development + RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11) + // UNIMPLEMENTED + // Stability: development + RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12) + // INTERNAL + // Stability: development + RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13) + // UNAVAILABLE + // Stability: development + RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14) + // DATA_LOSS + // Stability: development + RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15) + // UNAUTHENTICATED + // Stability: development + RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16) +) + +// Enum values for rpc.message.type +var ( + // sent + // Stability: development + RPCMessageTypeSent = RPCMessageTypeKey.String("SENT") + // received + // Stability: development + RPCMessageTypeReceived = RPCMessageTypeKey.String("RECEIVED") +) + +// Enum values for rpc.system +var ( + // gRPC + // Stability: development + RPCSystemGRPC = RPCSystemKey.String("grpc") + // Java RMI + // Stability: development + RPCSystemJavaRmi = RPCSystemKey.String("java_rmi") + // .NET WCF + // Stability: development + RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf") + // Apache Dubbo + // Stability: development + RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo") + // Connect RPC + // Stability: development + RPCSystemConnectRPC = RPCSystemKey.String("connect_rpc") +) + +// Namespace: security_rule +const ( + // SecurityRuleCategoryKey is the attribute Key conforming to the + // "security_rule.category" semantic conventions. It represents a categorization + // value keyword used by the entity using the rule for detection of this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Attempted Information Leak" + SecurityRuleCategoryKey = attribute.Key("security_rule.category") + + // SecurityRuleDescriptionKey is the attribute Key conforming to the + // "security_rule.description" semantic conventions. It represents the + // description of the rule generating the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Block requests to public DNS over HTTPS / TLS protocols" + SecurityRuleDescriptionKey = attribute.Key("security_rule.description") + + // SecurityRuleLicenseKey is the attribute Key conforming to the + // "security_rule.license" semantic conventions. It represents the name of the + // license under which the rule used to generate this event is made available. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Apache 2.0" + SecurityRuleLicenseKey = attribute.Key("security_rule.license") + + // SecurityRuleNameKey is the attribute Key conforming to the + // "security_rule.name" semantic conventions. It represents the name of the rule + // or signature generating the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "BLOCK_DNS_over_TLS" + SecurityRuleNameKey = attribute.Key("security_rule.name") + + // SecurityRuleReferenceKey is the attribute Key conforming to the + // "security_rule.reference" semantic conventions. It represents the reference + // URL to additional information about the rule used to generate this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://en.wikipedia.org/wiki/DNS_over_TLS" + // Note: The URL can point to the vendor’s documentation about the rule. If + // that’s not available, it can also be a link to a more general page + // describing this type of alert. + SecurityRuleReferenceKey = attribute.Key("security_rule.reference") + + // SecurityRuleRulesetNameKey is the attribute Key conforming to the + // "security_rule.ruleset.name" semantic conventions. It represents the name of + // the ruleset, policy, group, or parent category in which the rule used to + // generate this event is a member. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Standard_Protocol_Filters" + SecurityRuleRulesetNameKey = attribute.Key("security_rule.ruleset.name") + + // SecurityRuleUUIDKey is the attribute Key conforming to the + // "security_rule.uuid" semantic conventions. It represents a rule ID that is + // unique within the scope of a set or group of agents, observers, or other + // entities using the rule for detection of this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "550e8400-e29b-41d4-a716-446655440000", "1100110011" + SecurityRuleUUIDKey = attribute.Key("security_rule.uuid") + + // SecurityRuleVersionKey is the attribute Key conforming to the + // "security_rule.version" semantic conventions. It represents the version / + // revision of the rule being used for analysis. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.0.0" + SecurityRuleVersionKey = attribute.Key("security_rule.version") +) + +// SecurityRuleCategory returns an attribute KeyValue conforming to the +// "security_rule.category" semantic conventions. It represents a categorization +// value keyword used by the entity using the rule for detection of this event. +func SecurityRuleCategory(val string) attribute.KeyValue { + return SecurityRuleCategoryKey.String(val) +} + +// SecurityRuleDescription returns an attribute KeyValue conforming to the +// "security_rule.description" semantic conventions. It represents the +// description of the rule generating the event. +func SecurityRuleDescription(val string) attribute.KeyValue { + return SecurityRuleDescriptionKey.String(val) +} + +// SecurityRuleLicense returns an attribute KeyValue conforming to the +// "security_rule.license" semantic conventions. It represents the name of the +// license under which the rule used to generate this event is made available. +func SecurityRuleLicense(val string) attribute.KeyValue { + return SecurityRuleLicenseKey.String(val) +} + +// SecurityRuleName returns an attribute KeyValue conforming to the +// "security_rule.name" semantic conventions. It represents the name of the rule +// or signature generating the event. +func SecurityRuleName(val string) attribute.KeyValue { + return SecurityRuleNameKey.String(val) +} + +// SecurityRuleReference returns an attribute KeyValue conforming to the +// "security_rule.reference" semantic conventions. It represents the reference +// URL to additional information about the rule used to generate this event. +func SecurityRuleReference(val string) attribute.KeyValue { + return SecurityRuleReferenceKey.String(val) +} + +// SecurityRuleRulesetName returns an attribute KeyValue conforming to the +// "security_rule.ruleset.name" semantic conventions. It represents the name of +// the ruleset, policy, group, or parent category in which the rule used to +// generate this event is a member. +func SecurityRuleRulesetName(val string) attribute.KeyValue { + return SecurityRuleRulesetNameKey.String(val) +} + +// SecurityRuleUUID returns an attribute KeyValue conforming to the +// "security_rule.uuid" semantic conventions. It represents a rule ID that is +// unique within the scope of a set or group of agents, observers, or other +// entities using the rule for detection of this event. +func SecurityRuleUUID(val string) attribute.KeyValue { + return SecurityRuleUUIDKey.String(val) +} + +// SecurityRuleVersion returns an attribute KeyValue conforming to the +// "security_rule.version" semantic conventions. It represents the version / +// revision of the rule being used for analysis. +func SecurityRuleVersion(val string) attribute.KeyValue { + return SecurityRuleVersionKey.String(val) +} + +// Namespace: server +const ( + // ServerAddressKey is the attribute Key conforming to the "server.address" + // semantic conventions. It represents the server domain name if available + // without reverse DNS lookup; otherwise, IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the client side, and when communicating through an + // intermediary, `server.address` SHOULD represent the server address behind any + // intermediaries, for example proxies, if it's available. + ServerAddressKey = attribute.Key("server.address") + + // ServerPortKey is the attribute Key conforming to the "server.port" semantic + // conventions. It represents the server port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 80, 8080, 443 + // Note: When observed from the client side, and when communicating through an + // intermediary, `server.port` SHOULD represent the server port behind any + // intermediaries, for example proxies, if it's available. + ServerPortKey = attribute.Key("server.port") +) + +// ServerAddress returns an attribute KeyValue conforming to the "server.address" +// semantic conventions. It represents the server domain name if available +// without reverse DNS lookup; otherwise, IP address or Unix domain socket name. +func ServerAddress(val string) attribute.KeyValue { + return ServerAddressKey.String(val) +} + +// ServerPort returns an attribute KeyValue conforming to the "server.port" +// semantic conventions. It represents the server port number. +func ServerPort(val int) attribute.KeyValue { + return ServerPortKey.Int(val) +} + +// Namespace: service +const ( + // ServiceInstanceIDKey is the attribute Key conforming to the + // "service.instance.id" semantic conventions. It represents the string ID of + // the service instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "627cc493-f310-47de-96bd-71410b7dec09" + // Note: MUST be unique for each instance of the same + // `service.namespace,service.name` pair (in other words + // `service.namespace,service.name,service.instance.id` triplet MUST be globally + // unique). The ID helps to + // distinguish instances of the same service that exist at the same time (e.g. + // instances of a horizontally scaled + // service). + // + // Implementations, such as SDKs, are recommended to generate a random Version 1 + // or Version 4 [RFC + // 4122] UUID, but are free to use an inherent unique ID as + // the source of + // this value if stability is desirable. In that case, the ID SHOULD be used as + // source of a UUID Version 5 and + // SHOULD use the following UUID as the namespace: + // `4d63009a-8d0f-11ee-aad7-4c796ed8e320`. + // + // UUIDs are typically recommended, as only an opaque value for the purposes of + // identifying a service instance is + // needed. Similar to what can be seen in the man page for the + // [`/etc/machine-id`] file, the underlying + // data, such as pod name and namespace should be treated as confidential, being + // the user's choice to expose it + // or not via another resource attribute. + // + // For applications running behind an application server (like unicorn), we do + // not recommend using one identifier + // for all processes participating in the application. Instead, it's recommended + // each division (e.g. a worker + // thread in unicorn) to have its own instance.id. + // + // It's not recommended for a Collector to set `service.instance.id` if it can't + // unambiguously determine the + // service instance that is generating that telemetry. For instance, creating an + // UUID based on `pod.name` will + // likely be wrong, as the Collector might not know from which container within + // that pod the telemetry originated. + // However, Collectors can set the `service.instance.id` if they can + // unambiguously determine the service instance + // for that telemetry. This is typically the case for scraping receivers, as + // they know the target address and + // port. + // + // [RFC + // 4122]: https://www.ietf.org/rfc/rfc4122.txt + // [`/etc/machine-id`]: https://www.freedesktop.org/software/systemd/man/latest/machine-id.html + ServiceInstanceIDKey = attribute.Key("service.instance.id") + + // ServiceNameKey is the attribute Key conforming to the "service.name" semantic + // conventions. It represents the logical name of the service. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "shoppingcart" + // Note: MUST be the same for all instances of horizontally scaled services. If + // the value was not specified, SDKs MUST fallback to `unknown_service:` + // concatenated with [`process.executable.name`], e.g. `unknown_service:bash`. + // If `process.executable.name` is not available, the value MUST be set to + // `unknown_service`. + // + // [`process.executable.name`]: process.md + ServiceNameKey = attribute.Key("service.name") + + // ServiceNamespaceKey is the attribute Key conforming to the + // "service.namespace" semantic conventions. It represents a namespace for + // `service.name`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Shop" + // Note: A string value having a meaning that helps to distinguish a group of + // services, for example the team name that owns a group of services. + // `service.name` is expected to be unique within the same namespace. If + // `service.namespace` is not specified in the Resource then `service.name` is + // expected to be unique for all services that have no explicit namespace + // defined (so the empty/unspecified namespace is simply one more valid + // namespace). Zero-length namespace string is assumed equal to unspecified + // namespace. + ServiceNamespaceKey = attribute.Key("service.namespace") + + // ServiceVersionKey is the attribute Key conforming to the "service.version" + // semantic conventions. It represents the version string of the service API or + // implementation. The format is not defined by these conventions. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "2.0.0", "a01dbef8a" + ServiceVersionKey = attribute.Key("service.version") +) + +// ServiceInstanceID returns an attribute KeyValue conforming to the +// "service.instance.id" semantic conventions. It represents the string ID of the +// service instance. +func ServiceInstanceID(val string) attribute.KeyValue { + return ServiceInstanceIDKey.String(val) +} + +// ServiceName returns an attribute KeyValue conforming to the "service.name" +// semantic conventions. It represents the logical name of the service. +func ServiceName(val string) attribute.KeyValue { + return ServiceNameKey.String(val) +} + +// ServiceNamespace returns an attribute KeyValue conforming to the +// "service.namespace" semantic conventions. It represents a namespace for +// `service.name`. +func ServiceNamespace(val string) attribute.KeyValue { + return ServiceNamespaceKey.String(val) +} + +// ServiceVersion returns an attribute KeyValue conforming to the +// "service.version" semantic conventions. It represents the version string of +// the service API or implementation. The format is not defined by these +// conventions. +func ServiceVersion(val string) attribute.KeyValue { + return ServiceVersionKey.String(val) +} + +// Namespace: session +const ( + // SessionIDKey is the attribute Key conforming to the "session.id" semantic + // conventions. It represents a unique id to identify a session. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 00112233-4455-6677-8899-aabbccddeeff + SessionIDKey = attribute.Key("session.id") + + // SessionPreviousIDKey is the attribute Key conforming to the + // "session.previous_id" semantic conventions. It represents the previous + // `session.id` for this user, when known. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 00112233-4455-6677-8899-aabbccddeeff + SessionPreviousIDKey = attribute.Key("session.previous_id") +) + +// SessionID returns an attribute KeyValue conforming to the "session.id" +// semantic conventions. It represents a unique id to identify a session. +func SessionID(val string) attribute.KeyValue { + return SessionIDKey.String(val) +} + +// SessionPreviousID returns an attribute KeyValue conforming to the +// "session.previous_id" semantic conventions. It represents the previous +// `session.id` for this user, when known. +func SessionPreviousID(val string) attribute.KeyValue { + return SessionPreviousIDKey.String(val) +} + +// Namespace: signalr +const ( + // SignalrConnectionStatusKey is the attribute Key conforming to the + // "signalr.connection.status" semantic conventions. It represents the signalR + // HTTP connection closure status. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "app_shutdown", "timeout" + SignalrConnectionStatusKey = attribute.Key("signalr.connection.status") + + // SignalrTransportKey is the attribute Key conforming to the + // "signalr.transport" semantic conventions. It represents the + // [SignalR transport type]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "web_sockets", "long_polling" + // + // [SignalR transport type]: https://github.com/dotnet/aspnetcore/blob/main/src/SignalR/docs/specs/TransportProtocols.md + SignalrTransportKey = attribute.Key("signalr.transport") +) + +// Enum values for signalr.connection.status +var ( + // The connection was closed normally. + // Stability: stable + SignalrConnectionStatusNormalClosure = SignalrConnectionStatusKey.String("normal_closure") + // The connection was closed due to a timeout. + // Stability: stable + SignalrConnectionStatusTimeout = SignalrConnectionStatusKey.String("timeout") + // The connection was closed because the app is shutting down. + // Stability: stable + SignalrConnectionStatusAppShutdown = SignalrConnectionStatusKey.String("app_shutdown") +) + +// Enum values for signalr.transport +var ( + // ServerSentEvents protocol + // Stability: stable + SignalrTransportServerSentEvents = SignalrTransportKey.String("server_sent_events") + // LongPolling protocol + // Stability: stable + SignalrTransportLongPolling = SignalrTransportKey.String("long_polling") + // WebSockets protocol + // Stability: stable + SignalrTransportWebSockets = SignalrTransportKey.String("web_sockets") +) + +// Namespace: source +const ( + // SourceAddressKey is the attribute Key conforming to the "source.address" + // semantic conventions. It represents the source address - domain name if + // available without reverse DNS lookup; otherwise, IP address or Unix domain + // socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "source.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the destination side, and when communicating through + // an intermediary, `source.address` SHOULD represent the source address behind + // any intermediaries, for example proxies, if it's available. + SourceAddressKey = attribute.Key("source.address") + + // SourcePortKey is the attribute Key conforming to the "source.port" semantic + // conventions. It represents the source port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3389, 2888 + SourcePortKey = attribute.Key("source.port") +) + +// SourceAddress returns an attribute KeyValue conforming to the "source.address" +// semantic conventions. It represents the source address - domain name if +// available without reverse DNS lookup; otherwise, IP address or Unix domain +// socket name. +func SourceAddress(val string) attribute.KeyValue { + return SourceAddressKey.String(val) +} + +// SourcePort returns an attribute KeyValue conforming to the "source.port" +// semantic conventions. It represents the source port number. +func SourcePort(val int) attribute.KeyValue { + return SourcePortKey.Int(val) +} + +// Namespace: system +const ( + // SystemCPULogicalNumberKey is the attribute Key conforming to the + // "system.cpu.logical_number" semantic conventions. It represents the logical + // CPU number [0..n-1]. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + SystemCPULogicalNumberKey = attribute.Key("system.cpu.logical_number") + + // SystemDeviceKey is the attribute Key conforming to the "system.device" + // semantic conventions. It represents the device identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "(identifier)" + SystemDeviceKey = attribute.Key("system.device") + + // SystemFilesystemModeKey is the attribute Key conforming to the + // "system.filesystem.mode" semantic conventions. It represents the filesystem + // mode. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "rw, ro" + SystemFilesystemModeKey = attribute.Key("system.filesystem.mode") + + // SystemFilesystemMountpointKey is the attribute Key conforming to the + // "system.filesystem.mountpoint" semantic conventions. It represents the + // filesystem mount path. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/mnt/data" + SystemFilesystemMountpointKey = attribute.Key("system.filesystem.mountpoint") + + // SystemFilesystemStateKey is the attribute Key conforming to the + // "system.filesystem.state" semantic conventions. It represents the filesystem + // state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "used" + SystemFilesystemStateKey = attribute.Key("system.filesystem.state") + + // SystemFilesystemTypeKey is the attribute Key conforming to the + // "system.filesystem.type" semantic conventions. It represents the filesystem + // type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ext4" + SystemFilesystemTypeKey = attribute.Key("system.filesystem.type") + + // SystemMemoryStateKey is the attribute Key conforming to the + // "system.memory.state" semantic conventions. It represents the memory state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "free", "cached" + SystemMemoryStateKey = attribute.Key("system.memory.state") + + // SystemPagingDirectionKey is the attribute Key conforming to the + // "system.paging.direction" semantic conventions. It represents the paging + // access direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "in" + SystemPagingDirectionKey = attribute.Key("system.paging.direction") + + // SystemPagingStateKey is the attribute Key conforming to the + // "system.paging.state" semantic conventions. It represents the memory paging + // state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "free" + SystemPagingStateKey = attribute.Key("system.paging.state") + + // SystemPagingTypeKey is the attribute Key conforming to the + // "system.paging.type" semantic conventions. It represents the memory paging + // type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "minor" + SystemPagingTypeKey = attribute.Key("system.paging.type") + + // SystemProcessStatusKey is the attribute Key conforming to the + // "system.process.status" semantic conventions. It represents the process + // state, e.g., [Linux Process State Codes]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "running" + // + // [Linux Process State Codes]: https://man7.org/linux/man-pages/man1/ps.1.html#PROCESS_STATE_CODES + SystemProcessStatusKey = attribute.Key("system.process.status") +) + +// SystemCPULogicalNumber returns an attribute KeyValue conforming to the +// "system.cpu.logical_number" semantic conventions. It represents the logical +// CPU number [0..n-1]. +func SystemCPULogicalNumber(val int) attribute.KeyValue { + return SystemCPULogicalNumberKey.Int(val) +} + +// SystemDevice returns an attribute KeyValue conforming to the "system.device" +// semantic conventions. It represents the device identifier. +func SystemDevice(val string) attribute.KeyValue { + return SystemDeviceKey.String(val) +} + +// SystemFilesystemMode returns an attribute KeyValue conforming to the +// "system.filesystem.mode" semantic conventions. It represents the filesystem +// mode. +func SystemFilesystemMode(val string) attribute.KeyValue { + return SystemFilesystemModeKey.String(val) +} + +// SystemFilesystemMountpoint returns an attribute KeyValue conforming to the +// "system.filesystem.mountpoint" semantic conventions. It represents the +// filesystem mount path. +func SystemFilesystemMountpoint(val string) attribute.KeyValue { + return SystemFilesystemMountpointKey.String(val) +} + +// Enum values for system.filesystem.state +var ( + // used + // Stability: development + SystemFilesystemStateUsed = SystemFilesystemStateKey.String("used") + // free + // Stability: development + SystemFilesystemStateFree = SystemFilesystemStateKey.String("free") + // reserved + // Stability: development + SystemFilesystemStateReserved = SystemFilesystemStateKey.String("reserved") +) + +// Enum values for system.filesystem.type +var ( + // fat32 + // Stability: development + SystemFilesystemTypeFat32 = SystemFilesystemTypeKey.String("fat32") + // exfat + // Stability: development + SystemFilesystemTypeExfat = SystemFilesystemTypeKey.String("exfat") + // ntfs + // Stability: development + SystemFilesystemTypeNtfs = SystemFilesystemTypeKey.String("ntfs") + // refs + // Stability: development + SystemFilesystemTypeRefs = SystemFilesystemTypeKey.String("refs") + // hfsplus + // Stability: development + SystemFilesystemTypeHfsplus = SystemFilesystemTypeKey.String("hfsplus") + // ext4 + // Stability: development + SystemFilesystemTypeExt4 = SystemFilesystemTypeKey.String("ext4") +) + +// Enum values for system.memory.state +var ( + // used + // Stability: development + SystemMemoryStateUsed = SystemMemoryStateKey.String("used") + // free + // Stability: development + SystemMemoryStateFree = SystemMemoryStateKey.String("free") + // Deprecated: Removed, report shared memory usage with + // `metric.system.memory.shared` metric. + SystemMemoryStateShared = SystemMemoryStateKey.String("shared") + // buffers + // Stability: development + SystemMemoryStateBuffers = SystemMemoryStateKey.String("buffers") + // cached + // Stability: development + SystemMemoryStateCached = SystemMemoryStateKey.String("cached") +) + +// Enum values for system.paging.direction +var ( + // in + // Stability: development + SystemPagingDirectionIn = SystemPagingDirectionKey.String("in") + // out + // Stability: development + SystemPagingDirectionOut = SystemPagingDirectionKey.String("out") +) + +// Enum values for system.paging.state +var ( + // used + // Stability: development + SystemPagingStateUsed = SystemPagingStateKey.String("used") + // free + // Stability: development + SystemPagingStateFree = SystemPagingStateKey.String("free") +) + +// Enum values for system.paging.type +var ( + // major + // Stability: development + SystemPagingTypeMajor = SystemPagingTypeKey.String("major") + // minor + // Stability: development + SystemPagingTypeMinor = SystemPagingTypeKey.String("minor") +) + +// Enum values for system.process.status +var ( + // running + // Stability: development + SystemProcessStatusRunning = SystemProcessStatusKey.String("running") + // sleeping + // Stability: development + SystemProcessStatusSleeping = SystemProcessStatusKey.String("sleeping") + // stopped + // Stability: development + SystemProcessStatusStopped = SystemProcessStatusKey.String("stopped") + // defunct + // Stability: development + SystemProcessStatusDefunct = SystemProcessStatusKey.String("defunct") +) + +// Namespace: telemetry +const ( + // TelemetryDistroNameKey is the attribute Key conforming to the + // "telemetry.distro.name" semantic conventions. It represents the name of the + // auto instrumentation agent or distribution, if used. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "parts-unlimited-java" + // Note: Official auto instrumentation agents and distributions SHOULD set the + // `telemetry.distro.name` attribute to + // a string starting with `opentelemetry-`, e.g. + // `opentelemetry-java-instrumentation`. + TelemetryDistroNameKey = attribute.Key("telemetry.distro.name") + + // TelemetryDistroVersionKey is the attribute Key conforming to the + // "telemetry.distro.version" semantic conventions. It represents the version + // string of the auto instrumentation agent or distribution, if used. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.2.3" + TelemetryDistroVersionKey = attribute.Key("telemetry.distro.version") + + // TelemetrySDKLanguageKey is the attribute Key conforming to the + // "telemetry.sdk.language" semantic conventions. It represents the language of + // the telemetry SDK. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + TelemetrySDKLanguageKey = attribute.Key("telemetry.sdk.language") + + // TelemetrySDKNameKey is the attribute Key conforming to the + // "telemetry.sdk.name" semantic conventions. It represents the name of the + // telemetry SDK as defined above. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "opentelemetry" + // Note: The OpenTelemetry SDK MUST set the `telemetry.sdk.name` attribute to + // `opentelemetry`. + // If another SDK, like a fork or a vendor-provided implementation, is used, + // this SDK MUST set the + // `telemetry.sdk.name` attribute to the fully-qualified class or module name of + // this SDK's main entry point + // or another suitable identifier depending on the language. + // The identifier `opentelemetry` is reserved and MUST NOT be used in this case. + // All custom identifiers SHOULD be stable across different versions of an + // implementation. + TelemetrySDKNameKey = attribute.Key("telemetry.sdk.name") + + // TelemetrySDKVersionKey is the attribute Key conforming to the + // "telemetry.sdk.version" semantic conventions. It represents the version + // string of the telemetry SDK. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.2.3" + TelemetrySDKVersionKey = attribute.Key("telemetry.sdk.version") +) + +// TelemetryDistroName returns an attribute KeyValue conforming to the +// "telemetry.distro.name" semantic conventions. It represents the name of the +// auto instrumentation agent or distribution, if used. +func TelemetryDistroName(val string) attribute.KeyValue { + return TelemetryDistroNameKey.String(val) +} + +// TelemetryDistroVersion returns an attribute KeyValue conforming to the +// "telemetry.distro.version" semantic conventions. It represents the version +// string of the auto instrumentation agent or distribution, if used. +func TelemetryDistroVersion(val string) attribute.KeyValue { + return TelemetryDistroVersionKey.String(val) +} + +// TelemetrySDKName returns an attribute KeyValue conforming to the +// "telemetry.sdk.name" semantic conventions. It represents the name of the +// telemetry SDK as defined above. +func TelemetrySDKName(val string) attribute.KeyValue { + return TelemetrySDKNameKey.String(val) +} + +// TelemetrySDKVersion returns an attribute KeyValue conforming to the +// "telemetry.sdk.version" semantic conventions. It represents the version string +// of the telemetry SDK. +func TelemetrySDKVersion(val string) attribute.KeyValue { + return TelemetrySDKVersionKey.String(val) +} + +// Enum values for telemetry.sdk.language +var ( + // cpp + // Stability: stable + TelemetrySDKLanguageCPP = TelemetrySDKLanguageKey.String("cpp") + // dotnet + // Stability: stable + TelemetrySDKLanguageDotnet = TelemetrySDKLanguageKey.String("dotnet") + // erlang + // Stability: stable + TelemetrySDKLanguageErlang = TelemetrySDKLanguageKey.String("erlang") + // go + // Stability: stable + TelemetrySDKLanguageGo = TelemetrySDKLanguageKey.String("go") + // java + // Stability: stable + TelemetrySDKLanguageJava = TelemetrySDKLanguageKey.String("java") + // nodejs + // Stability: stable + TelemetrySDKLanguageNodejs = TelemetrySDKLanguageKey.String("nodejs") + // php + // Stability: stable + TelemetrySDKLanguagePHP = TelemetrySDKLanguageKey.String("php") + // python + // Stability: stable + TelemetrySDKLanguagePython = TelemetrySDKLanguageKey.String("python") + // ruby + // Stability: stable + TelemetrySDKLanguageRuby = TelemetrySDKLanguageKey.String("ruby") + // rust + // Stability: stable + TelemetrySDKLanguageRust = TelemetrySDKLanguageKey.String("rust") + // swift + // Stability: stable + TelemetrySDKLanguageSwift = TelemetrySDKLanguageKey.String("swift") + // webjs + // Stability: stable + TelemetrySDKLanguageWebjs = TelemetrySDKLanguageKey.String("webjs") +) + +// Namespace: test +const ( + // TestCaseNameKey is the attribute Key conforming to the "test.case.name" + // semantic conventions. It represents the fully qualified human readable name + // of the [test case]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "org.example.TestCase1.test1", "example/tests/TestCase1.test1", + // "ExampleTestCase1_test1" + // + // [test case]: https://wikipedia.org/wiki/Test_case + TestCaseNameKey = attribute.Key("test.case.name") + + // TestCaseResultStatusKey is the attribute Key conforming to the + // "test.case.result.status" semantic conventions. It represents the status of + // the actual test case result from test execution. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pass", "fail" + TestCaseResultStatusKey = attribute.Key("test.case.result.status") + + // TestSuiteNameKey is the attribute Key conforming to the "test.suite.name" + // semantic conventions. It represents the human readable name of a [test suite] + // . + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TestSuite1" + // + // [test suite]: https://wikipedia.org/wiki/Test_suite + TestSuiteNameKey = attribute.Key("test.suite.name") + + // TestSuiteRunStatusKey is the attribute Key conforming to the + // "test.suite.run.status" semantic conventions. It represents the status of the + // test suite run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "skipped", "aborted", "timed_out", + // "in_progress" + TestSuiteRunStatusKey = attribute.Key("test.suite.run.status") +) + +// TestCaseName returns an attribute KeyValue conforming to the "test.case.name" +// semantic conventions. It represents the fully qualified human readable name of +// the [test case]. +// +// [test case]: https://wikipedia.org/wiki/Test_case +func TestCaseName(val string) attribute.KeyValue { + return TestCaseNameKey.String(val) +} + +// TestSuiteName returns an attribute KeyValue conforming to the +// "test.suite.name" semantic conventions. It represents the human readable name +// of a [test suite]. +// +// [test suite]: https://wikipedia.org/wiki/Test_suite +func TestSuiteName(val string) attribute.KeyValue { + return TestSuiteNameKey.String(val) +} + +// Enum values for test.case.result.status +var ( + // pass + // Stability: development + TestCaseResultStatusPass = TestCaseResultStatusKey.String("pass") + // fail + // Stability: development + TestCaseResultStatusFail = TestCaseResultStatusKey.String("fail") +) + +// Enum values for test.suite.run.status +var ( + // success + // Stability: development + TestSuiteRunStatusSuccess = TestSuiteRunStatusKey.String("success") + // failure + // Stability: development + TestSuiteRunStatusFailure = TestSuiteRunStatusKey.String("failure") + // skipped + // Stability: development + TestSuiteRunStatusSkipped = TestSuiteRunStatusKey.String("skipped") + // aborted + // Stability: development + TestSuiteRunStatusAborted = TestSuiteRunStatusKey.String("aborted") + // timed_out + // Stability: development + TestSuiteRunStatusTimedOut = TestSuiteRunStatusKey.String("timed_out") + // in_progress + // Stability: development + TestSuiteRunStatusInProgress = TestSuiteRunStatusKey.String("in_progress") +) + +// Namespace: thread +const ( + // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic + // conventions. It represents the current "managed" thread ID (as opposed to OS + // thread ID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + ThreadIDKey = attribute.Key("thread.id") + + // ThreadNameKey is the attribute Key conforming to the "thread.name" semantic + // conventions. It represents the current thread name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: main + ThreadNameKey = attribute.Key("thread.name") +) + +// ThreadID returns an attribute KeyValue conforming to the "thread.id" semantic +// conventions. It represents the current "managed" thread ID (as opposed to OS +// thread ID). +func ThreadID(val int) attribute.KeyValue { + return ThreadIDKey.Int(val) +} + +// ThreadName returns an attribute KeyValue conforming to the "thread.name" +// semantic conventions. It represents the current thread name. +func ThreadName(val string) attribute.KeyValue { + return ThreadNameKey.String(val) +} + +// Namespace: tls +const ( + // TLSCipherKey is the attribute Key conforming to the "tls.cipher" semantic + // conventions. It represents the string indicating the [cipher] used during the + // current connection. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TLS_RSA_WITH_3DES_EDE_CBC_SHA", + // "TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256" + // Note: The values allowed for `tls.cipher` MUST be one of the `Descriptions` + // of the [registered TLS Cipher Suits]. + // + // [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5 + // [registered TLS Cipher Suits]: https://www.iana.org/assignments/tls-parameters/tls-parameters.xhtml#table-tls-parameters-4 + TLSCipherKey = attribute.Key("tls.cipher") + + // TLSClientCertificateKey is the attribute Key conforming to the + // "tls.client.certificate" semantic conventions. It represents the pEM-encoded + // stand-alone certificate offered by the client. This is usually + // mutually-exclusive of `client.certificate_chain` since this value also exists + // in that list. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII..." + TLSClientCertificateKey = attribute.Key("tls.client.certificate") + + // TLSClientCertificateChainKey is the attribute Key conforming to the + // "tls.client.certificate_chain" semantic conventions. It represents the array + // of PEM-encoded certificates that make up the certificate chain offered by the + // client. This is usually mutually-exclusive of `client.certificate` since that + // value should be the first certificate in the chain. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII...", "MI..." + TLSClientCertificateChainKey = attribute.Key("tls.client.certificate_chain") + + // TLSClientHashMd5Key is the attribute Key conforming to the + // "tls.client.hash.md5" semantic conventions. It represents the certificate + // fingerprint using the MD5 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC" + TLSClientHashMd5Key = attribute.Key("tls.client.hash.md5") + + // TLSClientHashSha1Key is the attribute Key conforming to the + // "tls.client.hash.sha1" semantic conventions. It represents the certificate + // fingerprint using the SHA1 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A" + TLSClientHashSha1Key = attribute.Key("tls.client.hash.sha1") + + // TLSClientHashSha256Key is the attribute Key conforming to the + // "tls.client.hash.sha256" semantic conventions. It represents the certificate + // fingerprint using the SHA256 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0" + TLSClientHashSha256Key = attribute.Key("tls.client.hash.sha256") + + // TLSClientIssuerKey is the attribute Key conforming to the "tls.client.issuer" + // semantic conventions. It represents the distinguished name of [subject] of + // the issuer of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com" + // + // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 + TLSClientIssuerKey = attribute.Key("tls.client.issuer") + + // TLSClientJa3Key is the attribute Key conforming to the "tls.client.ja3" + // semantic conventions. It represents a hash that identifies clients based on + // how they perform an SSL/TLS handshake. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "d4e5b18d6b55c71272893221c96ba240" + TLSClientJa3Key = attribute.Key("tls.client.ja3") + + // TLSClientNotAfterKey is the attribute Key conforming to the + // "tls.client.not_after" semantic conventions. It represents the date/Time + // indicating when client certificate is no longer considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T00:00:00.000Z" + TLSClientNotAfterKey = attribute.Key("tls.client.not_after") + + // TLSClientNotBeforeKey is the attribute Key conforming to the + // "tls.client.not_before" semantic conventions. It represents the date/Time + // indicating when client certificate is first considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1970-01-01T00:00:00.000Z" + TLSClientNotBeforeKey = attribute.Key("tls.client.not_before") + + // TLSClientSubjectKey is the attribute Key conforming to the + // "tls.client.subject" semantic conventions. It represents the distinguished + // name of subject of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=myclient, OU=Documentation Team, DC=example, DC=com" + TLSClientSubjectKey = attribute.Key("tls.client.subject") + + // TLSClientSupportedCiphersKey is the attribute Key conforming to the + // "tls.client.supported_ciphers" semantic conventions. It represents the array + // of ciphers offered by the client during the client hello. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384", + // "TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384" + TLSClientSupportedCiphersKey = attribute.Key("tls.client.supported_ciphers") + + // TLSCurveKey is the attribute Key conforming to the "tls.curve" semantic + // conventions. It represents the string indicating the curve used for the given + // cipher, when applicable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "secp256r1" + TLSCurveKey = attribute.Key("tls.curve") + + // TLSEstablishedKey is the attribute Key conforming to the "tls.established" + // semantic conventions. It represents the boolean flag indicating if the TLS + // negotiation was successful and transitioned to an encrypted tunnel. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: true + TLSEstablishedKey = attribute.Key("tls.established") + + // TLSNextProtocolKey is the attribute Key conforming to the "tls.next_protocol" + // semantic conventions. It represents the string indicating the protocol being + // tunneled. Per the values in the [IANA registry], this string should be lower + // case. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "http/1.1" + // + // [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids + TLSNextProtocolKey = attribute.Key("tls.next_protocol") + + // TLSProtocolNameKey is the attribute Key conforming to the "tls.protocol.name" + // semantic conventions. It represents the normalized lowercase protocol name + // parsed from original string of the negotiated [SSL/TLS protocol version]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [SSL/TLS protocol version]: https://www.openssl.org/docs/man1.1.1/man3/SSL_get_version.html#RETURN-VALUES + TLSProtocolNameKey = attribute.Key("tls.protocol.name") + + // TLSProtocolVersionKey is the attribute Key conforming to the + // "tls.protocol.version" semantic conventions. It represents the numeric part + // of the version parsed from the original string of the negotiated + // [SSL/TLS protocol version]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.2", "3" + // + // [SSL/TLS protocol version]: https://www.openssl.org/docs/man1.1.1/man3/SSL_get_version.html#RETURN-VALUES + TLSProtocolVersionKey = attribute.Key("tls.protocol.version") + + // TLSResumedKey is the attribute Key conforming to the "tls.resumed" semantic + // conventions. It represents the boolean flag indicating if this TLS connection + // was resumed from an existing TLS negotiation. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: true + TLSResumedKey = attribute.Key("tls.resumed") + + // TLSServerCertificateKey is the attribute Key conforming to the + // "tls.server.certificate" semantic conventions. It represents the pEM-encoded + // stand-alone certificate offered by the server. This is usually + // mutually-exclusive of `server.certificate_chain` since this value also exists + // in that list. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII..." + TLSServerCertificateKey = attribute.Key("tls.server.certificate") + + // TLSServerCertificateChainKey is the attribute Key conforming to the + // "tls.server.certificate_chain" semantic conventions. It represents the array + // of PEM-encoded certificates that make up the certificate chain offered by the + // server. This is usually mutually-exclusive of `server.certificate` since that + // value should be the first certificate in the chain. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII...", "MI..." + TLSServerCertificateChainKey = attribute.Key("tls.server.certificate_chain") + + // TLSServerHashMd5Key is the attribute Key conforming to the + // "tls.server.hash.md5" semantic conventions. It represents the certificate + // fingerprint using the MD5 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC" + TLSServerHashMd5Key = attribute.Key("tls.server.hash.md5") + + // TLSServerHashSha1Key is the attribute Key conforming to the + // "tls.server.hash.sha1" semantic conventions. It represents the certificate + // fingerprint using the SHA1 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A" + TLSServerHashSha1Key = attribute.Key("tls.server.hash.sha1") + + // TLSServerHashSha256Key is the attribute Key conforming to the + // "tls.server.hash.sha256" semantic conventions. It represents the certificate + // fingerprint using the SHA256 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0" + TLSServerHashSha256Key = attribute.Key("tls.server.hash.sha256") + + // TLSServerIssuerKey is the attribute Key conforming to the "tls.server.issuer" + // semantic conventions. It represents the distinguished name of [subject] of + // the issuer of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com" + // + // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 + TLSServerIssuerKey = attribute.Key("tls.server.issuer") + + // TLSServerJa3sKey is the attribute Key conforming to the "tls.server.ja3s" + // semantic conventions. It represents a hash that identifies servers based on + // how they perform an SSL/TLS handshake. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "d4e5b18d6b55c71272893221c96ba240" + TLSServerJa3sKey = attribute.Key("tls.server.ja3s") + + // TLSServerNotAfterKey is the attribute Key conforming to the + // "tls.server.not_after" semantic conventions. It represents the date/Time + // indicating when server certificate is no longer considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T00:00:00.000Z" + TLSServerNotAfterKey = attribute.Key("tls.server.not_after") + + // TLSServerNotBeforeKey is the attribute Key conforming to the + // "tls.server.not_before" semantic conventions. It represents the date/Time + // indicating when server certificate is first considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1970-01-01T00:00:00.000Z" + TLSServerNotBeforeKey = attribute.Key("tls.server.not_before") + + // TLSServerSubjectKey is the attribute Key conforming to the + // "tls.server.subject" semantic conventions. It represents the distinguished + // name of subject of the x.509 certificate presented by the server. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=myserver, OU=Documentation Team, DC=example, DC=com" + TLSServerSubjectKey = attribute.Key("tls.server.subject") +) + +// TLSCipher returns an attribute KeyValue conforming to the "tls.cipher" +// semantic conventions. It represents the string indicating the [cipher] used +// during the current connection. +// +// [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5 +func TLSCipher(val string) attribute.KeyValue { + return TLSCipherKey.String(val) +} + +// TLSClientCertificate returns an attribute KeyValue conforming to the +// "tls.client.certificate" semantic conventions. It represents the pEM-encoded +// stand-alone certificate offered by the client. This is usually +// mutually-exclusive of `client.certificate_chain` since this value also exists +// in that list. +func TLSClientCertificate(val string) attribute.KeyValue { + return TLSClientCertificateKey.String(val) +} + +// TLSClientCertificateChain returns an attribute KeyValue conforming to the +// "tls.client.certificate_chain" semantic conventions. It represents the array +// of PEM-encoded certificates that make up the certificate chain offered by the +// client. This is usually mutually-exclusive of `client.certificate` since that +// value should be the first certificate in the chain. +func TLSClientCertificateChain(val ...string) attribute.KeyValue { + return TLSClientCertificateChainKey.StringSlice(val) +} + +// TLSClientHashMd5 returns an attribute KeyValue conforming to the +// "tls.client.hash.md5" semantic conventions. It represents the certificate +// fingerprint using the MD5 digest of DER-encoded version of certificate offered +// by the client. For consistency with other hash values, this value should be +// formatted as an uppercase hash. +func TLSClientHashMd5(val string) attribute.KeyValue { + return TLSClientHashMd5Key.String(val) +} + +// TLSClientHashSha1 returns an attribute KeyValue conforming to the +// "tls.client.hash.sha1" semantic conventions. It represents the certificate +// fingerprint using the SHA1 digest of DER-encoded version of certificate +// offered by the client. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSClientHashSha1(val string) attribute.KeyValue { + return TLSClientHashSha1Key.String(val) +} + +// TLSClientHashSha256 returns an attribute KeyValue conforming to the +// "tls.client.hash.sha256" semantic conventions. It represents the certificate +// fingerprint using the SHA256 digest of DER-encoded version of certificate +// offered by the client. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSClientHashSha256(val string) attribute.KeyValue { + return TLSClientHashSha256Key.String(val) +} + +// TLSClientIssuer returns an attribute KeyValue conforming to the +// "tls.client.issuer" semantic conventions. It represents the distinguished name +// of [subject] of the issuer of the x.509 certificate presented by the client. +// +// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 +func TLSClientIssuer(val string) attribute.KeyValue { + return TLSClientIssuerKey.String(val) +} + +// TLSClientJa3 returns an attribute KeyValue conforming to the "tls.client.ja3" +// semantic conventions. It represents a hash that identifies clients based on +// how they perform an SSL/TLS handshake. +func TLSClientJa3(val string) attribute.KeyValue { + return TLSClientJa3Key.String(val) +} + +// TLSClientNotAfter returns an attribute KeyValue conforming to the +// "tls.client.not_after" semantic conventions. It represents the date/Time +// indicating when client certificate is no longer considered valid. +func TLSClientNotAfter(val string) attribute.KeyValue { + return TLSClientNotAfterKey.String(val) +} + +// TLSClientNotBefore returns an attribute KeyValue conforming to the +// "tls.client.not_before" semantic conventions. It represents the date/Time +// indicating when client certificate is first considered valid. +func TLSClientNotBefore(val string) attribute.KeyValue { + return TLSClientNotBeforeKey.String(val) +} + +// TLSClientSubject returns an attribute KeyValue conforming to the +// "tls.client.subject" semantic conventions. It represents the distinguished +// name of subject of the x.509 certificate presented by the client. +func TLSClientSubject(val string) attribute.KeyValue { + return TLSClientSubjectKey.String(val) +} + +// TLSClientSupportedCiphers returns an attribute KeyValue conforming to the +// "tls.client.supported_ciphers" semantic conventions. It represents the array +// of ciphers offered by the client during the client hello. +func TLSClientSupportedCiphers(val ...string) attribute.KeyValue { + return TLSClientSupportedCiphersKey.StringSlice(val) +} + +// TLSCurve returns an attribute KeyValue conforming to the "tls.curve" semantic +// conventions. It represents the string indicating the curve used for the given +// cipher, when applicable. +func TLSCurve(val string) attribute.KeyValue { + return TLSCurveKey.String(val) +} + +// TLSEstablished returns an attribute KeyValue conforming to the +// "tls.established" semantic conventions. It represents the boolean flag +// indicating if the TLS negotiation was successful and transitioned to an +// encrypted tunnel. +func TLSEstablished(val bool) attribute.KeyValue { + return TLSEstablishedKey.Bool(val) +} + +// TLSNextProtocol returns an attribute KeyValue conforming to the +// "tls.next_protocol" semantic conventions. It represents the string indicating +// the protocol being tunneled. Per the values in the [IANA registry], this +// string should be lower case. +// +// [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids +func TLSNextProtocol(val string) attribute.KeyValue { + return TLSNextProtocolKey.String(val) +} + +// TLSProtocolVersion returns an attribute KeyValue conforming to the +// "tls.protocol.version" semantic conventions. It represents the numeric part of +// the version parsed from the original string of the negotiated +// [SSL/TLS protocol version]. +// +// [SSL/TLS protocol version]: https://www.openssl.org/docs/man1.1.1/man3/SSL_get_version.html#RETURN-VALUES +func TLSProtocolVersion(val string) attribute.KeyValue { + return TLSProtocolVersionKey.String(val) +} + +// TLSResumed returns an attribute KeyValue conforming to the "tls.resumed" +// semantic conventions. It represents the boolean flag indicating if this TLS +// connection was resumed from an existing TLS negotiation. +func TLSResumed(val bool) attribute.KeyValue { + return TLSResumedKey.Bool(val) +} + +// TLSServerCertificate returns an attribute KeyValue conforming to the +// "tls.server.certificate" semantic conventions. It represents the pEM-encoded +// stand-alone certificate offered by the server. This is usually +// mutually-exclusive of `server.certificate_chain` since this value also exists +// in that list. +func TLSServerCertificate(val string) attribute.KeyValue { + return TLSServerCertificateKey.String(val) +} + +// TLSServerCertificateChain returns an attribute KeyValue conforming to the +// "tls.server.certificate_chain" semantic conventions. It represents the array +// of PEM-encoded certificates that make up the certificate chain offered by the +// server. This is usually mutually-exclusive of `server.certificate` since that +// value should be the first certificate in the chain. +func TLSServerCertificateChain(val ...string) attribute.KeyValue { + return TLSServerCertificateChainKey.StringSlice(val) +} + +// TLSServerHashMd5 returns an attribute KeyValue conforming to the +// "tls.server.hash.md5" semantic conventions. It represents the certificate +// fingerprint using the MD5 digest of DER-encoded version of certificate offered +// by the server. For consistency with other hash values, this value should be +// formatted as an uppercase hash. +func TLSServerHashMd5(val string) attribute.KeyValue { + return TLSServerHashMd5Key.String(val) +} + +// TLSServerHashSha1 returns an attribute KeyValue conforming to the +// "tls.server.hash.sha1" semantic conventions. It represents the certificate +// fingerprint using the SHA1 digest of DER-encoded version of certificate +// offered by the server. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSServerHashSha1(val string) attribute.KeyValue { + return TLSServerHashSha1Key.String(val) +} + +// TLSServerHashSha256 returns an attribute KeyValue conforming to the +// "tls.server.hash.sha256" semantic conventions. It represents the certificate +// fingerprint using the SHA256 digest of DER-encoded version of certificate +// offered by the server. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSServerHashSha256(val string) attribute.KeyValue { + return TLSServerHashSha256Key.String(val) +} + +// TLSServerIssuer returns an attribute KeyValue conforming to the +// "tls.server.issuer" semantic conventions. It represents the distinguished name +// of [subject] of the issuer of the x.509 certificate presented by the client. +// +// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 +func TLSServerIssuer(val string) attribute.KeyValue { + return TLSServerIssuerKey.String(val) +} + +// TLSServerJa3s returns an attribute KeyValue conforming to the +// "tls.server.ja3s" semantic conventions. It represents a hash that identifies +// servers based on how they perform an SSL/TLS handshake. +func TLSServerJa3s(val string) attribute.KeyValue { + return TLSServerJa3sKey.String(val) +} + +// TLSServerNotAfter returns an attribute KeyValue conforming to the +// "tls.server.not_after" semantic conventions. It represents the date/Time +// indicating when server certificate is no longer considered valid. +func TLSServerNotAfter(val string) attribute.KeyValue { + return TLSServerNotAfterKey.String(val) +} + +// TLSServerNotBefore returns an attribute KeyValue conforming to the +// "tls.server.not_before" semantic conventions. It represents the date/Time +// indicating when server certificate is first considered valid. +func TLSServerNotBefore(val string) attribute.KeyValue { + return TLSServerNotBeforeKey.String(val) +} + +// TLSServerSubject returns an attribute KeyValue conforming to the +// "tls.server.subject" semantic conventions. It represents the distinguished +// name of subject of the x.509 certificate presented by the server. +func TLSServerSubject(val string) attribute.KeyValue { + return TLSServerSubjectKey.String(val) +} + +// Enum values for tls.protocol.name +var ( + // ssl + // Stability: development + TLSProtocolNameSsl = TLSProtocolNameKey.String("ssl") + // tls + // Stability: development + TLSProtocolNameTLS = TLSProtocolNameKey.String("tls") +) + +// Namespace: url +const ( + // URLDomainKey is the attribute Key conforming to the "url.domain" semantic + // conventions. It represents the domain extracted from the `url.full`, such as + // "opentelemetry.io". + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "www.foo.bar", "opentelemetry.io", "3.12.167.2", + // "[1080:0:0:0:8:800:200C:417A]" + // Note: In some cases a URL may refer to an IP and/or port directly, without a + // domain name. In this case, the IP address would go to the domain field. If + // the URL contains a [literal IPv6 address] enclosed by `[` and `]`, the `[` + // and `]` characters should also be captured in the domain field. + // + // [literal IPv6 address]: https://www.rfc-editor.org/rfc/rfc2732#section-2 + URLDomainKey = attribute.Key("url.domain") + + // URLExtensionKey is the attribute Key conforming to the "url.extension" + // semantic conventions. It represents the file extension extracted from the + // `url.full`, excluding the leading dot. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "png", "gz" + // Note: The file extension is only set if it exists, as not every url has a + // file extension. When the file name has multiple extensions `example.tar.gz`, + // only the last one should be captured `gz`, not `tar.gz`. + URLExtensionKey = attribute.Key("url.extension") + + // URLFragmentKey is the attribute Key conforming to the "url.fragment" semantic + // conventions. It represents the [URI fragment] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "SemConv" + // + // [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5 + URLFragmentKey = attribute.Key("url.fragment") + + // URLFullKey is the attribute Key conforming to the "url.full" semantic + // conventions. It represents the absolute URL describing a network resource + // according to [RFC3986]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", "//localhost" + // Note: For network calls, URL usually has + // `scheme://host[:port][path][?query][#fragment]` format, where the fragment + // is not transmitted over HTTP, but if it is known, it SHOULD be included + // nevertheless. + // + // `url.full` MUST NOT contain credentials passed via URL in form of + // `https://username:password@www.example.com/`. + // In such case username and password SHOULD be redacted and attribute's value + // SHOULD be `https://REDACTED:REDACTED@www.example.com/`. + // + // `url.full` SHOULD capture the absolute URL when it is available (or can be + // reconstructed). + // + // Sensitive content provided in `url.full` SHOULD be scrubbed when + // instrumentations can identify it. + // + // + // Query string values for the following keys SHOULD be redacted by default and + // replaced by the + // value `REDACTED`: + // + // - [`AWSAccessKeyId`] + // - [`Signature`] + // - [`sig`] + // - [`X-Goog-Signature`] + // + // This list is subject to change over time. + // + // When a query string value is redacted, the query string key SHOULD still be + // preserved, e.g. + // `https://www.example.com/path?color=blue&sig=REDACTED`. + // + // [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986 + // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token + // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls + URLFullKey = attribute.Key("url.full") + + // URLOriginalKey is the attribute Key conforming to the "url.original" semantic + // conventions. It represents the unmodified original URL as seen in the event + // source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", + // "search?q=OpenTelemetry" + // Note: In network monitoring, the observed URL may be a full URL, whereas in + // access logs, the URL is often just represented as a path. This field is meant + // to represent the URL as it was observed, complete or not. + // `url.original` might contain credentials passed via URL in form of + // `https://username:password@www.example.com/`. In such case password and + // username SHOULD NOT be redacted and attribute's value SHOULD remain the same. + URLOriginalKey = attribute.Key("url.original") + + // URLPathKey is the attribute Key conforming to the "url.path" semantic + // conventions. It represents the [URI path] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "/search" + // Note: Sensitive content provided in `url.path` SHOULD be scrubbed when + // instrumentations can identify it. + // + // [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3 + URLPathKey = attribute.Key("url.path") + + // URLPortKey is the attribute Key conforming to the "url.port" semantic + // conventions. It represents the port extracted from the `url.full`. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 443 + URLPortKey = attribute.Key("url.port") + + // URLQueryKey is the attribute Key conforming to the "url.query" semantic + // conventions. It represents the [URI query] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "q=OpenTelemetry" + // Note: Sensitive content provided in `url.query` SHOULD be scrubbed when + // instrumentations can identify it. + // + // + // Query string values for the following keys SHOULD be redacted by default and + // replaced by the value `REDACTED`: + // + // - [`AWSAccessKeyId`] + // - [`Signature`] + // - [`sig`] + // - [`X-Goog-Signature`] + // + // This list is subject to change over time. + // + // When a query string value is redacted, the query string key SHOULD still be + // preserved, e.g. + // `q=OpenTelemetry&sig=REDACTED`. + // + // [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4 + // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token + // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls + URLQueryKey = attribute.Key("url.query") + + // URLRegisteredDomainKey is the attribute Key conforming to the + // "url.registered_domain" semantic conventions. It represents the highest + // registered url domain, stripped of the subdomain. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "example.com", "foo.co.uk" + // Note: This value can be determined precisely with the [public suffix list]. + // For example, the registered domain for `foo.example.com` is `example.com`. + // Trying to approximate this by simply taking the last two labels will not work + // well for TLDs such as `co.uk`. + // + // [public suffix list]: http://publicsuffix.org + URLRegisteredDomainKey = attribute.Key("url.registered_domain") + + // URLSchemeKey is the attribute Key conforming to the "url.scheme" semantic + // conventions. It represents the [URI scheme] component identifying the used + // protocol. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "https", "ftp", "telnet" + // + // [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1 + URLSchemeKey = attribute.Key("url.scheme") + + // URLSubdomainKey is the attribute Key conforming to the "url.subdomain" + // semantic conventions. It represents the subdomain portion of a fully + // qualified domain name includes all of the names except the host name under + // the registered_domain. In a partially qualified domain, or if the + // qualification level of the full name cannot be determined, subdomain contains + // all of the names below the registered domain. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "east", "sub2.sub1" + // Note: The subdomain portion of `www.east.mydomain.co.uk` is `east`. If the + // domain has multiple levels of subdomain, such as `sub2.sub1.example.com`, the + // subdomain field should contain `sub2.sub1`, with no trailing period. + URLSubdomainKey = attribute.Key("url.subdomain") + + // URLTemplateKey is the attribute Key conforming to the "url.template" semantic + // conventions. It represents the low-cardinality template of an + // [absolute path reference]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/users/{id}", "/users/:id", "/users?id={id}" + // + // [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2 + URLTemplateKey = attribute.Key("url.template") + + // URLTopLevelDomainKey is the attribute Key conforming to the + // "url.top_level_domain" semantic conventions. It represents the effective top + // level domain (eTLD), also known as the domain suffix, is the last part of the + // domain name. For example, the top level domain for example.com is `com`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "com", "co.uk" + // Note: This value can be determined precisely with the [public suffix list]. + // + // [public suffix list]: http://publicsuffix.org + URLTopLevelDomainKey = attribute.Key("url.top_level_domain") +) + +// URLDomain returns an attribute KeyValue conforming to the "url.domain" +// semantic conventions. It represents the domain extracted from the `url.full`, +// such as "opentelemetry.io". +func URLDomain(val string) attribute.KeyValue { + return URLDomainKey.String(val) +} + +// URLExtension returns an attribute KeyValue conforming to the "url.extension" +// semantic conventions. It represents the file extension extracted from the +// `url.full`, excluding the leading dot. +func URLExtension(val string) attribute.KeyValue { + return URLExtensionKey.String(val) +} + +// URLFragment returns an attribute KeyValue conforming to the "url.fragment" +// semantic conventions. It represents the [URI fragment] component. +// +// [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5 +func URLFragment(val string) attribute.KeyValue { + return URLFragmentKey.String(val) +} + +// URLFull returns an attribute KeyValue conforming to the "url.full" semantic +// conventions. It represents the absolute URL describing a network resource +// according to [RFC3986]. +// +// [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986 +func URLFull(val string) attribute.KeyValue { + return URLFullKey.String(val) +} + +// URLOriginal returns an attribute KeyValue conforming to the "url.original" +// semantic conventions. It represents the unmodified original URL as seen in the +// event source. +func URLOriginal(val string) attribute.KeyValue { + return URLOriginalKey.String(val) +} + +// URLPath returns an attribute KeyValue conforming to the "url.path" semantic +// conventions. It represents the [URI path] component. +// +// [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3 +func URLPath(val string) attribute.KeyValue { + return URLPathKey.String(val) +} + +// URLPort returns an attribute KeyValue conforming to the "url.port" semantic +// conventions. It represents the port extracted from the `url.full`. +func URLPort(val int) attribute.KeyValue { + return URLPortKey.Int(val) +} + +// URLQuery returns an attribute KeyValue conforming to the "url.query" semantic +// conventions. It represents the [URI query] component. +// +// [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4 +func URLQuery(val string) attribute.KeyValue { + return URLQueryKey.String(val) +} + +// URLRegisteredDomain returns an attribute KeyValue conforming to the +// "url.registered_domain" semantic conventions. It represents the highest +// registered url domain, stripped of the subdomain. +func URLRegisteredDomain(val string) attribute.KeyValue { + return URLRegisteredDomainKey.String(val) +} + +// URLScheme returns an attribute KeyValue conforming to the "url.scheme" +// semantic conventions. It represents the [URI scheme] component identifying the +// used protocol. +// +// [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1 +func URLScheme(val string) attribute.KeyValue { + return URLSchemeKey.String(val) +} + +// URLSubdomain returns an attribute KeyValue conforming to the "url.subdomain" +// semantic conventions. It represents the subdomain portion of a fully qualified +// domain name includes all of the names except the host name under the +// registered_domain. In a partially qualified domain, or if the qualification +// level of the full name cannot be determined, subdomain contains all of the +// names below the registered domain. +func URLSubdomain(val string) attribute.KeyValue { + return URLSubdomainKey.String(val) +} + +// URLTemplate returns an attribute KeyValue conforming to the "url.template" +// semantic conventions. It represents the low-cardinality template of an +// [absolute path reference]. +// +// [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2 +func URLTemplate(val string) attribute.KeyValue { + return URLTemplateKey.String(val) +} + +// URLTopLevelDomain returns an attribute KeyValue conforming to the +// "url.top_level_domain" semantic conventions. It represents the effective top +// level domain (eTLD), also known as the domain suffix, is the last part of the +// domain name. For example, the top level domain for example.com is `com`. +func URLTopLevelDomain(val string) attribute.KeyValue { + return URLTopLevelDomainKey.String(val) +} + +// Namespace: user +const ( + // UserEmailKey is the attribute Key conforming to the "user.email" semantic + // conventions. It represents the user email address. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a.einstein@example.com" + UserEmailKey = attribute.Key("user.email") + + // UserFullNameKey is the attribute Key conforming to the "user.full_name" + // semantic conventions. It represents the user's full name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Albert Einstein" + UserFullNameKey = attribute.Key("user.full_name") + + // UserHashKey is the attribute Key conforming to the "user.hash" semantic + // conventions. It represents the unique user hash to correlate information for + // a user in anonymized form. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "364fc68eaf4c8acec74a4e52d7d1feaa" + // Note: Useful if `user.id` or `user.name` contain confidential information and + // cannot be used. + UserHashKey = attribute.Key("user.hash") + + // UserIDKey is the attribute Key conforming to the "user.id" semantic + // conventions. It represents the unique identifier of the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "S-1-5-21-202424912787-2692429404-2351956786-1000" + UserIDKey = attribute.Key("user.id") + + // UserNameKey is the attribute Key conforming to the "user.name" semantic + // conventions. It represents the short name or login/username of the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a.einstein" + UserNameKey = attribute.Key("user.name") + + // UserRolesKey is the attribute Key conforming to the "user.roles" semantic + // conventions. It represents the array of user roles at the time of the event. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "admin", "reporting_user" + UserRolesKey = attribute.Key("user.roles") +) + +// UserEmail returns an attribute KeyValue conforming to the "user.email" +// semantic conventions. It represents the user email address. +func UserEmail(val string) attribute.KeyValue { + return UserEmailKey.String(val) +} + +// UserFullName returns an attribute KeyValue conforming to the "user.full_name" +// semantic conventions. It represents the user's full name. +func UserFullName(val string) attribute.KeyValue { + return UserFullNameKey.String(val) +} + +// UserHash returns an attribute KeyValue conforming to the "user.hash" semantic +// conventions. It represents the unique user hash to correlate information for a +// user in anonymized form. +func UserHash(val string) attribute.KeyValue { + return UserHashKey.String(val) +} + +// UserID returns an attribute KeyValue conforming to the "user.id" semantic +// conventions. It represents the unique identifier of the user. +func UserID(val string) attribute.KeyValue { + return UserIDKey.String(val) +} + +// UserName returns an attribute KeyValue conforming to the "user.name" semantic +// conventions. It represents the short name or login/username of the user. +func UserName(val string) attribute.KeyValue { + return UserNameKey.String(val) +} + +// UserRoles returns an attribute KeyValue conforming to the "user.roles" +// semantic conventions. It represents the array of user roles at the time of the +// event. +func UserRoles(val ...string) attribute.KeyValue { + return UserRolesKey.StringSlice(val) +} + +// Namespace: user_agent +const ( + // UserAgentNameKey is the attribute Key conforming to the "user_agent.name" + // semantic conventions. It represents the name of the user-agent extracted from + // original. Usually refers to the browser's name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Safari", "YourApp" + // Note: [Example] of extracting browser's name from original string. In the + // case of using a user-agent for non-browser products, such as microservices + // with multiple names/versions inside the `user_agent.original`, the most + // significant name SHOULD be selected. In such a scenario it should align with + // `user_agent.version` + // + // [Example]: https://www.whatsmyua.info + UserAgentNameKey = attribute.Key("user_agent.name") + + // UserAgentOriginalKey is the attribute Key conforming to the + // "user_agent.original" semantic conventions. It represents the value of the + // [HTTP User-Agent] header sent by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "CERN-LineMode/2.15 libwww/2.17b3", "Mozilla/5.0 (iPhone; CPU + // iPhone OS 14_7_1 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) + // Version/14.1.2 Mobile/15E148 Safari/604.1", "YourApp/1.0.0 + // grpc-java-okhttp/1.27.2" + // + // [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent + UserAgentOriginalKey = attribute.Key("user_agent.original") + + // UserAgentSyntheticTypeKey is the attribute Key conforming to the + // "user_agent.synthetic.type" semantic conventions. It represents the specifies + // the category of synthetic traffic, such as tests or bots. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This attribute MAY be derived from the contents of the + // `user_agent.original` attribute. Components that populate the attribute are + // responsible for determining what they consider to be synthetic bot or test + // traffic. This attribute can either be set for self-identification purposes, + // or on telemetry detected to be generated as a result of a synthetic request. + // This attribute is useful for distinguishing between genuine client traffic + // and synthetic traffic generated by bots or tests. + UserAgentSyntheticTypeKey = attribute.Key("user_agent.synthetic.type") + + // UserAgentVersionKey is the attribute Key conforming to the + // "user_agent.version" semantic conventions. It represents the version of the + // user-agent extracted from original. Usually refers to the browser's version. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.1.2", "1.0.0" + // Note: [Example] of extracting browser's version from original string. In the + // case of using a user-agent for non-browser products, such as microservices + // with multiple names/versions inside the `user_agent.original`, the most + // significant version SHOULD be selected. In such a scenario it should align + // with `user_agent.name` + // + // [Example]: https://www.whatsmyua.info + UserAgentVersionKey = attribute.Key("user_agent.version") +) + +// UserAgentName returns an attribute KeyValue conforming to the +// "user_agent.name" semantic conventions. It represents the name of the +// user-agent extracted from original. Usually refers to the browser's name. +func UserAgentName(val string) attribute.KeyValue { + return UserAgentNameKey.String(val) +} + +// UserAgentOriginal returns an attribute KeyValue conforming to the +// "user_agent.original" semantic conventions. It represents the value of the +// [HTTP User-Agent] header sent by the client. +// +// [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent +func UserAgentOriginal(val string) attribute.KeyValue { + return UserAgentOriginalKey.String(val) +} + +// UserAgentVersion returns an attribute KeyValue conforming to the +// "user_agent.version" semantic conventions. It represents the version of the +// user-agent extracted from original. Usually refers to the browser's version. +func UserAgentVersion(val string) attribute.KeyValue { + return UserAgentVersionKey.String(val) +} + +// Enum values for user_agent.synthetic.type +var ( + // Bot source. + // Stability: development + UserAgentSyntheticTypeBot = UserAgentSyntheticTypeKey.String("bot") + // Synthetic test source. + // Stability: development + UserAgentSyntheticTypeTest = UserAgentSyntheticTypeKey.String("test") +) + +// Namespace: vcs +const ( + // VCSChangeIDKey is the attribute Key conforming to the "vcs.change.id" + // semantic conventions. It represents the ID of the change (pull request/merge + // request/changelist) if applicable. This is usually a unique (within + // repository) identifier generated by the VCS system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123" + VCSChangeIDKey = attribute.Key("vcs.change.id") + + // VCSChangeStateKey is the attribute Key conforming to the "vcs.change.state" + // semantic conventions. It represents the state of the change (pull + // request/merge request/changelist). + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "open", "closed", "merged" + VCSChangeStateKey = attribute.Key("vcs.change.state") + + // VCSChangeTitleKey is the attribute Key conforming to the "vcs.change.title" + // semantic conventions. It represents the human readable title of the change + // (pull request/merge request/changelist). This title is often a brief summary + // of the change and may get merged in to a ref as the commit summary. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Fixes broken thing", "feat: add my new feature", "[chore] update + // dependency" + VCSChangeTitleKey = attribute.Key("vcs.change.title") + + // VCSLineChangeTypeKey is the attribute Key conforming to the + // "vcs.line_change.type" semantic conventions. It represents the type of line + // change being measured on a branch or change. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "added", "removed" + VCSLineChangeTypeKey = attribute.Key("vcs.line_change.type") + + // VCSRefBaseNameKey is the attribute Key conforming to the "vcs.ref.base.name" + // semantic conventions. It represents the name of the [reference] such as + // **branch** or **tag** in the repository. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-feature-branch", "tag-1-test" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefBaseNameKey = attribute.Key("vcs.ref.base.name") + + // VCSRefBaseRevisionKey is the attribute Key conforming to the + // "vcs.ref.base.revision" semantic conventions. It represents the revision, + // literally [revised version], The revision most often refers to a commit + // object in Git, or a revision number in SVN. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc", + // "main", "123", "HEAD" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. The + // revision can be a full [hash value (see + // glossary)], + // of the recorded change to a ref within a repository pointing to a + // commit [commit] object. It does + // not necessarily have to be a hash; it can simply define a [revision + // number] + // which is an integer that is monotonically increasing. In cases where + // it is identical to the `ref.base.name`, it SHOULD still be included. + // It is up to the implementer to decide which value to set as the + // revision based on the VCS system and situational context. + // + // [revised version]: https://www.merriam-webster.com/dictionary/revision + // [hash value (see + // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [commit]: https://git-scm.com/docs/git-commit + // [revision + // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html + VCSRefBaseRevisionKey = attribute.Key("vcs.ref.base.revision") + + // VCSRefBaseTypeKey is the attribute Key conforming to the "vcs.ref.base.type" + // semantic conventions. It represents the type of the [reference] in the + // repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefBaseTypeKey = attribute.Key("vcs.ref.base.type") + + // VCSRefHeadNameKey is the attribute Key conforming to the "vcs.ref.head.name" + // semantic conventions. It represents the name of the [reference] such as + // **branch** or **tag** in the repository. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-feature-branch", "tag-1-test" + // Note: `head` refers to where you are right now; the current reference at a + // given time. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefHeadNameKey = attribute.Key("vcs.ref.head.name") + + // VCSRefHeadRevisionKey is the attribute Key conforming to the + // "vcs.ref.head.revision" semantic conventions. It represents the revision, + // literally [revised version], The revision most often refers to a commit + // object in Git, or a revision number in SVN. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc", + // "main", "123", "HEAD" + // Note: `head` refers to where you are right now; the current reference at a + // given time.The revision can be a full [hash value (see + // glossary)], + // of the recorded change to a ref within a repository pointing to a + // commit [commit] object. It does + // not necessarily have to be a hash; it can simply define a [revision + // number] + // which is an integer that is monotonically increasing. In cases where + // it is identical to the `ref.head.name`, it SHOULD still be included. + // It is up to the implementer to decide which value to set as the + // revision based on the VCS system and situational context. + // + // [revised version]: https://www.merriam-webster.com/dictionary/revision + // [hash value (see + // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [commit]: https://git-scm.com/docs/git-commit + // [revision + // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html + VCSRefHeadRevisionKey = attribute.Key("vcs.ref.head.revision") + + // VCSRefHeadTypeKey is the attribute Key conforming to the "vcs.ref.head.type" + // semantic conventions. It represents the type of the [reference] in the + // repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // Note: `head` refers to where you are right now; the current reference at a + // given time. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefHeadTypeKey = attribute.Key("vcs.ref.head.type") + + // VCSRefTypeKey is the attribute Key conforming to the "vcs.ref.type" semantic + // conventions. It represents the type of the [reference] in the repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefTypeKey = attribute.Key("vcs.ref.type") + + // VCSRepositoryNameKey is the attribute Key conforming to the + // "vcs.repository.name" semantic conventions. It represents the human readable + // name of the repository. It SHOULD NOT include any additional identifier like + // Group/SubGroup in GitLab or organization in GitHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "semantic-conventions", "my-cool-repo" + // Note: Due to it only being the name, it can clash with forks of the same + // repository if collecting telemetry across multiple orgs or groups in + // the same backends. + VCSRepositoryNameKey = attribute.Key("vcs.repository.name") + + // VCSRepositoryURLFullKey is the attribute Key conforming to the + // "vcs.repository.url.full" semantic conventions. It represents the + // [canonical URL] of the repository providing the complete HTTP(S) address in + // order to locate and identify the repository through a browser. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/opentelemetry/open-telemetry-collector-contrib", + // "https://gitlab.com/my-org/my-project/my-projects-project/repo" + // Note: In Git Version Control Systems, the canonical URL SHOULD NOT include + // the `.git` extension. + // + // [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical. + VCSRepositoryURLFullKey = attribute.Key("vcs.repository.url.full") + + // VCSRevisionDeltaDirectionKey is the attribute Key conforming to the + // "vcs.revision_delta.direction" semantic conventions. It represents the type + // of revision comparison. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ahead", "behind" + VCSRevisionDeltaDirectionKey = attribute.Key("vcs.revision_delta.direction") +) + +// VCSChangeID returns an attribute KeyValue conforming to the "vcs.change.id" +// semantic conventions. It represents the ID of the change (pull request/merge +// request/changelist) if applicable. This is usually a unique (within +// repository) identifier generated by the VCS system. +func VCSChangeID(val string) attribute.KeyValue { + return VCSChangeIDKey.String(val) +} + +// VCSChangeTitle returns an attribute KeyValue conforming to the +// "vcs.change.title" semantic conventions. It represents the human readable +// title of the change (pull request/merge request/changelist). This title is +// often a brief summary of the change and may get merged in to a ref as the +// commit summary. +func VCSChangeTitle(val string) attribute.KeyValue { + return VCSChangeTitleKey.String(val) +} + +// VCSRefBaseName returns an attribute KeyValue conforming to the +// "vcs.ref.base.name" semantic conventions. It represents the name of the +// [reference] such as **branch** or **tag** in the repository. +// +// [reference]: https://git-scm.com/docs/gitglossary#def_ref +func VCSRefBaseName(val string) attribute.KeyValue { + return VCSRefBaseNameKey.String(val) +} + +// VCSRefBaseRevision returns an attribute KeyValue conforming to the +// "vcs.ref.base.revision" semantic conventions. It represents the revision, +// literally [revised version], The revision most often refers to a commit object +// in Git, or a revision number in SVN. +// +// [revised version]: https://www.merriam-webster.com/dictionary/revision +func VCSRefBaseRevision(val string) attribute.KeyValue { + return VCSRefBaseRevisionKey.String(val) +} + +// VCSRefHeadName returns an attribute KeyValue conforming to the +// "vcs.ref.head.name" semantic conventions. It represents the name of the +// [reference] such as **branch** or **tag** in the repository. +// +// [reference]: https://git-scm.com/docs/gitglossary#def_ref +func VCSRefHeadName(val string) attribute.KeyValue { + return VCSRefHeadNameKey.String(val) +} + +// VCSRefHeadRevision returns an attribute KeyValue conforming to the +// "vcs.ref.head.revision" semantic conventions. It represents the revision, +// literally [revised version], The revision most often refers to a commit object +// in Git, or a revision number in SVN. +// +// [revised version]: https://www.merriam-webster.com/dictionary/revision +func VCSRefHeadRevision(val string) attribute.KeyValue { + return VCSRefHeadRevisionKey.String(val) +} + +// VCSRepositoryName returns an attribute KeyValue conforming to the +// "vcs.repository.name" semantic conventions. It represents the human readable +// name of the repository. It SHOULD NOT include any additional identifier like +// Group/SubGroup in GitLab or organization in GitHub. +func VCSRepositoryName(val string) attribute.KeyValue { + return VCSRepositoryNameKey.String(val) +} + +// VCSRepositoryURLFull returns an attribute KeyValue conforming to the +// "vcs.repository.url.full" semantic conventions. It represents the +// [canonical URL] of the repository providing the complete HTTP(S) address in +// order to locate and identify the repository through a browser. +// +// [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical. +func VCSRepositoryURLFull(val string) attribute.KeyValue { + return VCSRepositoryURLFullKey.String(val) +} + +// Enum values for vcs.change.state +var ( + // Open means the change is currently active and under review. It hasn't been + // merged into the target branch yet, and it's still possible to make changes or + // add comments. + // Stability: development + VCSChangeStateOpen = VCSChangeStateKey.String("open") + // WIP (work-in-progress, draft) means the change is still in progress and not + // yet ready for a full review. It might still undergo significant changes. + // Stability: development + VCSChangeStateWip = VCSChangeStateKey.String("wip") + // Closed means the merge request has been closed without merging. This can + // happen for various reasons, such as the changes being deemed unnecessary, the + // issue being resolved in another way, or the author deciding to withdraw the + // request. + // Stability: development + VCSChangeStateClosed = VCSChangeStateKey.String("closed") + // Merged indicates that the change has been successfully integrated into the + // target codebase. + // Stability: development + VCSChangeStateMerged = VCSChangeStateKey.String("merged") +) + +// Enum values for vcs.line_change.type +var ( + // How many lines were added. + // Stability: development + VCSLineChangeTypeAdded = VCSLineChangeTypeKey.String("added") + // How many lines were removed. + // Stability: development + VCSLineChangeTypeRemoved = VCSLineChangeTypeKey.String("removed") +) + +// Enum values for vcs.ref.base.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefBaseTypeBranch = VCSRefBaseTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefBaseTypeTag = VCSRefBaseTypeKey.String("tag") +) + +// Enum values for vcs.ref.head.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefHeadTypeBranch = VCSRefHeadTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefHeadTypeTag = VCSRefHeadTypeKey.String("tag") +) + +// Enum values for vcs.ref.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefTypeBranch = VCSRefTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefTypeTag = VCSRefTypeKey.String("tag") +) + +// Enum values for vcs.revision_delta.direction +var ( + // How many revisions the change is behind the target ref. + // Stability: development + VCSRevisionDeltaDirectionBehind = VCSRevisionDeltaDirectionKey.String("behind") + // How many revisions the change is ahead of the target ref. + // Stability: development + VCSRevisionDeltaDirectionAhead = VCSRevisionDeltaDirectionKey.String("ahead") +) + +// Namespace: webengine +const ( + // WebEngineDescriptionKey is the attribute Key conforming to the + // "webengine.description" semantic conventions. It represents the additional + // description of the web engine (e.g. detailed version and edition + // information). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "WildFly Full 21.0.0.Final (WildFly Core 13.0.1.Final) - + // 2.2.2.Final" + WebEngineDescriptionKey = attribute.Key("webengine.description") + + // WebEngineNameKey is the attribute Key conforming to the "webengine.name" + // semantic conventions. It represents the name of the web engine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "WildFly" + WebEngineNameKey = attribute.Key("webengine.name") + + // WebEngineVersionKey is the attribute Key conforming to the + // "webengine.version" semantic conventions. It represents the version of the + // web engine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "21.0.0" + WebEngineVersionKey = attribute.Key("webengine.version") +) + +// WebEngineDescription returns an attribute KeyValue conforming to the +// "webengine.description" semantic conventions. It represents the additional +// description of the web engine (e.g. detailed version and edition information). +func WebEngineDescription(val string) attribute.KeyValue { + return WebEngineDescriptionKey.String(val) +} + +// WebEngineName returns an attribute KeyValue conforming to the "webengine.name" +// semantic conventions. It represents the name of the web engine. +func WebEngineName(val string) attribute.KeyValue { + return WebEngineNameKey.String(val) +} + +// WebEngineVersion returns an attribute KeyValue conforming to the +// "webengine.version" semantic conventions. It represents the version of the web +// engine. +func WebEngineVersion(val string) attribute.KeyValue { + return WebEngineVersionKey.String(val) +} \ No newline at end of file diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/doc.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/doc.go similarity index 65% rename from vendor/go.opentelemetry.io/otel/semconv/v1.17.0/doc.go rename to vendor/go.opentelemetry.io/otel/semconv/v1.30.0/doc.go index e087c9c04..787f5b0f4 100644 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/doc.go +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/doc.go @@ -4,6 +4,6 @@ // Package semconv implements OpenTelemetry semantic conventions. // // OpenTelemetry semantic conventions are agreed standardized naming -// patterns for OpenTelemetry things. This package represents the conventions -// as of the v1.17.0 version of the OpenTelemetry specification. -package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0" +// patterns for OpenTelemetry things. This package represents the v1.30.0 +// version of the OpenTelemetry semantic conventions. +package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0" diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/exception.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/exception.go similarity index 74% rename from vendor/go.opentelemetry.io/otel/semconv/v1.17.0/exception.go rename to vendor/go.opentelemetry.io/otel/semconv/v1.30.0/exception.go index 137acc67d..4332a795f 100644 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/exception.go +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/exception.go @@ -1,7 +1,7 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0" +package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0" const ( // ExceptionEventName is the name of the Span event representing an exception. diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/metric.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/metric.go new file mode 100644 index 000000000..fe6beb91d --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/metric.go @@ -0,0 +1,1750 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +// Code generated from semantic convention specification. DO NOT EDIT. + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0" + +const ( + // AzureCosmosDBClientActiveInstanceCount is the metric conforming to the + // "azure.cosmosdb.client.active_instance.count" semantic conventions. It + // represents the number of active client instances. + // Instrument: updowncounter + // Unit: {instance} + // Stability: development + AzureCosmosDBClientActiveInstanceCountName = "azure.cosmosdb.client.active_instance.count" + AzureCosmosDBClientActiveInstanceCountUnit = "{instance}" + AzureCosmosDBClientActiveInstanceCountDescription = "Number of active client instances" + // AzureCosmosDBClientOperationRequestCharge is the metric conforming to the + // "azure.cosmosdb.client.operation.request_charge" semantic conventions. It + // represents the [Request units] consumed by the operation. + // + // [Request units]: https://learn.microsoft.com/azure/cosmos-db/request-units + // Instrument: histogram + // Unit: {request_unit} + // Stability: development + AzureCosmosDBClientOperationRequestChargeName = "azure.cosmosdb.client.operation.request_charge" + AzureCosmosDBClientOperationRequestChargeUnit = "{request_unit}" + AzureCosmosDBClientOperationRequestChargeDescription = "[Request units](https://learn.microsoft.com/azure/cosmos-db/request-units) consumed by the operation" + // CICDPipelineRunActive is the metric conforming to the + // "cicd.pipeline.run.active" semantic conventions. It represents the number of + // pipeline runs currently active in the system by state. + // Instrument: updowncounter + // Unit: {run} + // Stability: development + CICDPipelineRunActiveName = "cicd.pipeline.run.active" + CICDPipelineRunActiveUnit = "{run}" + CICDPipelineRunActiveDescription = "The number of pipeline runs currently active in the system by state." + // CICDPipelineRunDuration is the metric conforming to the + // "cicd.pipeline.run.duration" semantic conventions. It represents the + // duration of a pipeline run grouped by pipeline, state and result. + // Instrument: histogram + // Unit: s + // Stability: development + CICDPipelineRunDurationName = "cicd.pipeline.run.duration" + CICDPipelineRunDurationUnit = "s" + CICDPipelineRunDurationDescription = "Duration of a pipeline run grouped by pipeline, state and result." + // CICDPipelineRunErrors is the metric conforming to the + // "cicd.pipeline.run.errors" semantic conventions. It represents the number of + // errors encountered in pipeline runs (eg. compile, test failures). + // Instrument: counter + // Unit: {error} + // Stability: development + CICDPipelineRunErrorsName = "cicd.pipeline.run.errors" + CICDPipelineRunErrorsUnit = "{error}" + CICDPipelineRunErrorsDescription = "The number of errors encountered in pipeline runs (eg. compile, test failures)." + // CICDSystemErrors is the metric conforming to the "cicd.system.errors" + // semantic conventions. It represents the number of errors in a component of + // the CICD system (eg. controller, scheduler, agent). + // Instrument: counter + // Unit: {error} + // Stability: development + CICDSystemErrorsName = "cicd.system.errors" + CICDSystemErrorsUnit = "{error}" + CICDSystemErrorsDescription = "The number of errors in a component of the CICD system (eg. controller, scheduler, agent)." + // CICDWorkerCount is the metric conforming to the "cicd.worker.count" semantic + // conventions. It represents the number of workers on the CICD system by + // state. + // Instrument: updowncounter + // Unit: {count} + // Stability: development + CICDWorkerCountName = "cicd.worker.count" + CICDWorkerCountUnit = "{count}" + CICDWorkerCountDescription = "The number of workers on the CICD system by state." + // ContainerCPUTime is the metric conforming to the "container.cpu.time" + // semantic conventions. It represents the total CPU time consumed. + // Instrument: counter + // Unit: s + // Stability: development + ContainerCPUTimeName = "container.cpu.time" + ContainerCPUTimeUnit = "s" + ContainerCPUTimeDescription = "Total CPU time consumed" + // ContainerCPUUsage is the metric conforming to the "container.cpu.usage" + // semantic conventions. It represents the container's CPU usage, measured in + // cpus. Range from 0 to the number of allocatable CPUs. + // Instrument: gauge + // Unit: {cpu} + // Stability: development + ContainerCPUUsageName = "container.cpu.usage" + ContainerCPUUsageUnit = "{cpu}" + ContainerCPUUsageDescription = "Container's CPU usage, measured in cpus. Range from 0 to the number of allocatable CPUs" + // ContainerDiskIo is the metric conforming to the "container.disk.io" semantic + // conventions. It represents the disk bytes for the container. + // Instrument: counter + // Unit: By + // Stability: development + ContainerDiskIoName = "container.disk.io" + ContainerDiskIoUnit = "By" + ContainerDiskIoDescription = "Disk bytes for the container." + // ContainerMemoryUsage is the metric conforming to the + // "container.memory.usage" semantic conventions. It represents the memory + // usage of the container. + // Instrument: counter + // Unit: By + // Stability: development + ContainerMemoryUsageName = "container.memory.usage" + ContainerMemoryUsageUnit = "By" + ContainerMemoryUsageDescription = "Memory usage of the container." + // ContainerNetworkIo is the metric conforming to the "container.network.io" + // semantic conventions. It represents the network bytes for the container. + // Instrument: counter + // Unit: By + // Stability: development + ContainerNetworkIoName = "container.network.io" + ContainerNetworkIoUnit = "By" + ContainerNetworkIoDescription = "Network bytes for the container." + // ContainerUptime is the metric conforming to the "container.uptime" semantic + // conventions. It represents the time the container has been running. + // Instrument: gauge + // Unit: s + // Stability: development + ContainerUptimeName = "container.uptime" + ContainerUptimeUnit = "s" + ContainerUptimeDescription = "The time the container has been running" + // DBClientConnectionCount is the metric conforming to the + // "db.client.connection.count" semantic conventions. It represents the number + // of connections that are currently in state described by the `state` + // attribute. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + DBClientConnectionCountName = "db.client.connection.count" + DBClientConnectionCountUnit = "{connection}" + DBClientConnectionCountDescription = "The number of connections that are currently in state described by the `state` attribute" + // DBClientConnectionCreateTime is the metric conforming to the + // "db.client.connection.create_time" semantic conventions. It represents the + // time it took to create a new connection. + // Instrument: histogram + // Unit: s + // Stability: development + DBClientConnectionCreateTimeName = "db.client.connection.create_time" + DBClientConnectionCreateTimeUnit = "s" + DBClientConnectionCreateTimeDescription = "The time it took to create a new connection" + // DBClientConnectionIdleMax is the metric conforming to the + // "db.client.connection.idle.max" semantic conventions. It represents the + // maximum number of idle open connections allowed. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + DBClientConnectionIdleMaxName = "db.client.connection.idle.max" + DBClientConnectionIdleMaxUnit = "{connection}" + DBClientConnectionIdleMaxDescription = "The maximum number of idle open connections allowed" + // DBClientConnectionIdleMin is the metric conforming to the + // "db.client.connection.idle.min" semantic conventions. It represents the + // minimum number of idle open connections allowed. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + DBClientConnectionIdleMinName = "db.client.connection.idle.min" + DBClientConnectionIdleMinUnit = "{connection}" + DBClientConnectionIdleMinDescription = "The minimum number of idle open connections allowed" + // DBClientConnectionMax is the metric conforming to the + // "db.client.connection.max" semantic conventions. It represents the maximum + // number of open connections allowed. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + DBClientConnectionMaxName = "db.client.connection.max" + DBClientConnectionMaxUnit = "{connection}" + DBClientConnectionMaxDescription = "The maximum number of open connections allowed" + // DBClientConnectionPendingRequests is the metric conforming to the + // "db.client.connection.pending_requests" semantic conventions. It represents + // the number of current pending requests for an open connection. + // Instrument: updowncounter + // Unit: {request} + // Stability: development + DBClientConnectionPendingRequestsName = "db.client.connection.pending_requests" + DBClientConnectionPendingRequestsUnit = "{request}" + DBClientConnectionPendingRequestsDescription = "The number of current pending requests for an open connection" + // DBClientConnectionTimeouts is the metric conforming to the + // "db.client.connection.timeouts" semantic conventions. It represents the + // number of connection timeouts that have occurred trying to obtain a + // connection from the pool. + // Instrument: counter + // Unit: {timeout} + // Stability: development + DBClientConnectionTimeoutsName = "db.client.connection.timeouts" + DBClientConnectionTimeoutsUnit = "{timeout}" + DBClientConnectionTimeoutsDescription = "The number of connection timeouts that have occurred trying to obtain a connection from the pool" + // DBClientConnectionUseTime is the metric conforming to the + // "db.client.connection.use_time" semantic conventions. It represents the time + // between borrowing a connection and returning it to the pool. + // Instrument: histogram + // Unit: s + // Stability: development + DBClientConnectionUseTimeName = "db.client.connection.use_time" + DBClientConnectionUseTimeUnit = "s" + DBClientConnectionUseTimeDescription = "The time between borrowing a connection and returning it to the pool" + // DBClientConnectionWaitTime is the metric conforming to the + // "db.client.connection.wait_time" semantic conventions. It represents the + // time it took to obtain an open connection from the pool. + // Instrument: histogram + // Unit: s + // Stability: development + DBClientConnectionWaitTimeName = "db.client.connection.wait_time" + DBClientConnectionWaitTimeUnit = "s" + DBClientConnectionWaitTimeDescription = "The time it took to obtain an open connection from the pool" + // DBClientConnectionsCreateTime is the metric conforming to the + // "db.client.connections.create_time" semantic conventions. It represents the + // deprecated, use `db.client.connection.create_time` instead. Note: the unit + // also changed from `ms` to `s`. + // Instrument: histogram + // Unit: ms + // Stability: development + // Deprecated: Replaced by `db.client.connection.create_time`. Note: the unit also changed from `ms` to `s`. + DBClientConnectionsCreateTimeName = "db.client.connections.create_time" + DBClientConnectionsCreateTimeUnit = "ms" + DBClientConnectionsCreateTimeDescription = "Deprecated, use `db.client.connection.create_time` instead. Note: the unit also changed from `ms` to `s`." + // DBClientConnectionsIdleMax is the metric conforming to the + // "db.client.connections.idle.max" semantic conventions. It represents the + // deprecated, use `db.client.connection.idle.max` instead. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + // Deprecated: Replaced by `db.client.connection.idle.max`. + DBClientConnectionsIdleMaxName = "db.client.connections.idle.max" + DBClientConnectionsIdleMaxUnit = "{connection}" + DBClientConnectionsIdleMaxDescription = "Deprecated, use `db.client.connection.idle.max` instead." + // DBClientConnectionsIdleMin is the metric conforming to the + // "db.client.connections.idle.min" semantic conventions. It represents the + // deprecated, use `db.client.connection.idle.min` instead. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + // Deprecated: Replaced by `db.client.connection.idle.min`. + DBClientConnectionsIdleMinName = "db.client.connections.idle.min" + DBClientConnectionsIdleMinUnit = "{connection}" + DBClientConnectionsIdleMinDescription = "Deprecated, use `db.client.connection.idle.min` instead." + // DBClientConnectionsMax is the metric conforming to the + // "db.client.connections.max" semantic conventions. It represents the + // deprecated, use `db.client.connection.max` instead. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + // Deprecated: Replaced by `db.client.connection.max`. + DBClientConnectionsMaxName = "db.client.connections.max" + DBClientConnectionsMaxUnit = "{connection}" + DBClientConnectionsMaxDescription = "Deprecated, use `db.client.connection.max` instead." + // DBClientConnectionsPendingRequests is the metric conforming to the + // "db.client.connections.pending_requests" semantic conventions. It represents + // the deprecated, use `db.client.connection.pending_requests` instead. + // Instrument: updowncounter + // Unit: {request} + // Stability: development + // Deprecated: Replaced by `db.client.connection.pending_requests`. + DBClientConnectionsPendingRequestsName = "db.client.connections.pending_requests" + DBClientConnectionsPendingRequestsUnit = "{request}" + DBClientConnectionsPendingRequestsDescription = "Deprecated, use `db.client.connection.pending_requests` instead." + // DBClientConnectionsTimeouts is the metric conforming to the + // "db.client.connections.timeouts" semantic conventions. It represents the + // deprecated, use `db.client.connection.timeouts` instead. + // Instrument: counter + // Unit: {timeout} + // Stability: development + // Deprecated: Replaced by `db.client.connection.timeouts`. + DBClientConnectionsTimeoutsName = "db.client.connections.timeouts" + DBClientConnectionsTimeoutsUnit = "{timeout}" + DBClientConnectionsTimeoutsDescription = "Deprecated, use `db.client.connection.timeouts` instead." + // DBClientConnectionsUsage is the metric conforming to the + // "db.client.connections.usage" semantic conventions. It represents the + // deprecated, use `db.client.connection.count` instead. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + // Deprecated: Replaced by `db.client.connection.count`. + DBClientConnectionsUsageName = "db.client.connections.usage" + DBClientConnectionsUsageUnit = "{connection}" + DBClientConnectionsUsageDescription = "Deprecated, use `db.client.connection.count` instead." + // DBClientConnectionsUseTime is the metric conforming to the + // "db.client.connections.use_time" semantic conventions. It represents the + // deprecated, use `db.client.connection.use_time` instead. Note: the unit also + // changed from `ms` to `s`. + // Instrument: histogram + // Unit: ms + // Stability: development + // Deprecated: Replaced by `db.client.connection.use_time`. Note: the unit also changed from `ms` to `s`. + DBClientConnectionsUseTimeName = "db.client.connections.use_time" + DBClientConnectionsUseTimeUnit = "ms" + DBClientConnectionsUseTimeDescription = "Deprecated, use `db.client.connection.use_time` instead. Note: the unit also changed from `ms` to `s`." + // DBClientConnectionsWaitTime is the metric conforming to the + // "db.client.connections.wait_time" semantic conventions. It represents the + // deprecated, use `db.client.connection.wait_time` instead. Note: the unit + // also changed from `ms` to `s`. + // Instrument: histogram + // Unit: ms + // Stability: development + // Deprecated: Replaced by `db.client.connection.wait_time`. Note: the unit also changed from `ms` to `s`. + DBClientConnectionsWaitTimeName = "db.client.connections.wait_time" + DBClientConnectionsWaitTimeUnit = "ms" + DBClientConnectionsWaitTimeDescription = "Deprecated, use `db.client.connection.wait_time` instead. Note: the unit also changed from `ms` to `s`." + // DBClientCosmosDBActiveInstanceCount is the metric conforming to the + // "db.client.cosmosdb.active_instance.count" semantic conventions. It + // represents the deprecated, use `azure.cosmosdb.client.active_instance.count` + // instead. + // Instrument: updowncounter + // Unit: {instance} + // Stability: development + // Deprecated: Replaced by `azure.cosmosdb.client.active_instance.count`. + DBClientCosmosDBActiveInstanceCountName = "db.client.cosmosdb.active_instance.count" + DBClientCosmosDBActiveInstanceCountUnit = "{instance}" + DBClientCosmosDBActiveInstanceCountDescription = "Deprecated, use `azure.cosmosdb.client.active_instance.count` instead." + // DBClientCosmosDBOperationRequestCharge is the metric conforming to the + // "db.client.cosmosdb.operation.request_charge" semantic conventions. It + // represents the deprecated, use + // `azure.cosmosdb.client.operation.request_charge` instead. + // Instrument: histogram + // Unit: {request_unit} + // Stability: development + // Deprecated: Replaced by `azure.cosmosdb.client.operation.request_charge`. + DBClientCosmosDBOperationRequestChargeName = "db.client.cosmosdb.operation.request_charge" + DBClientCosmosDBOperationRequestChargeUnit = "{request_unit}" + DBClientCosmosDBOperationRequestChargeDescription = "Deprecated, use `azure.cosmosdb.client.operation.request_charge` instead." + // DBClientOperationDuration is the metric conforming to the + // "db.client.operation.duration" semantic conventions. It represents the + // duration of database client operations. + // Instrument: histogram + // Unit: s + // Stability: release_candidate + DBClientOperationDurationName = "db.client.operation.duration" + DBClientOperationDurationUnit = "s" + DBClientOperationDurationDescription = "Duration of database client operations." + // DBClientResponseReturnedRows is the metric conforming to the + // "db.client.response.returned_rows" semantic conventions. It represents the + // actual number of records returned by the database operation. + // Instrument: histogram + // Unit: {row} + // Stability: development + DBClientResponseReturnedRowsName = "db.client.response.returned_rows" + DBClientResponseReturnedRowsUnit = "{row}" + DBClientResponseReturnedRowsDescription = "The actual number of records returned by the database operation." + // DNSLookupDuration is the metric conforming to the "dns.lookup.duration" + // semantic conventions. It represents the measures the time taken to perform a + // DNS lookup. + // Instrument: histogram + // Unit: s + // Stability: development + DNSLookupDurationName = "dns.lookup.duration" + DNSLookupDurationUnit = "s" + DNSLookupDurationDescription = "Measures the time taken to perform a DNS lookup." + // FaaSColdstarts is the metric conforming to the "faas.coldstarts" semantic + // conventions. It represents the number of invocation cold starts. + // Instrument: counter + // Unit: {coldstart} + // Stability: development + FaaSColdstartsName = "faas.coldstarts" + FaaSColdstartsUnit = "{coldstart}" + FaaSColdstartsDescription = "Number of invocation cold starts" + // FaaSCPUUsage is the metric conforming to the "faas.cpu_usage" semantic + // conventions. It represents the distribution of CPU usage per invocation. + // Instrument: histogram + // Unit: s + // Stability: development + FaaSCPUUsageName = "faas.cpu_usage" + FaaSCPUUsageUnit = "s" + FaaSCPUUsageDescription = "Distribution of CPU usage per invocation" + // FaaSErrors is the metric conforming to the "faas.errors" semantic + // conventions. It represents the number of invocation errors. + // Instrument: counter + // Unit: {error} + // Stability: development + FaaSErrorsName = "faas.errors" + FaaSErrorsUnit = "{error}" + FaaSErrorsDescription = "Number of invocation errors" + // FaaSInitDuration is the metric conforming to the "faas.init_duration" + // semantic conventions. It represents the measures the duration of the + // function's initialization, such as a cold start. + // Instrument: histogram + // Unit: s + // Stability: development + FaaSInitDurationName = "faas.init_duration" + FaaSInitDurationUnit = "s" + FaaSInitDurationDescription = "Measures the duration of the function's initialization, such as a cold start" + // FaaSInvocations is the metric conforming to the "faas.invocations" semantic + // conventions. It represents the number of successful invocations. + // Instrument: counter + // Unit: {invocation} + // Stability: development + FaaSInvocationsName = "faas.invocations" + FaaSInvocationsUnit = "{invocation}" + FaaSInvocationsDescription = "Number of successful invocations" + // FaaSInvokeDuration is the metric conforming to the "faas.invoke_duration" + // semantic conventions. It represents the measures the duration of the + // function's logic execution. + // Instrument: histogram + // Unit: s + // Stability: development + FaaSInvokeDurationName = "faas.invoke_duration" + FaaSInvokeDurationUnit = "s" + FaaSInvokeDurationDescription = "Measures the duration of the function's logic execution" + // FaaSMemUsage is the metric conforming to the "faas.mem_usage" semantic + // conventions. It represents the distribution of max memory usage per + // invocation. + // Instrument: histogram + // Unit: By + // Stability: development + FaaSMemUsageName = "faas.mem_usage" + FaaSMemUsageUnit = "By" + FaaSMemUsageDescription = "Distribution of max memory usage per invocation" + // FaaSNetIo is the metric conforming to the "faas.net_io" semantic + // conventions. It represents the distribution of net I/O usage per invocation. + // Instrument: histogram + // Unit: By + // Stability: development + FaaSNetIoName = "faas.net_io" + FaaSNetIoUnit = "By" + FaaSNetIoDescription = "Distribution of net I/O usage per invocation" + // FaaSTimeouts is the metric conforming to the "faas.timeouts" semantic + // conventions. It represents the number of invocation timeouts. + // Instrument: counter + // Unit: {timeout} + // Stability: development + FaaSTimeoutsName = "faas.timeouts" + FaaSTimeoutsUnit = "{timeout}" + FaaSTimeoutsDescription = "Number of invocation timeouts" + // GenAIClientOperationDuration is the metric conforming to the + // "gen_ai.client.operation.duration" semantic conventions. It represents the + // genAI operation duration. + // Instrument: histogram + // Unit: s + // Stability: development + GenAIClientOperationDurationName = "gen_ai.client.operation.duration" + GenAIClientOperationDurationUnit = "s" + GenAIClientOperationDurationDescription = "GenAI operation duration" + // GenAIClientTokenUsage is the metric conforming to the + // "gen_ai.client.token.usage" semantic conventions. It represents the measures + // number of input and output tokens used. + // Instrument: histogram + // Unit: {token} + // Stability: development + GenAIClientTokenUsageName = "gen_ai.client.token.usage" + GenAIClientTokenUsageUnit = "{token}" + GenAIClientTokenUsageDescription = "Measures number of input and output tokens used" + // GenAIServerRequestDuration is the metric conforming to the + // "gen_ai.server.request.duration" semantic conventions. It represents the + // generative AI server request duration such as time-to-last byte or last + // output token. + // Instrument: histogram + // Unit: s + // Stability: development + GenAIServerRequestDurationName = "gen_ai.server.request.duration" + GenAIServerRequestDurationUnit = "s" + GenAIServerRequestDurationDescription = "Generative AI server request duration such as time-to-last byte or last output token" + // GenAIServerTimePerOutputToken is the metric conforming to the + // "gen_ai.server.time_per_output_token" semantic conventions. It represents + // the time per output token generated after the first token for successful + // responses. + // Instrument: histogram + // Unit: s + // Stability: development + GenAIServerTimePerOutputTokenName = "gen_ai.server.time_per_output_token" + GenAIServerTimePerOutputTokenUnit = "s" + GenAIServerTimePerOutputTokenDescription = "Time per output token generated after the first token for successful responses" + // GenAIServerTimeToFirstToken is the metric conforming to the + // "gen_ai.server.time_to_first_token" semantic conventions. It represents the + // time to generate first token for successful responses. + // Instrument: histogram + // Unit: s + // Stability: development + GenAIServerTimeToFirstTokenName = "gen_ai.server.time_to_first_token" + GenAIServerTimeToFirstTokenUnit = "s" + GenAIServerTimeToFirstTokenDescription = "Time to generate first token for successful responses" + // GoConfigGogc is the metric conforming to the "go.config.gogc" semantic + // conventions. It represents the heap size target percentage configured by the + // user, otherwise 100. + // Instrument: updowncounter + // Unit: % + // Stability: development + GoConfigGogcName = "go.config.gogc" + GoConfigGogcUnit = "%" + GoConfigGogcDescription = "Heap size target percentage configured by the user, otherwise 100." + // GoGoroutineCount is the metric conforming to the "go.goroutine.count" + // semantic conventions. It represents the count of live goroutines. + // Instrument: updowncounter + // Unit: {goroutine} + // Stability: development + GoGoroutineCountName = "go.goroutine.count" + GoGoroutineCountUnit = "{goroutine}" + GoGoroutineCountDescription = "Count of live goroutines." + // GoMemoryAllocated is the metric conforming to the "go.memory.allocated" + // semantic conventions. It represents the memory allocated to the heap by the + // application. + // Instrument: counter + // Unit: By + // Stability: development + GoMemoryAllocatedName = "go.memory.allocated" + GoMemoryAllocatedUnit = "By" + GoMemoryAllocatedDescription = "Memory allocated to the heap by the application." + // GoMemoryAllocations is the metric conforming to the "go.memory.allocations" + // semantic conventions. It represents the count of allocations to the heap by + // the application. + // Instrument: counter + // Unit: {allocation} + // Stability: development + GoMemoryAllocationsName = "go.memory.allocations" + GoMemoryAllocationsUnit = "{allocation}" + GoMemoryAllocationsDescription = "Count of allocations to the heap by the application." + // GoMemoryGCGoal is the metric conforming to the "go.memory.gc.goal" semantic + // conventions. It represents the heap size target for the end of the GC cycle. + // Instrument: updowncounter + // Unit: By + // Stability: development + GoMemoryGCGoalName = "go.memory.gc.goal" + GoMemoryGCGoalUnit = "By" + GoMemoryGCGoalDescription = "Heap size target for the end of the GC cycle." + // GoMemoryLimit is the metric conforming to the "go.memory.limit" semantic + // conventions. It represents the go runtime memory limit configured by the + // user, if a limit exists. + // Instrument: updowncounter + // Unit: By + // Stability: development + GoMemoryLimitName = "go.memory.limit" + GoMemoryLimitUnit = "By" + GoMemoryLimitDescription = "Go runtime memory limit configured by the user, if a limit exists." + // GoMemoryUsed is the metric conforming to the "go.memory.used" semantic + // conventions. It represents the memory used by the Go runtime. + // Instrument: updowncounter + // Unit: By + // Stability: development + GoMemoryUsedName = "go.memory.used" + GoMemoryUsedUnit = "By" + GoMemoryUsedDescription = "Memory used by the Go runtime." + // GoProcessorLimit is the metric conforming to the "go.processor.limit" + // semantic conventions. It represents the number of OS threads that can + // execute user-level Go code simultaneously. + // Instrument: updowncounter + // Unit: {thread} + // Stability: development + GoProcessorLimitName = "go.processor.limit" + GoProcessorLimitUnit = "{thread}" + GoProcessorLimitDescription = "The number of OS threads that can execute user-level Go code simultaneously." + // GoScheduleDuration is the metric conforming to the "go.schedule.duration" + // semantic conventions. It represents the time goroutines have spent in the + // scheduler in a runnable state before actually running. + // Instrument: histogram + // Unit: s + // Stability: development + GoScheduleDurationName = "go.schedule.duration" + GoScheduleDurationUnit = "s" + GoScheduleDurationDescription = "The time goroutines have spent in the scheduler in a runnable state before actually running." + // HTTPClientActiveRequests is the metric conforming to the + // "http.client.active_requests" semantic conventions. It represents the number + // of active HTTP requests. + // Instrument: updowncounter + // Unit: {request} + // Stability: development + HTTPClientActiveRequestsName = "http.client.active_requests" + HTTPClientActiveRequestsUnit = "{request}" + HTTPClientActiveRequestsDescription = "Number of active HTTP requests." + // HTTPClientConnectionDuration is the metric conforming to the + // "http.client.connection.duration" semantic conventions. It represents the + // duration of the successfully established outbound HTTP connections. + // Instrument: histogram + // Unit: s + // Stability: development + HTTPClientConnectionDurationName = "http.client.connection.duration" + HTTPClientConnectionDurationUnit = "s" + HTTPClientConnectionDurationDescription = "The duration of the successfully established outbound HTTP connections." + // HTTPClientOpenConnections is the metric conforming to the + // "http.client.open_connections" semantic conventions. It represents the + // number of outbound HTTP connections that are currently active or idle on the + // client. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + HTTPClientOpenConnectionsName = "http.client.open_connections" + HTTPClientOpenConnectionsUnit = "{connection}" + HTTPClientOpenConnectionsDescription = "Number of outbound HTTP connections that are currently active or idle on the client." + // HTTPClientRequestBodySize is the metric conforming to the + // "http.client.request.body.size" semantic conventions. It represents the size + // of HTTP client request bodies. + // Instrument: histogram + // Unit: By + // Stability: development + HTTPClientRequestBodySizeName = "http.client.request.body.size" + HTTPClientRequestBodySizeUnit = "By" + HTTPClientRequestBodySizeDescription = "Size of HTTP client request bodies." + // HTTPClientRequestDuration is the metric conforming to the + // "http.client.request.duration" semantic conventions. It represents the + // duration of HTTP client requests. + // Instrument: histogram + // Unit: s + // Stability: stable + HTTPClientRequestDurationName = "http.client.request.duration" + HTTPClientRequestDurationUnit = "s" + HTTPClientRequestDurationDescription = "Duration of HTTP client requests." + // HTTPClientResponseBodySize is the metric conforming to the + // "http.client.response.body.size" semantic conventions. It represents the + // size of HTTP client response bodies. + // Instrument: histogram + // Unit: By + // Stability: development + HTTPClientResponseBodySizeName = "http.client.response.body.size" + HTTPClientResponseBodySizeUnit = "By" + HTTPClientResponseBodySizeDescription = "Size of HTTP client response bodies." + // HTTPServerActiveRequests is the metric conforming to the + // "http.server.active_requests" semantic conventions. It represents the number + // of active HTTP server requests. + // Instrument: updowncounter + // Unit: {request} + // Stability: development + HTTPServerActiveRequestsName = "http.server.active_requests" + HTTPServerActiveRequestsUnit = "{request}" + HTTPServerActiveRequestsDescription = "Number of active HTTP server requests." + // HTTPServerRequestBodySize is the metric conforming to the + // "http.server.request.body.size" semantic conventions. It represents the size + // of HTTP server request bodies. + // Instrument: histogram + // Unit: By + // Stability: development + HTTPServerRequestBodySizeName = "http.server.request.body.size" + HTTPServerRequestBodySizeUnit = "By" + HTTPServerRequestBodySizeDescription = "Size of HTTP server request bodies." + // HTTPServerRequestDuration is the metric conforming to the + // "http.server.request.duration" semantic conventions. It represents the + // duration of HTTP server requests. + // Instrument: histogram + // Unit: s + // Stability: stable + HTTPServerRequestDurationName = "http.server.request.duration" + HTTPServerRequestDurationUnit = "s" + HTTPServerRequestDurationDescription = "Duration of HTTP server requests." + // HTTPServerResponseBodySize is the metric conforming to the + // "http.server.response.body.size" semantic conventions. It represents the + // size of HTTP server response bodies. + // Instrument: histogram + // Unit: By + // Stability: development + HTTPServerResponseBodySizeName = "http.server.response.body.size" + HTTPServerResponseBodySizeUnit = "By" + HTTPServerResponseBodySizeDescription = "Size of HTTP server response bodies." + // HwEnergy is the metric conforming to the "hw.energy" semantic conventions. + // It represents the energy consumed by the component. + // Instrument: counter + // Unit: J + // Stability: development + HwEnergyName = "hw.energy" + HwEnergyUnit = "J" + HwEnergyDescription = "Energy consumed by the component" + // HwErrors is the metric conforming to the "hw.errors" semantic conventions. + // It represents the number of errors encountered by the component. + // Instrument: counter + // Unit: {error} + // Stability: development + HwErrorsName = "hw.errors" + HwErrorsUnit = "{error}" + HwErrorsDescription = "Number of errors encountered by the component" + // HwPower is the metric conforming to the "hw.power" semantic conventions. It + // represents the instantaneous power consumed by the component. + // Instrument: gauge + // Unit: W + // Stability: development + HwPowerName = "hw.power" + HwPowerUnit = "W" + HwPowerDescription = "Instantaneous power consumed by the component" + // HwStatus is the metric conforming to the "hw.status" semantic conventions. + // It represents the operational status: `1` (true) or `0` (false) for each of + // the possible states. + // Instrument: updowncounter + // Unit: 1 + // Stability: development + HwStatusName = "hw.status" + HwStatusUnit = "1" + HwStatusDescription = "Operational status: `1` (true) or `0` (false) for each of the possible states" + // K8SCronJobActiveJobs is the metric conforming to the + // "k8s.cronjob.active_jobs" semantic conventions. It represents the number of + // actively running jobs for a cronjob. + // Instrument: updowncounter + // Unit: {job} + // Stability: development + K8SCronJobActiveJobsName = "k8s.cronjob.active_jobs" + K8SCronJobActiveJobsUnit = "{job}" + K8SCronJobActiveJobsDescription = "The number of actively running jobs for a cronjob" + // K8SDaemonSetCurrentScheduledNodes is the metric conforming to the + // "k8s.daemonset.current_scheduled_nodes" semantic conventions. It represents + // the number of nodes that are running at least 1 daemon pod and are supposed + // to run the daemon pod. + // Instrument: updowncounter + // Unit: {node} + // Stability: development + K8SDaemonSetCurrentScheduledNodesName = "k8s.daemonset.current_scheduled_nodes" + K8SDaemonSetCurrentScheduledNodesUnit = "{node}" + K8SDaemonSetCurrentScheduledNodesDescription = "Number of nodes that are running at least 1 daemon pod and are supposed to run the daemon pod" + // K8SDaemonSetDesiredScheduledNodes is the metric conforming to the + // "k8s.daemonset.desired_scheduled_nodes" semantic conventions. It represents + // the number of nodes that should be running the daemon pod (including nodes + // currently running the daemon pod). + // Instrument: updowncounter + // Unit: {node} + // Stability: development + K8SDaemonSetDesiredScheduledNodesName = "k8s.daemonset.desired_scheduled_nodes" + K8SDaemonSetDesiredScheduledNodesUnit = "{node}" + K8SDaemonSetDesiredScheduledNodesDescription = "Number of nodes that should be running the daemon pod (including nodes currently running the daemon pod)" + // K8SDaemonSetMisscheduledNodes is the metric conforming to the + // "k8s.daemonset.misscheduled_nodes" semantic conventions. It represents the + // number of nodes that are running the daemon pod, but are not supposed to run + // the daemon pod. + // Instrument: updowncounter + // Unit: {node} + // Stability: development + K8SDaemonSetMisscheduledNodesName = "k8s.daemonset.misscheduled_nodes" + K8SDaemonSetMisscheduledNodesUnit = "{node}" + K8SDaemonSetMisscheduledNodesDescription = "Number of nodes that are running the daemon pod, but are not supposed to run the daemon pod" + // K8SDaemonSetReadyNodes is the metric conforming to the + // "k8s.daemonset.ready_nodes" semantic conventions. It represents the number + // of nodes that should be running the daemon pod and have one or more of the + // daemon pod running and ready. + // Instrument: updowncounter + // Unit: {node} + // Stability: development + K8SDaemonSetReadyNodesName = "k8s.daemonset.ready_nodes" + K8SDaemonSetReadyNodesUnit = "{node}" + K8SDaemonSetReadyNodesDescription = "Number of nodes that should be running the daemon pod and have one or more of the daemon pod running and ready" + // K8SDeploymentAvailablePods is the metric conforming to the + // "k8s.deployment.available_pods" semantic conventions. It represents the + // total number of available replica pods (ready for at least minReadySeconds) + // targeted by this deployment. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SDeploymentAvailablePodsName = "k8s.deployment.available_pods" + K8SDeploymentAvailablePodsUnit = "{pod}" + K8SDeploymentAvailablePodsDescription = "Total number of available replica pods (ready for at least minReadySeconds) targeted by this deployment" + // K8SDeploymentDesiredPods is the metric conforming to the + // "k8s.deployment.desired_pods" semantic conventions. It represents the number + // of desired replica pods in this deployment. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SDeploymentDesiredPodsName = "k8s.deployment.desired_pods" + K8SDeploymentDesiredPodsUnit = "{pod}" + K8SDeploymentDesiredPodsDescription = "Number of desired replica pods in this deployment" + // K8SHpaCurrentPods is the metric conforming to the "k8s.hpa.current_pods" + // semantic conventions. It represents the current number of replica pods + // managed by this horizontal pod autoscaler, as last seen by the autoscaler. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SHpaCurrentPodsName = "k8s.hpa.current_pods" + K8SHpaCurrentPodsUnit = "{pod}" + K8SHpaCurrentPodsDescription = "Current number of replica pods managed by this horizontal pod autoscaler, as last seen by the autoscaler" + // K8SHpaDesiredPods is the metric conforming to the "k8s.hpa.desired_pods" + // semantic conventions. It represents the desired number of replica pods + // managed by this horizontal pod autoscaler, as last calculated by the + // autoscaler. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SHpaDesiredPodsName = "k8s.hpa.desired_pods" + K8SHpaDesiredPodsUnit = "{pod}" + K8SHpaDesiredPodsDescription = "Desired number of replica pods managed by this horizontal pod autoscaler, as last calculated by the autoscaler" + // K8SHpaMaxPods is the metric conforming to the "k8s.hpa.max_pods" semantic + // conventions. It represents the upper limit for the number of replica pods to + // which the autoscaler can scale up. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SHpaMaxPodsName = "k8s.hpa.max_pods" + K8SHpaMaxPodsUnit = "{pod}" + K8SHpaMaxPodsDescription = "The upper limit for the number of replica pods to which the autoscaler can scale up" + // K8SHpaMinPods is the metric conforming to the "k8s.hpa.min_pods" semantic + // conventions. It represents the lower limit for the number of replica pods to + // which the autoscaler can scale down. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SHpaMinPodsName = "k8s.hpa.min_pods" + K8SHpaMinPodsUnit = "{pod}" + K8SHpaMinPodsDescription = "The lower limit for the number of replica pods to which the autoscaler can scale down" + // K8SJobActivePods is the metric conforming to the "k8s.job.active_pods" + // semantic conventions. It represents the number of pending and actively + // running pods for a job. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SJobActivePodsName = "k8s.job.active_pods" + K8SJobActivePodsUnit = "{pod}" + K8SJobActivePodsDescription = "The number of pending and actively running pods for a job" + // K8SJobDesiredSuccessfulPods is the metric conforming to the + // "k8s.job.desired_successful_pods" semantic conventions. It represents the + // desired number of successfully finished pods the job should be run with. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SJobDesiredSuccessfulPodsName = "k8s.job.desired_successful_pods" + K8SJobDesiredSuccessfulPodsUnit = "{pod}" + K8SJobDesiredSuccessfulPodsDescription = "The desired number of successfully finished pods the job should be run with" + // K8SJobFailedPods is the metric conforming to the "k8s.job.failed_pods" + // semantic conventions. It represents the number of pods which reached phase + // Failed for a job. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SJobFailedPodsName = "k8s.job.failed_pods" + K8SJobFailedPodsUnit = "{pod}" + K8SJobFailedPodsDescription = "The number of pods which reached phase Failed for a job" + // K8SJobMaxParallelPods is the metric conforming to the + // "k8s.job.max_parallel_pods" semantic conventions. It represents the max + // desired number of pods the job should run at any given time. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SJobMaxParallelPodsName = "k8s.job.max_parallel_pods" + K8SJobMaxParallelPodsUnit = "{pod}" + K8SJobMaxParallelPodsDescription = "The max desired number of pods the job should run at any given time" + // K8SJobSuccessfulPods is the metric conforming to the + // "k8s.job.successful_pods" semantic conventions. It represents the number of + // pods which reached phase Succeeded for a job. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SJobSuccessfulPodsName = "k8s.job.successful_pods" + K8SJobSuccessfulPodsUnit = "{pod}" + K8SJobSuccessfulPodsDescription = "The number of pods which reached phase Succeeded for a job" + // K8SNamespacePhase is the metric conforming to the "k8s.namespace.phase" + // semantic conventions. It represents the describes number of K8s namespaces + // that are currently in a given phase. + // Instrument: updowncounter + // Unit: {namespace} + // Stability: development + K8SNamespacePhaseName = "k8s.namespace.phase" + K8SNamespacePhaseUnit = "{namespace}" + K8SNamespacePhaseDescription = "Describes number of K8s namespaces that are currently in a given phase." + // K8SNodeCPUTime is the metric conforming to the "k8s.node.cpu.time" semantic + // conventions. It represents the total CPU time consumed. + // Instrument: counter + // Unit: s + // Stability: development + K8SNodeCPUTimeName = "k8s.node.cpu.time" + K8SNodeCPUTimeUnit = "s" + K8SNodeCPUTimeDescription = "Total CPU time consumed" + // K8SNodeCPUUsage is the metric conforming to the "k8s.node.cpu.usage" + // semantic conventions. It represents the node's CPU usage, measured in cpus. + // Range from 0 to the number of allocatable CPUs. + // Instrument: gauge + // Unit: {cpu} + // Stability: development + K8SNodeCPUUsageName = "k8s.node.cpu.usage" + K8SNodeCPUUsageUnit = "{cpu}" + K8SNodeCPUUsageDescription = "Node's CPU usage, measured in cpus. Range from 0 to the number of allocatable CPUs" + // K8SNodeMemoryUsage is the metric conforming to the "k8s.node.memory.usage" + // semantic conventions. It represents the memory usage of the Node. + // Instrument: gauge + // Unit: By + // Stability: development + K8SNodeMemoryUsageName = "k8s.node.memory.usage" + K8SNodeMemoryUsageUnit = "By" + K8SNodeMemoryUsageDescription = "Memory usage of the Node" + // K8SNodeNetworkErrors is the metric conforming to the + // "k8s.node.network.errors" semantic conventions. It represents the node + // network errors. + // Instrument: counter + // Unit: {error} + // Stability: development + K8SNodeNetworkErrorsName = "k8s.node.network.errors" + K8SNodeNetworkErrorsUnit = "{error}" + K8SNodeNetworkErrorsDescription = "Node network errors" + // K8SNodeNetworkIo is the metric conforming to the "k8s.node.network.io" + // semantic conventions. It represents the network bytes for the Node. + // Instrument: counter + // Unit: By + // Stability: development + K8SNodeNetworkIoName = "k8s.node.network.io" + K8SNodeNetworkIoUnit = "By" + K8SNodeNetworkIoDescription = "Network bytes for the Node" + // K8SNodeUptime is the metric conforming to the "k8s.node.uptime" semantic + // conventions. It represents the time the Node has been running. + // Instrument: gauge + // Unit: s + // Stability: development + K8SNodeUptimeName = "k8s.node.uptime" + K8SNodeUptimeUnit = "s" + K8SNodeUptimeDescription = "The time the Node has been running" + // K8SPodCPUTime is the metric conforming to the "k8s.pod.cpu.time" semantic + // conventions. It represents the total CPU time consumed. + // Instrument: counter + // Unit: s + // Stability: development + K8SPodCPUTimeName = "k8s.pod.cpu.time" + K8SPodCPUTimeUnit = "s" + K8SPodCPUTimeDescription = "Total CPU time consumed" + // K8SPodCPUUsage is the metric conforming to the "k8s.pod.cpu.usage" semantic + // conventions. It represents the pod's CPU usage, measured in cpus. Range from + // 0 to the number of allocatable CPUs. + // Instrument: gauge + // Unit: {cpu} + // Stability: development + K8SPodCPUUsageName = "k8s.pod.cpu.usage" + K8SPodCPUUsageUnit = "{cpu}" + K8SPodCPUUsageDescription = "Pod's CPU usage, measured in cpus. Range from 0 to the number of allocatable CPUs" + // K8SPodMemoryUsage is the metric conforming to the "k8s.pod.memory.usage" + // semantic conventions. It represents the memory usage of the Pod. + // Instrument: gauge + // Unit: By + // Stability: development + K8SPodMemoryUsageName = "k8s.pod.memory.usage" + K8SPodMemoryUsageUnit = "By" + K8SPodMemoryUsageDescription = "Memory usage of the Pod" + // K8SPodNetworkErrors is the metric conforming to the "k8s.pod.network.errors" + // semantic conventions. It represents the pod network errors. + // Instrument: counter + // Unit: {error} + // Stability: development + K8SPodNetworkErrorsName = "k8s.pod.network.errors" + K8SPodNetworkErrorsUnit = "{error}" + K8SPodNetworkErrorsDescription = "Pod network errors" + // K8SPodNetworkIo is the metric conforming to the "k8s.pod.network.io" + // semantic conventions. It represents the network bytes for the Pod. + // Instrument: counter + // Unit: By + // Stability: development + K8SPodNetworkIoName = "k8s.pod.network.io" + K8SPodNetworkIoUnit = "By" + K8SPodNetworkIoDescription = "Network bytes for the Pod" + // K8SPodUptime is the metric conforming to the "k8s.pod.uptime" semantic + // conventions. It represents the time the Pod has been running. + // Instrument: gauge + // Unit: s + // Stability: development + K8SPodUptimeName = "k8s.pod.uptime" + K8SPodUptimeUnit = "s" + K8SPodUptimeDescription = "The time the Pod has been running" + // K8SReplicaSetAvailablePods is the metric conforming to the + // "k8s.replicaset.available_pods" semantic conventions. It represents the + // total number of available replica pods (ready for at least minReadySeconds) + // targeted by this replicaset. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SReplicaSetAvailablePodsName = "k8s.replicaset.available_pods" + K8SReplicaSetAvailablePodsUnit = "{pod}" + K8SReplicaSetAvailablePodsDescription = "Total number of available replica pods (ready for at least minReadySeconds) targeted by this replicaset" + // K8SReplicaSetDesiredPods is the metric conforming to the + // "k8s.replicaset.desired_pods" semantic conventions. It represents the number + // of desired replica pods in this replicaset. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SReplicaSetDesiredPodsName = "k8s.replicaset.desired_pods" + K8SReplicaSetDesiredPodsUnit = "{pod}" + K8SReplicaSetDesiredPodsDescription = "Number of desired replica pods in this replicaset" + // K8SReplicationControllerAvailablePods is the metric conforming to the + // "k8s.replication_controller.available_pods" semantic conventions. It + // represents the total number of available replica pods (ready for at least + // minReadySeconds) targeted by this replication controller. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SReplicationControllerAvailablePodsName = "k8s.replication_controller.available_pods" + K8SReplicationControllerAvailablePodsUnit = "{pod}" + K8SReplicationControllerAvailablePodsDescription = "Total number of available replica pods (ready for at least minReadySeconds) targeted by this replication controller" + // K8SReplicationControllerDesiredPods is the metric conforming to the + // "k8s.replication_controller.desired_pods" semantic conventions. It + // represents the number of desired replica pods in this replication + // controller. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SReplicationControllerDesiredPodsName = "k8s.replication_controller.desired_pods" + K8SReplicationControllerDesiredPodsUnit = "{pod}" + K8SReplicationControllerDesiredPodsDescription = "Number of desired replica pods in this replication controller" + // K8SStatefulSetCurrentPods is the metric conforming to the + // "k8s.statefulset.current_pods" semantic conventions. It represents the + // number of replica pods created by the statefulset controller from the + // statefulset version indicated by currentRevision. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SStatefulSetCurrentPodsName = "k8s.statefulset.current_pods" + K8SStatefulSetCurrentPodsUnit = "{pod}" + K8SStatefulSetCurrentPodsDescription = "The number of replica pods created by the statefulset controller from the statefulset version indicated by currentRevision" + // K8SStatefulSetDesiredPods is the metric conforming to the + // "k8s.statefulset.desired_pods" semantic conventions. It represents the + // number of desired replica pods in this statefulset. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SStatefulSetDesiredPodsName = "k8s.statefulset.desired_pods" + K8SStatefulSetDesiredPodsUnit = "{pod}" + K8SStatefulSetDesiredPodsDescription = "Number of desired replica pods in this statefulset" + // K8SStatefulSetReadyPods is the metric conforming to the + // "k8s.statefulset.ready_pods" semantic conventions. It represents the number + // of replica pods created for this statefulset with a Ready Condition. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SStatefulSetReadyPodsName = "k8s.statefulset.ready_pods" + K8SStatefulSetReadyPodsUnit = "{pod}" + K8SStatefulSetReadyPodsDescription = "The number of replica pods created for this statefulset with a Ready Condition" + // K8SStatefulSetUpdatedPods is the metric conforming to the + // "k8s.statefulset.updated_pods" semantic conventions. It represents the + // number of replica pods created by the statefulset controller from the + // statefulset version indicated by updateRevision. + // Instrument: updowncounter + // Unit: {pod} + // Stability: development + K8SStatefulSetUpdatedPodsName = "k8s.statefulset.updated_pods" + K8SStatefulSetUpdatedPodsUnit = "{pod}" + K8SStatefulSetUpdatedPodsDescription = "Number of replica pods created by the statefulset controller from the statefulset version indicated by updateRevision" + // KestrelActiveConnections is the metric conforming to the + // "kestrel.active_connections" semantic conventions. It represents the number + // of connections that are currently active on the server. + // Instrument: updowncounter + // Unit: {connection} + // Stability: stable + KestrelActiveConnectionsName = "kestrel.active_connections" + KestrelActiveConnectionsUnit = "{connection}" + KestrelActiveConnectionsDescription = "Number of connections that are currently active on the server." + // KestrelActiveTLSHandshakes is the metric conforming to the + // "kestrel.active_tls_handshakes" semantic conventions. It represents the + // number of TLS handshakes that are currently in progress on the server. + // Instrument: updowncounter + // Unit: {handshake} + // Stability: stable + KestrelActiveTLSHandshakesName = "kestrel.active_tls_handshakes" + KestrelActiveTLSHandshakesUnit = "{handshake}" + KestrelActiveTLSHandshakesDescription = "Number of TLS handshakes that are currently in progress on the server." + // KestrelConnectionDuration is the metric conforming to the + // "kestrel.connection.duration" semantic conventions. It represents the + // duration of connections on the server. + // Instrument: histogram + // Unit: s + // Stability: stable + KestrelConnectionDurationName = "kestrel.connection.duration" + KestrelConnectionDurationUnit = "s" + KestrelConnectionDurationDescription = "The duration of connections on the server." + // KestrelQueuedConnections is the metric conforming to the + // "kestrel.queued_connections" semantic conventions. It represents the number + // of connections that are currently queued and are waiting to start. + // Instrument: updowncounter + // Unit: {connection} + // Stability: stable + KestrelQueuedConnectionsName = "kestrel.queued_connections" + KestrelQueuedConnectionsUnit = "{connection}" + KestrelQueuedConnectionsDescription = "Number of connections that are currently queued and are waiting to start." + // KestrelQueuedRequests is the metric conforming to the + // "kestrel.queued_requests" semantic conventions. It represents the number of + // HTTP requests on multiplexed connections (HTTP/2 and HTTP/3) that are + // currently queued and are waiting to start. + // Instrument: updowncounter + // Unit: {request} + // Stability: stable + KestrelQueuedRequestsName = "kestrel.queued_requests" + KestrelQueuedRequestsUnit = "{request}" + KestrelQueuedRequestsDescription = "Number of HTTP requests on multiplexed connections (HTTP/2 and HTTP/3) that are currently queued and are waiting to start." + // KestrelRejectedConnections is the metric conforming to the + // "kestrel.rejected_connections" semantic conventions. It represents the + // number of connections rejected by the server. + // Instrument: counter + // Unit: {connection} + // Stability: stable + KestrelRejectedConnectionsName = "kestrel.rejected_connections" + KestrelRejectedConnectionsUnit = "{connection}" + KestrelRejectedConnectionsDescription = "Number of connections rejected by the server." + // KestrelTLSHandshakeDuration is the metric conforming to the + // "kestrel.tls_handshake.duration" semantic conventions. It represents the + // duration of TLS handshakes on the server. + // Instrument: histogram + // Unit: s + // Stability: stable + KestrelTLSHandshakeDurationName = "kestrel.tls_handshake.duration" + KestrelTLSHandshakeDurationUnit = "s" + KestrelTLSHandshakeDurationDescription = "The duration of TLS handshakes on the server." + // KestrelUpgradedConnections is the metric conforming to the + // "kestrel.upgraded_connections" semantic conventions. It represents the + // number of connections that are currently upgraded (WebSockets). . + // Instrument: updowncounter + // Unit: {connection} + // Stability: stable + KestrelUpgradedConnectionsName = "kestrel.upgraded_connections" + KestrelUpgradedConnectionsUnit = "{connection}" + KestrelUpgradedConnectionsDescription = "Number of connections that are currently upgraded (WebSockets). ." + // MessagingClientConsumedMessages is the metric conforming to the + // "messaging.client.consumed.messages" semantic conventions. It represents the + // number of messages that were delivered to the application. + // Instrument: counter + // Unit: {message} + // Stability: development + MessagingClientConsumedMessagesName = "messaging.client.consumed.messages" + MessagingClientConsumedMessagesUnit = "{message}" + MessagingClientConsumedMessagesDescription = "Number of messages that were delivered to the application." + // MessagingClientOperationDuration is the metric conforming to the + // "messaging.client.operation.duration" semantic conventions. It represents + // the duration of messaging operation initiated by a producer or consumer + // client. + // Instrument: histogram + // Unit: s + // Stability: development + MessagingClientOperationDurationName = "messaging.client.operation.duration" + MessagingClientOperationDurationUnit = "s" + MessagingClientOperationDurationDescription = "Duration of messaging operation initiated by a producer or consumer client." + // MessagingClientPublishedMessages is the metric conforming to the + // "messaging.client.published.messages" semantic conventions. It represents + // the deprecated. Use `messaging.client.sent.messages` instead. + // Instrument: counter + // Unit: {message} + // Stability: development + // Deprecated: Replaced by `messaging.client.sent.messages`. + MessagingClientPublishedMessagesName = "messaging.client.published.messages" + MessagingClientPublishedMessagesUnit = "{message}" + MessagingClientPublishedMessagesDescription = "Deprecated. Use `messaging.client.sent.messages` instead." + // MessagingClientSentMessages is the metric conforming to the + // "messaging.client.sent.messages" semantic conventions. It represents the + // number of messages producer attempted to send to the broker. + // Instrument: counter + // Unit: {message} + // Stability: development + MessagingClientSentMessagesName = "messaging.client.sent.messages" + MessagingClientSentMessagesUnit = "{message}" + MessagingClientSentMessagesDescription = "Number of messages producer attempted to send to the broker." + // MessagingProcessDuration is the metric conforming to the + // "messaging.process.duration" semantic conventions. It represents the + // duration of processing operation. + // Instrument: histogram + // Unit: s + // Stability: development + MessagingProcessDurationName = "messaging.process.duration" + MessagingProcessDurationUnit = "s" + MessagingProcessDurationDescription = "Duration of processing operation." + // MessagingProcessMessages is the metric conforming to the + // "messaging.process.messages" semantic conventions. It represents the + // deprecated. Use `messaging.client.consumed.messages` instead. + // Instrument: counter + // Unit: {message} + // Stability: development + // Deprecated: Replaced by `messaging.client.consumed.messages`. + MessagingProcessMessagesName = "messaging.process.messages" + MessagingProcessMessagesUnit = "{message}" + MessagingProcessMessagesDescription = "Deprecated. Use `messaging.client.consumed.messages` instead." + // MessagingPublishDuration is the metric conforming to the + // "messaging.publish.duration" semantic conventions. It represents the + // deprecated. Use `messaging.client.operation.duration` instead. + // Instrument: histogram + // Unit: s + // Stability: development + // Deprecated: Replaced by `messaging.client.operation.duration`. + MessagingPublishDurationName = "messaging.publish.duration" + MessagingPublishDurationUnit = "s" + MessagingPublishDurationDescription = "Deprecated. Use `messaging.client.operation.duration` instead." + // MessagingPublishMessages is the metric conforming to the + // "messaging.publish.messages" semantic conventions. It represents the + // deprecated. Use `messaging.client.produced.messages` instead. + // Instrument: counter + // Unit: {message} + // Stability: development + // Deprecated: Replaced by `messaging.client.produced.messages`. + MessagingPublishMessagesName = "messaging.publish.messages" + MessagingPublishMessagesUnit = "{message}" + MessagingPublishMessagesDescription = "Deprecated. Use `messaging.client.produced.messages` instead." + // MessagingReceiveDuration is the metric conforming to the + // "messaging.receive.duration" semantic conventions. It represents the + // deprecated. Use `messaging.client.operation.duration` instead. + // Instrument: histogram + // Unit: s + // Stability: development + // Deprecated: Replaced by `messaging.client.operation.duration`. + MessagingReceiveDurationName = "messaging.receive.duration" + MessagingReceiveDurationUnit = "s" + MessagingReceiveDurationDescription = "Deprecated. Use `messaging.client.operation.duration` instead." + // MessagingReceiveMessages is the metric conforming to the + // "messaging.receive.messages" semantic conventions. It represents the + // deprecated. Use `messaging.client.consumed.messages` instead. + // Instrument: counter + // Unit: {message} + // Stability: development + // Deprecated: Replaced by `messaging.client.consumed.messages`. + MessagingReceiveMessagesName = "messaging.receive.messages" + MessagingReceiveMessagesUnit = "{message}" + MessagingReceiveMessagesDescription = "Deprecated. Use `messaging.client.consumed.messages` instead." + // ProcessContextSwitches is the metric conforming to the + // "process.context_switches" semantic conventions. It represents the number of + // times the process has been context switched. + // Instrument: counter + // Unit: {count} + // Stability: development + ProcessContextSwitchesName = "process.context_switches" + ProcessContextSwitchesUnit = "{count}" + ProcessContextSwitchesDescription = "Number of times the process has been context switched." + // ProcessCPUTime is the metric conforming to the "process.cpu.time" semantic + // conventions. It represents the total CPU seconds broken down by different + // states. + // Instrument: counter + // Unit: s + // Stability: development + ProcessCPUTimeName = "process.cpu.time" + ProcessCPUTimeUnit = "s" + ProcessCPUTimeDescription = "Total CPU seconds broken down by different states." + // ProcessCPUUtilization is the metric conforming to the + // "process.cpu.utilization" semantic conventions. It represents the difference + // in process.cpu.time since the last measurement, divided by the elapsed time + // and number of CPUs available to the process. + // Instrument: gauge + // Unit: 1 + // Stability: development + ProcessCPUUtilizationName = "process.cpu.utilization" + ProcessCPUUtilizationUnit = "1" + ProcessCPUUtilizationDescription = "Difference in process.cpu.time since the last measurement, divided by the elapsed time and number of CPUs available to the process." + // ProcessDiskIo is the metric conforming to the "process.disk.io" semantic + // conventions. It represents the disk bytes transferred. + // Instrument: counter + // Unit: By + // Stability: development + ProcessDiskIoName = "process.disk.io" + ProcessDiskIoUnit = "By" + ProcessDiskIoDescription = "Disk bytes transferred." + // ProcessMemoryUsage is the metric conforming to the "process.memory.usage" + // semantic conventions. It represents the amount of physical memory in use. + // Instrument: updowncounter + // Unit: By + // Stability: development + ProcessMemoryUsageName = "process.memory.usage" + ProcessMemoryUsageUnit = "By" + ProcessMemoryUsageDescription = "The amount of physical memory in use." + // ProcessMemoryVirtual is the metric conforming to the + // "process.memory.virtual" semantic conventions. It represents the amount of + // committed virtual memory. + // Instrument: updowncounter + // Unit: By + // Stability: development + ProcessMemoryVirtualName = "process.memory.virtual" + ProcessMemoryVirtualUnit = "By" + ProcessMemoryVirtualDescription = "The amount of committed virtual memory." + // ProcessNetworkIo is the metric conforming to the "process.network.io" + // semantic conventions. It represents the network bytes transferred. + // Instrument: counter + // Unit: By + // Stability: development + ProcessNetworkIoName = "process.network.io" + ProcessNetworkIoUnit = "By" + ProcessNetworkIoDescription = "Network bytes transferred." + // ProcessOpenFileDescriptorCount is the metric conforming to the + // "process.open_file_descriptor.count" semantic conventions. It represents the + // number of file descriptors in use by the process. + // Instrument: updowncounter + // Unit: {count} + // Stability: development + ProcessOpenFileDescriptorCountName = "process.open_file_descriptor.count" + ProcessOpenFileDescriptorCountUnit = "{count}" + ProcessOpenFileDescriptorCountDescription = "Number of file descriptors in use by the process." + // ProcessPagingFaults is the metric conforming to the "process.paging.faults" + // semantic conventions. It represents the number of page faults the process + // has made. + // Instrument: counter + // Unit: {fault} + // Stability: development + ProcessPagingFaultsName = "process.paging.faults" + ProcessPagingFaultsUnit = "{fault}" + ProcessPagingFaultsDescription = "Number of page faults the process has made." + // ProcessThreadCount is the metric conforming to the "process.thread.count" + // semantic conventions. It represents the process threads count. + // Instrument: updowncounter + // Unit: {thread} + // Stability: development + ProcessThreadCountName = "process.thread.count" + ProcessThreadCountUnit = "{thread}" + ProcessThreadCountDescription = "Process threads count." + // ProcessUptime is the metric conforming to the "process.uptime" semantic + // conventions. It represents the time the process has been running. + // Instrument: gauge + // Unit: s + // Stability: development + ProcessUptimeName = "process.uptime" + ProcessUptimeUnit = "s" + ProcessUptimeDescription = "The time the process has been running." + // RPCClientDuration is the metric conforming to the "rpc.client.duration" + // semantic conventions. It represents the measures the duration of outbound + // RPC. + // Instrument: histogram + // Unit: ms + // Stability: development + RPCClientDurationName = "rpc.client.duration" + RPCClientDurationUnit = "ms" + RPCClientDurationDescription = "Measures the duration of outbound RPC." + // RPCClientRequestSize is the metric conforming to the + // "rpc.client.request.size" semantic conventions. It represents the measures + // the size of RPC request messages (uncompressed). + // Instrument: histogram + // Unit: By + // Stability: development + RPCClientRequestSizeName = "rpc.client.request.size" + RPCClientRequestSizeUnit = "By" + RPCClientRequestSizeDescription = "Measures the size of RPC request messages (uncompressed)." + // RPCClientRequestsPerRPC is the metric conforming to the + // "rpc.client.requests_per_rpc" semantic conventions. It represents the + // measures the number of messages received per RPC. + // Instrument: histogram + // Unit: {count} + // Stability: development + RPCClientRequestsPerRPCName = "rpc.client.requests_per_rpc" + RPCClientRequestsPerRPCUnit = "{count}" + RPCClientRequestsPerRPCDescription = "Measures the number of messages received per RPC." + // RPCClientResponseSize is the metric conforming to the + // "rpc.client.response.size" semantic conventions. It represents the measures + // the size of RPC response messages (uncompressed). + // Instrument: histogram + // Unit: By + // Stability: development + RPCClientResponseSizeName = "rpc.client.response.size" + RPCClientResponseSizeUnit = "By" + RPCClientResponseSizeDescription = "Measures the size of RPC response messages (uncompressed)." + // RPCClientResponsesPerRPC is the metric conforming to the + // "rpc.client.responses_per_rpc" semantic conventions. It represents the + // measures the number of messages sent per RPC. + // Instrument: histogram + // Unit: {count} + // Stability: development + RPCClientResponsesPerRPCName = "rpc.client.responses_per_rpc" + RPCClientResponsesPerRPCUnit = "{count}" + RPCClientResponsesPerRPCDescription = "Measures the number of messages sent per RPC." + // RPCServerDuration is the metric conforming to the "rpc.server.duration" + // semantic conventions. It represents the measures the duration of inbound + // RPC. + // Instrument: histogram + // Unit: ms + // Stability: development + RPCServerDurationName = "rpc.server.duration" + RPCServerDurationUnit = "ms" + RPCServerDurationDescription = "Measures the duration of inbound RPC." + // RPCServerRequestSize is the metric conforming to the + // "rpc.server.request.size" semantic conventions. It represents the measures + // the size of RPC request messages (uncompressed). + // Instrument: histogram + // Unit: By + // Stability: development + RPCServerRequestSizeName = "rpc.server.request.size" + RPCServerRequestSizeUnit = "By" + RPCServerRequestSizeDescription = "Measures the size of RPC request messages (uncompressed)." + // RPCServerRequestsPerRPC is the metric conforming to the + // "rpc.server.requests_per_rpc" semantic conventions. It represents the + // measures the number of messages received per RPC. + // Instrument: histogram + // Unit: {count} + // Stability: development + RPCServerRequestsPerRPCName = "rpc.server.requests_per_rpc" + RPCServerRequestsPerRPCUnit = "{count}" + RPCServerRequestsPerRPCDescription = "Measures the number of messages received per RPC." + // RPCServerResponseSize is the metric conforming to the + // "rpc.server.response.size" semantic conventions. It represents the measures + // the size of RPC response messages (uncompressed). + // Instrument: histogram + // Unit: By + // Stability: development + RPCServerResponseSizeName = "rpc.server.response.size" + RPCServerResponseSizeUnit = "By" + RPCServerResponseSizeDescription = "Measures the size of RPC response messages (uncompressed)." + // RPCServerResponsesPerRPC is the metric conforming to the + // "rpc.server.responses_per_rpc" semantic conventions. It represents the + // measures the number of messages sent per RPC. + // Instrument: histogram + // Unit: {count} + // Stability: development + RPCServerResponsesPerRPCName = "rpc.server.responses_per_rpc" + RPCServerResponsesPerRPCUnit = "{count}" + RPCServerResponsesPerRPCDescription = "Measures the number of messages sent per RPC." + // SignalrServerActiveConnections is the metric conforming to the + // "signalr.server.active_connections" semantic conventions. It represents the + // number of connections that are currently active on the server. + // Instrument: updowncounter + // Unit: {connection} + // Stability: stable + SignalrServerActiveConnectionsName = "signalr.server.active_connections" + SignalrServerActiveConnectionsUnit = "{connection}" + SignalrServerActiveConnectionsDescription = "Number of connections that are currently active on the server." + // SignalrServerConnectionDuration is the metric conforming to the + // "signalr.server.connection.duration" semantic conventions. It represents the + // duration of connections on the server. + // Instrument: histogram + // Unit: s + // Stability: stable + SignalrServerConnectionDurationName = "signalr.server.connection.duration" + SignalrServerConnectionDurationUnit = "s" + SignalrServerConnectionDurationDescription = "The duration of connections on the server." + // SystemCPUFrequency is the metric conforming to the "system.cpu.frequency" + // semantic conventions. It represents the reports the current frequency of the + // CPU in Hz. + // Instrument: gauge + // Unit: {Hz} + // Stability: development + SystemCPUFrequencyName = "system.cpu.frequency" + SystemCPUFrequencyUnit = "{Hz}" + SystemCPUFrequencyDescription = "Reports the current frequency of the CPU in Hz" + // SystemCPULogicalCount is the metric conforming to the + // "system.cpu.logical.count" semantic conventions. It represents the reports + // the number of logical (virtual) processor cores created by the operating + // system to manage multitasking. + // Instrument: updowncounter + // Unit: {cpu} + // Stability: development + SystemCPULogicalCountName = "system.cpu.logical.count" + SystemCPULogicalCountUnit = "{cpu}" + SystemCPULogicalCountDescription = "Reports the number of logical (virtual) processor cores created by the operating system to manage multitasking" + // SystemCPUPhysicalCount is the metric conforming to the + // "system.cpu.physical.count" semantic conventions. It represents the reports + // the number of actual physical processor cores on the hardware. + // Instrument: updowncounter + // Unit: {cpu} + // Stability: development + SystemCPUPhysicalCountName = "system.cpu.physical.count" + SystemCPUPhysicalCountUnit = "{cpu}" + SystemCPUPhysicalCountDescription = "Reports the number of actual physical processor cores on the hardware" + // SystemCPUTime is the metric conforming to the "system.cpu.time" semantic + // conventions. It represents the seconds each logical CPU spent on each mode. + // Instrument: counter + // Unit: s + // Stability: development + SystemCPUTimeName = "system.cpu.time" + SystemCPUTimeUnit = "s" + SystemCPUTimeDescription = "Seconds each logical CPU spent on each mode" + // SystemCPUUtilization is the metric conforming to the + // "system.cpu.utilization" semantic conventions. It represents the difference + // in system.cpu.time since the last measurement, divided by the elapsed time + // and number of logical CPUs. + // Instrument: gauge + // Unit: 1 + // Stability: development + SystemCPUUtilizationName = "system.cpu.utilization" + SystemCPUUtilizationUnit = "1" + SystemCPUUtilizationDescription = "Difference in system.cpu.time since the last measurement, divided by the elapsed time and number of logical CPUs" + // SystemDiskIo is the metric conforming to the "system.disk.io" semantic + // conventions. + // Instrument: counter + // Unit: By + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemDiskIoName = "system.disk.io" + SystemDiskIoUnit = "By" + // SystemDiskIoTime is the metric conforming to the "system.disk.io_time" + // semantic conventions. It represents the time disk spent activated. + // Instrument: counter + // Unit: s + // Stability: development + SystemDiskIoTimeName = "system.disk.io_time" + SystemDiskIoTimeUnit = "s" + SystemDiskIoTimeDescription = "Time disk spent activated" + // SystemDiskLimit is the metric conforming to the "system.disk.limit" semantic + // conventions. It represents the total storage capacity of the disk. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemDiskLimitName = "system.disk.limit" + SystemDiskLimitUnit = "By" + SystemDiskLimitDescription = "The total storage capacity of the disk" + // SystemDiskMerged is the metric conforming to the "system.disk.merged" + // semantic conventions. + // Instrument: counter + // Unit: {operation} + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemDiskMergedName = "system.disk.merged" + SystemDiskMergedUnit = "{operation}" + // SystemDiskOperationTime is the metric conforming to the + // "system.disk.operation_time" semantic conventions. It represents the sum of + // the time each operation took to complete. + // Instrument: counter + // Unit: s + // Stability: development + SystemDiskOperationTimeName = "system.disk.operation_time" + SystemDiskOperationTimeUnit = "s" + SystemDiskOperationTimeDescription = "Sum of the time each operation took to complete" + // SystemDiskOperations is the metric conforming to the + // "system.disk.operations" semantic conventions. + // Instrument: counter + // Unit: {operation} + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemDiskOperationsName = "system.disk.operations" + SystemDiskOperationsUnit = "{operation}" + // SystemFilesystemLimit is the metric conforming to the + // "system.filesystem.limit" semantic conventions. It represents the total + // storage capacity of the filesystem. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemFilesystemLimitName = "system.filesystem.limit" + SystemFilesystemLimitUnit = "By" + SystemFilesystemLimitDescription = "The total storage capacity of the filesystem" + // SystemFilesystemUsage is the metric conforming to the + // "system.filesystem.usage" semantic conventions. It represents the reports a + // filesystem's space usage across different states. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemFilesystemUsageName = "system.filesystem.usage" + SystemFilesystemUsageUnit = "By" + SystemFilesystemUsageDescription = "Reports a filesystem's space usage across different states." + // SystemFilesystemUtilization is the metric conforming to the + // "system.filesystem.utilization" semantic conventions. + // Instrument: gauge + // Unit: 1 + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemFilesystemUtilizationName = "system.filesystem.utilization" + SystemFilesystemUtilizationUnit = "1" + // SystemLinuxMemoryAvailable is the metric conforming to the + // "system.linux.memory.available" semantic conventions. It represents an + // estimate of how much memory is available for starting new applications, + // without causing swapping. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemLinuxMemoryAvailableName = "system.linux.memory.available" + SystemLinuxMemoryAvailableUnit = "By" + SystemLinuxMemoryAvailableDescription = "An estimate of how much memory is available for starting new applications, without causing swapping" + // SystemLinuxMemorySlabUsage is the metric conforming to the + // "system.linux.memory.slab.usage" semantic conventions. It represents the + // reports the memory used by the Linux kernel for managing caches of + // frequently used objects. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemLinuxMemorySlabUsageName = "system.linux.memory.slab.usage" + SystemLinuxMemorySlabUsageUnit = "By" + SystemLinuxMemorySlabUsageDescription = "Reports the memory used by the Linux kernel for managing caches of frequently used objects." + // SystemMemoryLimit is the metric conforming to the "system.memory.limit" + // semantic conventions. It represents the total memory available in the + // system. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemMemoryLimitName = "system.memory.limit" + SystemMemoryLimitUnit = "By" + SystemMemoryLimitDescription = "Total memory available in the system." + // SystemMemoryShared is the metric conforming to the "system.memory.shared" + // semantic conventions. It represents the shared memory used (mostly by + // tmpfs). + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemMemorySharedName = "system.memory.shared" + SystemMemorySharedUnit = "By" + SystemMemorySharedDescription = "Shared memory used (mostly by tmpfs)." + // SystemMemoryUsage is the metric conforming to the "system.memory.usage" + // semantic conventions. It represents the reports memory in use by state. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemMemoryUsageName = "system.memory.usage" + SystemMemoryUsageUnit = "By" + SystemMemoryUsageDescription = "Reports memory in use by state." + // SystemMemoryUtilization is the metric conforming to the + // "system.memory.utilization" semantic conventions. + // Instrument: gauge + // Unit: 1 + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemMemoryUtilizationName = "system.memory.utilization" + SystemMemoryUtilizationUnit = "1" + // SystemNetworkConnections is the metric conforming to the + // "system.network.connections" semantic conventions. + // Instrument: updowncounter + // Unit: {connection} + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemNetworkConnectionsName = "system.network.connections" + SystemNetworkConnectionsUnit = "{connection}" + // SystemNetworkDropped is the metric conforming to the + // "system.network.dropped" semantic conventions. It represents the count of + // packets that are dropped or discarded even though there was no error. + // Instrument: counter + // Unit: {packet} + // Stability: development + SystemNetworkDroppedName = "system.network.dropped" + SystemNetworkDroppedUnit = "{packet}" + SystemNetworkDroppedDescription = "Count of packets that are dropped or discarded even though there was no error" + // SystemNetworkErrors is the metric conforming to the "system.network.errors" + // semantic conventions. It represents the count of network errors detected. + // Instrument: counter + // Unit: {error} + // Stability: development + SystemNetworkErrorsName = "system.network.errors" + SystemNetworkErrorsUnit = "{error}" + SystemNetworkErrorsDescription = "Count of network errors detected" + // SystemNetworkIo is the metric conforming to the "system.network.io" semantic + // conventions. + // Instrument: counter + // Unit: By + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemNetworkIoName = "system.network.io" + SystemNetworkIoUnit = "By" + // SystemNetworkPackets is the metric conforming to the + // "system.network.packets" semantic conventions. + // Instrument: counter + // Unit: {packet} + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemNetworkPacketsName = "system.network.packets" + SystemNetworkPacketsUnit = "{packet}" + // SystemPagingFaults is the metric conforming to the "system.paging.faults" + // semantic conventions. + // Instrument: counter + // Unit: {fault} + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemPagingFaultsName = "system.paging.faults" + SystemPagingFaultsUnit = "{fault}" + // SystemPagingOperations is the metric conforming to the + // "system.paging.operations" semantic conventions. + // Instrument: counter + // Unit: {operation} + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemPagingOperationsName = "system.paging.operations" + SystemPagingOperationsUnit = "{operation}" + // SystemPagingUsage is the metric conforming to the "system.paging.usage" + // semantic conventions. It represents the unix swap or windows pagefile usage. + // Instrument: updowncounter + // Unit: By + // Stability: development + SystemPagingUsageName = "system.paging.usage" + SystemPagingUsageUnit = "By" + SystemPagingUsageDescription = "Unix swap or windows pagefile usage" + // SystemPagingUtilization is the metric conforming to the + // "system.paging.utilization" semantic conventions. + // Instrument: gauge + // Unit: 1 + // Stability: development + // NOTE: The description (brief) for this metric is not defined in the semantic-conventions repository. + SystemPagingUtilizationName = "system.paging.utilization" + SystemPagingUtilizationUnit = "1" + // SystemProcessCount is the metric conforming to the "system.process.count" + // semantic conventions. It represents the total number of processes in each + // state. + // Instrument: updowncounter + // Unit: {process} + // Stability: development + SystemProcessCountName = "system.process.count" + SystemProcessCountUnit = "{process}" + SystemProcessCountDescription = "Total number of processes in each state" + // SystemProcessCreated is the metric conforming to the + // "system.process.created" semantic conventions. It represents the total + // number of processes created over uptime of the host. + // Instrument: counter + // Unit: {process} + // Stability: development + SystemProcessCreatedName = "system.process.created" + SystemProcessCreatedUnit = "{process}" + SystemProcessCreatedDescription = "Total number of processes created over uptime of the host" + // SystemUptime is the metric conforming to the "system.uptime" semantic + // conventions. It represents the time the system has been running. + // Instrument: gauge + // Unit: s + // Stability: development + SystemUptimeName = "system.uptime" + SystemUptimeUnit = "s" + SystemUptimeDescription = "The time the system has been running" + // VCSChangeCount is the metric conforming to the "vcs.change.count" semantic + // conventions. It represents the number of changes (pull requests/merge + // requests/changelists) in a repository, categorized by their state (e.g. open + // or merged). + // Instrument: updowncounter + // Unit: {change} + // Stability: development + VCSChangeCountName = "vcs.change.count" + VCSChangeCountUnit = "{change}" + VCSChangeCountDescription = "The number of changes (pull requests/merge requests/changelists) in a repository, categorized by their state (e.g. open or merged)" + // VCSChangeDuration is the metric conforming to the "vcs.change.duration" + // semantic conventions. It represents the time duration a change (pull + // request/merge request/changelist) has been in a given state. + // Instrument: gauge + // Unit: s + // Stability: development + VCSChangeDurationName = "vcs.change.duration" + VCSChangeDurationUnit = "s" + VCSChangeDurationDescription = "The time duration a change (pull request/merge request/changelist) has been in a given state." + // VCSChangeTimeToApproval is the metric conforming to the + // "vcs.change.time_to_approval" semantic conventions. It represents the amount + // of time since its creation it took a change (pull request/merge + // request/changelist) to get the first approval. + // Instrument: gauge + // Unit: s + // Stability: development + VCSChangeTimeToApprovalName = "vcs.change.time_to_approval" + VCSChangeTimeToApprovalUnit = "s" + VCSChangeTimeToApprovalDescription = "The amount of time since its creation it took a change (pull request/merge request/changelist) to get the first approval." + // VCSChangeTimeToMerge is the metric conforming to the + // "vcs.change.time_to_merge" semantic conventions. It represents the amount of + // time since its creation it took a change (pull request/merge + // request/changelist) to get merged into the target(base) ref. + // Instrument: gauge + // Unit: s + // Stability: development + VCSChangeTimeToMergeName = "vcs.change.time_to_merge" + VCSChangeTimeToMergeUnit = "s" + VCSChangeTimeToMergeDescription = "The amount of time since its creation it took a change (pull request/merge request/changelist) to get merged into the target(base) ref." + // VCSContributorCount is the metric conforming to the "vcs.contributor.count" + // semantic conventions. It represents the number of unique contributors to a + // repository. + // Instrument: gauge + // Unit: {contributor} + // Stability: development + VCSContributorCountName = "vcs.contributor.count" + VCSContributorCountUnit = "{contributor}" + VCSContributorCountDescription = "The number of unique contributors to a repository" + // VCSRefCount is the metric conforming to the "vcs.ref.count" semantic + // conventions. It represents the number of refs of type branch or tag in a + // repository. + // Instrument: updowncounter + // Unit: {ref} + // Stability: development + VCSRefCountName = "vcs.ref.count" + VCSRefCountUnit = "{ref}" + VCSRefCountDescription = "The number of refs of type branch or tag in a repository." + // VCSRefLinesDelta is the metric conforming to the "vcs.ref.lines_delta" + // semantic conventions. It represents the number of lines added/removed in a + // ref (branch) relative to the ref from the `vcs.ref.base.name` attribute. + // Instrument: gauge + // Unit: {line} + // Stability: development + VCSRefLinesDeltaName = "vcs.ref.lines_delta" + VCSRefLinesDeltaUnit = "{line}" + VCSRefLinesDeltaDescription = "The number of lines added/removed in a ref (branch) relative to the ref from the `vcs.ref.base.name` attribute." + // VCSRefRevisionsDelta is the metric conforming to the + // "vcs.ref.revisions_delta" semantic conventions. It represents the number of + // revisions (commits) a ref (branch) is ahead/behind the branch from the + // `vcs.ref.base.name` attribute. + // Instrument: gauge + // Unit: {revision} + // Stability: development + VCSRefRevisionsDeltaName = "vcs.ref.revisions_delta" + VCSRefRevisionsDeltaUnit = "{revision}" + VCSRefRevisionsDeltaDescription = "The number of revisions (commits) a ref (branch) is ahead/behind the branch from the `vcs.ref.base.name` attribute" + // VCSRefTime is the metric conforming to the "vcs.ref.time" semantic + // conventions. It represents the time a ref (branch) created from the default + // branch (trunk) has existed. The `ref.type` attribute will always be `branch` + // . + // Instrument: gauge + // Unit: s + // Stability: development + VCSRefTimeName = "vcs.ref.time" + VCSRefTimeUnit = "s" + VCSRefTimeDescription = "Time a ref (branch) created from the default branch (trunk) has existed. The `ref.type` attribute will always be `branch`" + // VCSRepositoryCount is the metric conforming to the "vcs.repository.count" + // semantic conventions. It represents the number of repositories in an + // organization. + // Instrument: updowncounter + // Unit: {repository} + // Stability: development + VCSRepositoryCountName = "vcs.repository.count" + VCSRepositoryCountUnit = "{repository}" + VCSRepositoryCountDescription = "The number of repositories in an organization." +) \ No newline at end of file diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/schema.go b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/schema.go similarity index 71% rename from vendor/go.opentelemetry.io/otel/semconv/v1.17.0/schema.go rename to vendor/go.opentelemetry.io/otel/semconv/v1.30.0/schema.go index 634a1dce0..b2e7a515a 100644 --- a/vendor/go.opentelemetry.io/otel/semconv/v1.17.0/schema.go +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.30.0/schema.go @@ -1,9 +1,9 @@ // Copyright The OpenTelemetry Authors // SPDX-License-Identifier: Apache-2.0 -package semconv // import "go.opentelemetry.io/otel/semconv/v1.17.0" +package semconv // import "go.opentelemetry.io/otel/semconv/v1.30.0" // SchemaURL is the schema URL that matches the version of the semantic conventions // that this package defines. Semconv packages starting from v1.4.0 must declare // non-empty schema URL in the form https://opentelemetry.io/schemas/ -const SchemaURL = "https://opentelemetry.io/schemas/1.17.0" +const SchemaURL = "https://opentelemetry.io/schemas/1.30.0" diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md new file mode 100644 index 000000000..02b56115e --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/MIGRATION.md @@ -0,0 +1,4 @@ + +# Migration from v1.33.0 to v1.34.0 + +The `go.opentelemetry.io/otel/semconv/v1.34.0` package should be a drop-in replacement for `go.opentelemetry.io/otel/semconv/v1.33.0`. diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md new file mode 100644 index 000000000..fab06c975 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/README.md @@ -0,0 +1,3 @@ +# Semconv v1.34.0 + +[![PkgGoDev](https://pkg.go.dev/badge/go.opentelemetry.io/otel/semconv/v1.34.0)](https://pkg.go.dev/go.opentelemetry.io/otel/semconv/v1.34.0) diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go new file mode 100644 index 000000000..5b5666257 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/attribute_group.go @@ -0,0 +1,13851 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +// Code generated from semantic convention specification. DO NOT EDIT. + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" + +import "go.opentelemetry.io/otel/attribute" + +// Namespace: android +const ( + // AndroidAppStateKey is the attribute Key conforming to the "android.app.state" + // semantic conventions. It represents the this attribute represents the state + // of the application. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "created" + // Note: The Android lifecycle states are defined in + // [Activity lifecycle callbacks], and from which the `OS identifiers` are + // derived. + // + // [Activity lifecycle callbacks]: https://developer.android.com/guide/components/activities/activity-lifecycle#lc + AndroidAppStateKey = attribute.Key("android.app.state") + + // AndroidOSAPILevelKey is the attribute Key conforming to the + // "android.os.api_level" semantic conventions. It represents the uniquely + // identifies the framework API revision offered by a version (`os.version`) of + // the android operating system. More information can be found [here]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "33", "32" + // + // [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels + AndroidOSAPILevelKey = attribute.Key("android.os.api_level") +) + +// AndroidOSAPILevel returns an attribute KeyValue conforming to the +// "android.os.api_level" semantic conventions. It represents the uniquely +// identifies the framework API revision offered by a version (`os.version`) of +// the android operating system. More information can be found [here]. +// +// [here]: https://developer.android.com/guide/topics/manifest/uses-sdk-element#ApiLevels +func AndroidOSAPILevel(val string) attribute.KeyValue { + return AndroidOSAPILevelKey.String(val) +} + +// Enum values for android.app.state +var ( + // Any time before Activity.onResume() or, if the app has no Activity, + // Context.startService() has been called in the app for the first time. + // + // Stability: development + AndroidAppStateCreated = AndroidAppStateKey.String("created") + // Any time after Activity.onPause() or, if the app has no Activity, + // Context.stopService() has been called when the app was in the foreground + // state. + // + // Stability: development + AndroidAppStateBackground = AndroidAppStateKey.String("background") + // Any time after Activity.onResume() or, if the app has no Activity, + // Context.startService() has been called when the app was in either the created + // or background states. + // + // Stability: development + AndroidAppStateForeground = AndroidAppStateKey.String("foreground") +) + +// Namespace: app +const ( + // AppInstallationIDKey is the attribute Key conforming to the + // "app.installation.id" semantic conventions. It represents a unique identifier + // representing the installation of an application on a specific device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2ab2916d-a51f-4ac8-80ee-45ac31a28092" + // Note: Its value SHOULD persist across launches of the same application + // installation, including through application upgrades. + // It SHOULD change if the application is uninstalled or if all applications of + // the vendor are uninstalled. + // Additionally, users might be able to reset this value (e.g. by clearing + // application data). + // If an app is installed multiple times on the same device (e.g. in different + // accounts on Android), each `app.installation.id` SHOULD have a different + // value. + // If multiple OpenTelemetry SDKs are used within the same application, they + // SHOULD use the same value for `app.installation.id`. + // Hardware IDs (e.g. serial number, IMEI, MAC address) MUST NOT be used as the + // `app.installation.id`. + // + // For iOS, this value SHOULD be equal to the [vendor identifier]. + // + // For Android, examples of `app.installation.id` implementations include: + // + // - [Firebase Installation ID]. + // - A globally unique UUID which is persisted across sessions in your + // application. + // - [App set ID]. + // - [`Settings.getString(Settings.Secure.ANDROID_ID)`]. + // + // More information about Android identifier best practices can be found [here] + // . + // + // [vendor identifier]: https://developer.apple.com/documentation/uikit/uidevice/identifierforvendor + // [Firebase Installation ID]: https://firebase.google.com/docs/projects/manage-installations + // [App set ID]: https://developer.android.com/identity/app-set-id + // [`Settings.getString(Settings.Secure.ANDROID_ID)`]: https://developer.android.com/reference/android/provider/Settings.Secure#ANDROID_ID + // [here]: https://developer.android.com/training/articles/user-data-ids + AppInstallationIDKey = attribute.Key("app.installation.id") + + // AppScreenCoordinateXKey is the attribute Key conforming to the + // "app.screen.coordinate.x" semantic conventions. It represents the x + // (horizontal) coordinate of a screen coordinate, in screen pixels. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 131 + AppScreenCoordinateXKey = attribute.Key("app.screen.coordinate.x") + + // AppScreenCoordinateYKey is the attribute Key conforming to the + // "app.screen.coordinate.y" semantic conventions. It represents the y + // (vertical) component of a screen coordinate, in screen pixels. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12, 99 + AppScreenCoordinateYKey = attribute.Key("app.screen.coordinate.y") + + // AppWidgetIDKey is the attribute Key conforming to the "app.widget.id" + // semantic conventions. It represents an identifier that uniquely + // differentiates this widget from other widgets in the same application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "f9bc787d-ff05-48ad-90e1-fca1d46130b3", "submit_order_1829" + // Note: A widget is an application component, typically an on-screen visual GUI + // element. + AppWidgetIDKey = attribute.Key("app.widget.id") + + // AppWidgetNameKey is the attribute Key conforming to the "app.widget.name" + // semantic conventions. It represents the name of an application widget. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "submit", "attack", "Clear Cart" + // Note: A widget is an application component, typically an on-screen visual GUI + // element. + AppWidgetNameKey = attribute.Key("app.widget.name") +) + +// AppInstallationID returns an attribute KeyValue conforming to the +// "app.installation.id" semantic conventions. It represents a unique identifier +// representing the installation of an application on a specific device. +func AppInstallationID(val string) attribute.KeyValue { + return AppInstallationIDKey.String(val) +} + +// AppScreenCoordinateX returns an attribute KeyValue conforming to the +// "app.screen.coordinate.x" semantic conventions. It represents the x +// (horizontal) coordinate of a screen coordinate, in screen pixels. +func AppScreenCoordinateX(val int) attribute.KeyValue { + return AppScreenCoordinateXKey.Int(val) +} + +// AppScreenCoordinateY returns an attribute KeyValue conforming to the +// "app.screen.coordinate.y" semantic conventions. It represents the y (vertical) +// component of a screen coordinate, in screen pixels. +func AppScreenCoordinateY(val int) attribute.KeyValue { + return AppScreenCoordinateYKey.Int(val) +} + +// AppWidgetID returns an attribute KeyValue conforming to the "app.widget.id" +// semantic conventions. It represents an identifier that uniquely differentiates +// this widget from other widgets in the same application. +func AppWidgetID(val string) attribute.KeyValue { + return AppWidgetIDKey.String(val) +} + +// AppWidgetName returns an attribute KeyValue conforming to the +// "app.widget.name" semantic conventions. It represents the name of an +// application widget. +func AppWidgetName(val string) attribute.KeyValue { + return AppWidgetNameKey.String(val) +} + +// Namespace: artifact +const ( + // ArtifactAttestationFilenameKey is the attribute Key conforming to the + // "artifact.attestation.filename" semantic conventions. It represents the + // provenance filename of the built attestation which directly relates to the + // build artifact filename. This filename SHOULD accompany the artifact at + // publish time. See the [SLSA Relationship] specification for more information. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "golang-binary-amd64-v0.1.0.attestation", + // "docker-image-amd64-v0.1.0.intoto.json1", "release-1.tar.gz.attestation", + // "file-name-package.tar.gz.intoto.json1" + // + // [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations + ArtifactAttestationFilenameKey = attribute.Key("artifact.attestation.filename") + + // ArtifactAttestationHashKey is the attribute Key conforming to the + // "artifact.attestation.hash" semantic conventions. It represents the full + // [hash value (see glossary)], of the built attestation. Some envelopes in the + // [software attestation space] also refer to this as the **digest**. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1b31dfcd5b7f9267bf2ff47651df1cfb9147b9e4df1f335accf65b4cda498408" + // + // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec + ArtifactAttestationHashKey = attribute.Key("artifact.attestation.hash") + + // ArtifactAttestationIDKey is the attribute Key conforming to the + // "artifact.attestation.id" semantic conventions. It represents the id of the + // build [software attestation]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123" + // + // [software attestation]: https://slsa.dev/attestation-model + ArtifactAttestationIDKey = attribute.Key("artifact.attestation.id") + + // ArtifactFilenameKey is the attribute Key conforming to the + // "artifact.filename" semantic conventions. It represents the human readable + // file name of the artifact, typically generated during build and release + // processes. Often includes the package name and version in the file name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "golang-binary-amd64-v0.1.0", "docker-image-amd64-v0.1.0", + // "release-1.tar.gz", "file-name-package.tar.gz" + // Note: This file name can also act as the [Package Name] + // in cases where the package ecosystem maps accordingly. + // Additionally, the artifact [can be published] + // for others, but that is not a guarantee. + // + // [Package Name]: https://slsa.dev/spec/v1.0/terminology#package-model + // [can be published]: https://slsa.dev/spec/v1.0/terminology#software-supply-chain + ArtifactFilenameKey = attribute.Key("artifact.filename") + + // ArtifactHashKey is the attribute Key conforming to the "artifact.hash" + // semantic conventions. It represents the full [hash value (see glossary)], + // often found in checksum.txt on a release of the artifact and used to verify + // package integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9ff4c52759e2c4ac70b7d517bc7fcdc1cda631ca0045271ddd1b192544f8a3e9" + // Note: The specific algorithm used to create the cryptographic hash value is + // not defined. In situations where an artifact has multiple + // cryptographic hashes, it is up to the implementer to choose which + // hash value to set here; this should be the most secure hash algorithm + // that is suitable for the situation and consistent with the + // corresponding attestation. The implementer can then provide the other + // hash values through an additional set of attribute extensions as they + // deem necessary. + // + // [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + ArtifactHashKey = attribute.Key("artifact.hash") + + // ArtifactPurlKey is the attribute Key conforming to the "artifact.purl" + // semantic conventions. It represents the [Package URL] of the + // [package artifact] provides a standard way to identify and locate the + // packaged artifact. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pkg:github/package-url/purl-spec@1209109710924", + // "pkg:npm/foo@12.12.3" + // + // [Package URL]: https://github.com/package-url/purl-spec + // [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model + ArtifactPurlKey = attribute.Key("artifact.purl") + + // ArtifactVersionKey is the attribute Key conforming to the "artifact.version" + // semantic conventions. It represents the version of the artifact. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "v0.1.0", "1.2.1", "122691-build" + ArtifactVersionKey = attribute.Key("artifact.version") +) + +// ArtifactAttestationFilename returns an attribute KeyValue conforming to the +// "artifact.attestation.filename" semantic conventions. It represents the +// provenance filename of the built attestation which directly relates to the +// build artifact filename. This filename SHOULD accompany the artifact at +// publish time. See the [SLSA Relationship] specification for more information. +// +// [SLSA Relationship]: https://slsa.dev/spec/v1.0/distributing-provenance#relationship-between-artifacts-and-attestations +func ArtifactAttestationFilename(val string) attribute.KeyValue { + return ArtifactAttestationFilenameKey.String(val) +} + +// ArtifactAttestationHash returns an attribute KeyValue conforming to the +// "artifact.attestation.hash" semantic conventions. It represents the full +// [hash value (see glossary)], of the built attestation. Some envelopes in the +// [software attestation space] also refer to this as the **digest**. +// +// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf +// [software attestation space]: https://github.com/in-toto/attestation/tree/main/spec +func ArtifactAttestationHash(val string) attribute.KeyValue { + return ArtifactAttestationHashKey.String(val) +} + +// ArtifactAttestationID returns an attribute KeyValue conforming to the +// "artifact.attestation.id" semantic conventions. It represents the id of the +// build [software attestation]. +// +// [software attestation]: https://slsa.dev/attestation-model +func ArtifactAttestationID(val string) attribute.KeyValue { + return ArtifactAttestationIDKey.String(val) +} + +// ArtifactFilename returns an attribute KeyValue conforming to the +// "artifact.filename" semantic conventions. It represents the human readable +// file name of the artifact, typically generated during build and release +// processes. Often includes the package name and version in the file name. +func ArtifactFilename(val string) attribute.KeyValue { + return ArtifactFilenameKey.String(val) +} + +// ArtifactHash returns an attribute KeyValue conforming to the "artifact.hash" +// semantic conventions. It represents the full [hash value (see glossary)], +// often found in checksum.txt on a release of the artifact and used to verify +// package integrity. +// +// [hash value (see glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf +func ArtifactHash(val string) attribute.KeyValue { + return ArtifactHashKey.String(val) +} + +// ArtifactPurl returns an attribute KeyValue conforming to the "artifact.purl" +// semantic conventions. It represents the [Package URL] of the +// [package artifact] provides a standard way to identify and locate the packaged +// artifact. +// +// [Package URL]: https://github.com/package-url/purl-spec +// [package artifact]: https://slsa.dev/spec/v1.0/terminology#package-model +func ArtifactPurl(val string) attribute.KeyValue { + return ArtifactPurlKey.String(val) +} + +// ArtifactVersion returns an attribute KeyValue conforming to the +// "artifact.version" semantic conventions. It represents the version of the +// artifact. +func ArtifactVersion(val string) attribute.KeyValue { + return ArtifactVersionKey.String(val) +} + +// Namespace: aws +const ( + // AWSBedrockGuardrailIDKey is the attribute Key conforming to the + // "aws.bedrock.guardrail.id" semantic conventions. It represents the unique + // identifier of the AWS Bedrock Guardrail. A [guardrail] helps safeguard and + // prevent unwanted behavior from model responses or user messages. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "sgi5gkybzqak" + // + // [guardrail]: https://docs.aws.amazon.com/bedrock/latest/userguide/guardrails.html + AWSBedrockGuardrailIDKey = attribute.Key("aws.bedrock.guardrail.id") + + // AWSBedrockKnowledgeBaseIDKey is the attribute Key conforming to the + // "aws.bedrock.knowledge_base.id" semantic conventions. It represents the + // unique identifier of the AWS Bedrock Knowledge base. A [knowledge base] is a + // bank of information that can be queried by models to generate more relevant + // responses and augment prompts. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "XFWUPB9PAW" + // + // [knowledge base]: https://docs.aws.amazon.com/bedrock/latest/userguide/knowledge-base.html + AWSBedrockKnowledgeBaseIDKey = attribute.Key("aws.bedrock.knowledge_base.id") + + // AWSDynamoDBAttributeDefinitionsKey is the attribute Key conforming to the + // "aws.dynamodb.attribute_definitions" semantic conventions. It represents the + // JSON-serialized value of each item in the `AttributeDefinitions` request + // field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "AttributeName": "string", "AttributeType": "string" }" + AWSDynamoDBAttributeDefinitionsKey = attribute.Key("aws.dynamodb.attribute_definitions") + + // AWSDynamoDBAttributesToGetKey is the attribute Key conforming to the + // "aws.dynamodb.attributes_to_get" semantic conventions. It represents the + // value of the `AttributesToGet` request parameter. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "lives", "id" + AWSDynamoDBAttributesToGetKey = attribute.Key("aws.dynamodb.attributes_to_get") + + // AWSDynamoDBConsistentReadKey is the attribute Key conforming to the + // "aws.dynamodb.consistent_read" semantic conventions. It represents the value + // of the `ConsistentRead` request parameter. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AWSDynamoDBConsistentReadKey = attribute.Key("aws.dynamodb.consistent_read") + + // AWSDynamoDBConsumedCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.consumed_capacity" semantic conventions. It represents the + // JSON-serialized value of each item in the `ConsumedCapacity` response field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "CapacityUnits": number, "GlobalSecondaryIndexes": { "string" : + // { "CapacityUnits": number, "ReadCapacityUnits": number, "WriteCapacityUnits": + // number } }, "LocalSecondaryIndexes": { "string" : { "CapacityUnits": number, + // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }, + // "ReadCapacityUnits": number, "Table": { "CapacityUnits": number, + // "ReadCapacityUnits": number, "WriteCapacityUnits": number }, "TableName": + // "string", "WriteCapacityUnits": number }" + AWSDynamoDBConsumedCapacityKey = attribute.Key("aws.dynamodb.consumed_capacity") + + // AWSDynamoDBCountKey is the attribute Key conforming to the + // "aws.dynamodb.count" semantic conventions. It represents the value of the + // `Count` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBCountKey = attribute.Key("aws.dynamodb.count") + + // AWSDynamoDBExclusiveStartTableKey is the attribute Key conforming to the + // "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the + // value of the `ExclusiveStartTableName` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Users", "CatsTable" + AWSDynamoDBExclusiveStartTableKey = attribute.Key("aws.dynamodb.exclusive_start_table") + + // AWSDynamoDBGlobalSecondaryIndexUpdatesKey is the attribute Key conforming to + // the "aws.dynamodb.global_secondary_index_updates" semantic conventions. It + // represents the JSON-serialized value of each item in the + // `GlobalSecondaryIndexUpdates` request field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "Create": { "IndexName": "string", "KeySchema": [ { + // "AttributeName": "string", "KeyType": "string" } ], "Projection": { + // "NonKeyAttributes": [ "string" ], "ProjectionType": "string" }, + // "ProvisionedThroughput": { "ReadCapacityUnits": number, "WriteCapacityUnits": + // number } }" + AWSDynamoDBGlobalSecondaryIndexUpdatesKey = attribute.Key("aws.dynamodb.global_secondary_index_updates") + + // AWSDynamoDBGlobalSecondaryIndexesKey is the attribute Key conforming to the + // "aws.dynamodb.global_secondary_indexes" semantic conventions. It represents + // the JSON-serialized value of each item of the `GlobalSecondaryIndexes` + // request field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "IndexName": "string", "KeySchema": [ { "AttributeName": + // "string", "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ + // "string" ], "ProjectionType": "string" }, "ProvisionedThroughput": { + // "ReadCapacityUnits": number, "WriteCapacityUnits": number } }" + AWSDynamoDBGlobalSecondaryIndexesKey = attribute.Key("aws.dynamodb.global_secondary_indexes") + + // AWSDynamoDBIndexNameKey is the attribute Key conforming to the + // "aws.dynamodb.index_name" semantic conventions. It represents the value of + // the `IndexName` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "name_to_group" + AWSDynamoDBIndexNameKey = attribute.Key("aws.dynamodb.index_name") + + // AWSDynamoDBItemCollectionMetricsKey is the attribute Key conforming to the + // "aws.dynamodb.item_collection_metrics" semantic conventions. It represents + // the JSON-serialized value of the `ItemCollectionMetrics` response field. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "string" : [ { "ItemCollectionKey": { "string" : { "B": blob, + // "BOOL": boolean, "BS": [ blob ], "L": [ "AttributeValue" ], "M": { "string" : + // "AttributeValue" }, "N": "string", "NS": [ "string" ], "NULL": boolean, "S": + // "string", "SS": [ "string" ] } }, "SizeEstimateRangeGB": [ number ] } ] }" + AWSDynamoDBItemCollectionMetricsKey = attribute.Key("aws.dynamodb.item_collection_metrics") + + // AWSDynamoDBLimitKey is the attribute Key conforming to the + // "aws.dynamodb.limit" semantic conventions. It represents the value of the + // `Limit` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBLimitKey = attribute.Key("aws.dynamodb.limit") + + // AWSDynamoDBLocalSecondaryIndexesKey is the attribute Key conforming to the + // "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents + // the JSON-serialized value of each item of the `LocalSecondaryIndexes` request + // field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "{ "IndexArn": "string", "IndexName": "string", "IndexSizeBytes": + // number, "ItemCount": number, "KeySchema": [ { "AttributeName": "string", + // "KeyType": "string" } ], "Projection": { "NonKeyAttributes": [ "string" ], + // "ProjectionType": "string" } }" + AWSDynamoDBLocalSecondaryIndexesKey = attribute.Key("aws.dynamodb.local_secondary_indexes") + + // AWSDynamoDBProjectionKey is the attribute Key conforming to the + // "aws.dynamodb.projection" semantic conventions. It represents the value of + // the `ProjectionExpression` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Title", "Title, Price, Color", "Title, Description, RelatedItems, + // ProductReviews" + AWSDynamoDBProjectionKey = attribute.Key("aws.dynamodb.projection") + + // AWSDynamoDBProvisionedReadCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.provisioned_read_capacity" semantic conventions. It represents + // the value of the `ProvisionedThroughput.ReadCapacityUnits` request parameter. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0, 2.0 + AWSDynamoDBProvisionedReadCapacityKey = attribute.Key("aws.dynamodb.provisioned_read_capacity") + + // AWSDynamoDBProvisionedWriteCapacityKey is the attribute Key conforming to the + // "aws.dynamodb.provisioned_write_capacity" semantic conventions. It represents + // the value of the `ProvisionedThroughput.WriteCapacityUnits` request + // parameter. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0, 2.0 + AWSDynamoDBProvisionedWriteCapacityKey = attribute.Key("aws.dynamodb.provisioned_write_capacity") + + // AWSDynamoDBScanForwardKey is the attribute Key conforming to the + // "aws.dynamodb.scan_forward" semantic conventions. It represents the value of + // the `ScanIndexForward` request parameter. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AWSDynamoDBScanForwardKey = attribute.Key("aws.dynamodb.scan_forward") + + // AWSDynamoDBScannedCountKey is the attribute Key conforming to the + // "aws.dynamodb.scanned_count" semantic conventions. It represents the value of + // the `ScannedCount` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 50 + AWSDynamoDBScannedCountKey = attribute.Key("aws.dynamodb.scanned_count") + + // AWSDynamoDBSegmentKey is the attribute Key conforming to the + // "aws.dynamodb.segment" semantic conventions. It represents the value of the + // `Segment` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10 + AWSDynamoDBSegmentKey = attribute.Key("aws.dynamodb.segment") + + // AWSDynamoDBSelectKey is the attribute Key conforming to the + // "aws.dynamodb.select" semantic conventions. It represents the value of the + // `Select` request parameter. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ALL_ATTRIBUTES", "COUNT" + AWSDynamoDBSelectKey = attribute.Key("aws.dynamodb.select") + + // AWSDynamoDBTableCountKey is the attribute Key conforming to the + // "aws.dynamodb.table_count" semantic conventions. It represents the number of + // items in the `TableNames` response parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 20 + AWSDynamoDBTableCountKey = attribute.Key("aws.dynamodb.table_count") + + // AWSDynamoDBTableNamesKey is the attribute Key conforming to the + // "aws.dynamodb.table_names" semantic conventions. It represents the keys in + // the `RequestItems` object field. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Users", "Cats" + AWSDynamoDBTableNamesKey = attribute.Key("aws.dynamodb.table_names") + + // AWSDynamoDBTotalSegmentsKey is the attribute Key conforming to the + // "aws.dynamodb.total_segments" semantic conventions. It represents the value + // of the `TotalSegments` request parameter. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + AWSDynamoDBTotalSegmentsKey = attribute.Key("aws.dynamodb.total_segments") + + // AWSECSClusterARNKey is the attribute Key conforming to the + // "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an + // [ECS cluster]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster" + // + // [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html + AWSECSClusterARNKey = attribute.Key("aws.ecs.cluster.arn") + + // AWSECSContainerARNKey is the attribute Key conforming to the + // "aws.ecs.container.arn" semantic conventions. It represents the Amazon + // Resource Name (ARN) of an [ECS container instance]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:ecs:us-west-1:123456789123:container/32624152-9086-4f0e-acae-1a75b14fe4d9" + // + // [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html + AWSECSContainerARNKey = attribute.Key("aws.ecs.container.arn") + + // AWSECSLaunchtypeKey is the attribute Key conforming to the + // "aws.ecs.launchtype" semantic conventions. It represents the [launch type] + // for an ECS task. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [launch type]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/launch_types.html + AWSECSLaunchtypeKey = attribute.Key("aws.ecs.launchtype") + + // AWSECSTaskARNKey is the attribute Key conforming to the "aws.ecs.task.arn" + // semantic conventions. It represents the ARN of a running [ECS task]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:ecs:us-west-1:123456789123:task/10838bed-421f-43ef-870a-f43feacbbb5b", + // "arn:aws:ecs:us-west-1:123456789123:task/my-cluster/task-id/23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd" + // + // [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids + AWSECSTaskARNKey = attribute.Key("aws.ecs.task.arn") + + // AWSECSTaskFamilyKey is the attribute Key conforming to the + // "aws.ecs.task.family" semantic conventions. It represents the family name of + // the [ECS task definition] used to create the ECS task. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-family" + // + // [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html + AWSECSTaskFamilyKey = attribute.Key("aws.ecs.task.family") + + // AWSECSTaskIDKey is the attribute Key conforming to the "aws.ecs.task.id" + // semantic conventions. It represents the ID of a running ECS task. The ID MUST + // be extracted from `task.arn`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "10838bed-421f-43ef-870a-f43feacbbb5b", + // "23ebb8ac-c18f-46c6-8bbe-d55d0e37cfbd" + AWSECSTaskIDKey = attribute.Key("aws.ecs.task.id") + + // AWSECSTaskRevisionKey is the attribute Key conforming to the + // "aws.ecs.task.revision" semantic conventions. It represents the revision for + // the task definition used to create the ECS task. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "8", "26" + AWSECSTaskRevisionKey = attribute.Key("aws.ecs.task.revision") + + // AWSEKSClusterARNKey is the attribute Key conforming to the + // "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS + // cluster. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:ecs:us-west-2:123456789123:cluster/my-cluster" + AWSEKSClusterARNKey = attribute.Key("aws.eks.cluster.arn") + + // AWSExtendedRequestIDKey is the attribute Key conforming to the + // "aws.extended_request_id" semantic conventions. It represents the AWS + // extended request ID as returned in the response header `x-amz-id-2`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "wzHcyEWfmOGDIE5QOhTAqFDoDWP3y8IUvpNINCwL9N4TEHbUw0/gZJ+VZTmCNCWR7fezEN3eCiQ=" + AWSExtendedRequestIDKey = attribute.Key("aws.extended_request_id") + + // AWSKinesisStreamNameKey is the attribute Key conforming to the + // "aws.kinesis.stream_name" semantic conventions. It represents the name of the + // AWS Kinesis [stream] the request refers to. Corresponds to the + // `--stream-name` parameter of the Kinesis [describe-stream] operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "some-stream-name" + // + // [stream]: https://docs.aws.amazon.com/streams/latest/dev/introduction.html + // [describe-stream]: https://docs.aws.amazon.com/cli/latest/reference/kinesis/describe-stream.html + AWSKinesisStreamNameKey = attribute.Key("aws.kinesis.stream_name") + + // AWSLambdaInvokedARNKey is the attribute Key conforming to the + // "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked + // ARN as provided on the `Context` passed to the function ( + // `Lambda-Runtime-Invoked-Function-Arn` header on the + // `/runtime/invocation/next` applicable). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:lambda:us-east-1:123456:function:myfunction:myalias" + // Note: This may be different from `cloud.resource_id` if an alias is involved. + AWSLambdaInvokedARNKey = attribute.Key("aws.lambda.invoked_arn") + + // AWSLambdaResourceMappingIDKey is the attribute Key conforming to the + // "aws.lambda.resource_mapping.id" semantic conventions. It represents the UUID + // of the [AWS Lambda EvenSource Mapping]. An event source is mapped to a lambda + // function. It's contents are read by Lambda and used to trigger a function. + // This isn't available in the lambda execution context or the lambda runtime + // environtment. This is going to be populated by the AWS SDK for each language + // when that UUID is present. Some of these operations are + // Create/Delete/Get/List/Update EventSourceMapping. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "587ad24b-03b9-4413-8202-bbd56b36e5b7" + // + // [AWS Lambda EvenSource Mapping]: https://docs.aws.amazon.com/AWSCloudFormation/latest/UserGuide/aws-resource-lambda-eventsourcemapping.html + AWSLambdaResourceMappingIDKey = attribute.Key("aws.lambda.resource_mapping.id") + + // AWSLogGroupARNsKey is the attribute Key conforming to the + // "aws.log.group.arns" semantic conventions. It represents the Amazon Resource + // Name(s) (ARN) of the AWS log group(s). + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:*" + // Note: See the [log group ARN format documentation]. + // + // [log group ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format + AWSLogGroupARNsKey = attribute.Key("aws.log.group.arns") + + // AWSLogGroupNamesKey is the attribute Key conforming to the + // "aws.log.group.names" semantic conventions. It represents the name(s) of the + // AWS log group(s) an application is writing to. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/aws/lambda/my-function", "opentelemetry-service" + // Note: Multiple log groups must be supported for cases like multi-container + // applications, where a single application has sidecar containers, and each + // write to their own log group. + AWSLogGroupNamesKey = attribute.Key("aws.log.group.names") + + // AWSLogStreamARNsKey is the attribute Key conforming to the + // "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the + // AWS log stream(s). + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:logs:us-west-1:123456789012:log-group:/aws/my/group:log-stream:logs/main/10838bed-421f-43ef-870a-f43feacbbb5b" + // Note: See the [log stream ARN format documentation]. One log group can + // contain several log streams, so these ARNs necessarily identify both a log + // group and a log stream. + // + // [log stream ARN format documentation]: https://docs.aws.amazon.com/AmazonCloudWatch/latest/logs/iam-access-control-overview-cwl.html#CWL_ARN_Format + AWSLogStreamARNsKey = attribute.Key("aws.log.stream.arns") + + // AWSLogStreamNamesKey is the attribute Key conforming to the + // "aws.log.stream.names" semantic conventions. It represents the name(s) of the + // AWS log stream(s) an application is writing to. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "logs/main/10838bed-421f-43ef-870a-f43feacbbb5b" + AWSLogStreamNamesKey = attribute.Key("aws.log.stream.names") + + // AWSRequestIDKey is the attribute Key conforming to the "aws.request_id" + // semantic conventions. It represents the AWS request ID as returned in the + // response headers `x-amzn-requestid`, `x-amzn-request-id` or + // `x-amz-request-id`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "79b9da39-b7ae-508a-a6bc-864b2829c622", "C9ER4AJX75574TDJ" + AWSRequestIDKey = attribute.Key("aws.request_id") + + // AWSS3BucketKey is the attribute Key conforming to the "aws.s3.bucket" + // semantic conventions. It represents the S3 bucket name the request refers to. + // Corresponds to the `--bucket` parameter of the [S3 API] operations. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "some-bucket-name" + // Note: The `bucket` attribute is applicable to all S3 operations that + // reference a bucket, i.e. that require the bucket name as a mandatory + // parameter. + // This applies to almost all S3 operations except `list-buckets`. + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + AWSS3BucketKey = attribute.Key("aws.s3.bucket") + + // AWSS3CopySourceKey is the attribute Key conforming to the + // "aws.s3.copy_source" semantic conventions. It represents the source object + // (in the form `bucket`/`key`) for the copy operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "someFile.yml" + // Note: The `copy_source` attribute applies to S3 copy operations and + // corresponds to the `--copy-source` parameter + // of the [copy-object operation within the S3 API]. + // This applies in particular to the following operations: + // + // - [copy-object] + // - [upload-part-copy] + // + // + // [copy-object operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3CopySourceKey = attribute.Key("aws.s3.copy_source") + + // AWSS3DeleteKey is the attribute Key conforming to the "aws.s3.delete" + // semantic conventions. It represents the delete request container that + // specifies the objects to be deleted. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "Objects=[{Key=string,VersionId=string},{Key=string,VersionId=string}],Quiet=boolean" + // Note: The `delete` attribute is only applicable to the [delete-object] + // operation. + // The `delete` attribute corresponds to the `--delete` parameter of the + // [delete-objects operation within the S3 API]. + // + // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html + // [delete-objects operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-objects.html + AWSS3DeleteKey = attribute.Key("aws.s3.delete") + + // AWSS3KeyKey is the attribute Key conforming to the "aws.s3.key" semantic + // conventions. It represents the S3 object key the request refers to. + // Corresponds to the `--key` parameter of the [S3 API] operations. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "someFile.yml" + // Note: The `key` attribute is applicable to all object-related S3 operations, + // i.e. that require the object key as a mandatory parameter. + // This applies in particular to the following operations: + // + // - [copy-object] + // - [delete-object] + // - [get-object] + // - [head-object] + // - [put-object] + // - [restore-object] + // - [select-object-content] + // - [abort-multipart-upload] + // - [complete-multipart-upload] + // - [create-multipart-upload] + // - [list-parts] + // - [upload-part] + // - [upload-part-copy] + // + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + // [copy-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/copy-object.html + // [delete-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/delete-object.html + // [get-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/get-object.html + // [head-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/head-object.html + // [put-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/put-object.html + // [restore-object]: https://docs.aws.amazon.com/cli/latest/reference/s3api/restore-object.html + // [select-object-content]: https://docs.aws.amazon.com/cli/latest/reference/s3api/select-object-content.html + // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html + // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html + // [create-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/create-multipart-upload.html + // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3KeyKey = attribute.Key("aws.s3.key") + + // AWSS3PartNumberKey is the attribute Key conforming to the + // "aws.s3.part_number" semantic conventions. It represents the part number of + // the part being uploaded in a multipart-upload operation. This is a positive + // integer between 1 and 10,000. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3456 + // Note: The `part_number` attribute is only applicable to the [upload-part] + // and [upload-part-copy] operations. + // The `part_number` attribute corresponds to the `--part-number` parameter of + // the + // [upload-part operation within the S3 API]. + // + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + // [upload-part operation within the S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + AWSS3PartNumberKey = attribute.Key("aws.s3.part_number") + + // AWSS3UploadIDKey is the attribute Key conforming to the "aws.s3.upload_id" + // semantic conventions. It represents the upload ID that identifies the + // multipart upload. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "dfRtDYWFbkRONycy.Yxwh66Yjlx.cph0gtNBtJ" + // Note: The `upload_id` attribute applies to S3 multipart-upload operations and + // corresponds to the `--upload-id` parameter + // of the [S3 API] multipart operations. + // This applies in particular to the following operations: + // + // - [abort-multipart-upload] + // - [complete-multipart-upload] + // - [list-parts] + // - [upload-part] + // - [upload-part-copy] + // + // + // [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html + // [abort-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/abort-multipart-upload.html + // [complete-multipart-upload]: https://docs.aws.amazon.com/cli/latest/reference/s3api/complete-multipart-upload.html + // [list-parts]: https://docs.aws.amazon.com/cli/latest/reference/s3api/list-parts.html + // [upload-part]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part.html + // [upload-part-copy]: https://docs.aws.amazon.com/cli/latest/reference/s3api/upload-part-copy.html + AWSS3UploadIDKey = attribute.Key("aws.s3.upload_id") + + // AWSSecretsmanagerSecretARNKey is the attribute Key conforming to the + // "aws.secretsmanager.secret.arn" semantic conventions. It represents the ARN + // of the Secret stored in the Secrets Mangger. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:secretsmanager:us-east-1:123456789012:secret:SecretName-6RandomCharacters" + AWSSecretsmanagerSecretARNKey = attribute.Key("aws.secretsmanager.secret.arn") + + // AWSSNSTopicARNKey is the attribute Key conforming to the "aws.sns.topic.arn" + // semantic conventions. It represents the ARN of the AWS SNS Topic. An Amazon + // SNS [topic] is a logical access point that acts as a communication channel. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:sns:us-east-1:123456789012:mystack-mytopic-NZJ5JSMVGFIE" + // + // [topic]: https://docs.aws.amazon.com/sns/latest/dg/sns-create-topic.html + AWSSNSTopicARNKey = attribute.Key("aws.sns.topic.arn") + + // AWSSQSQueueURLKey is the attribute Key conforming to the "aws.sqs.queue.url" + // semantic conventions. It represents the URL of the AWS SQS Queue. It's a + // unique identifier for a queue in Amazon Simple Queue Service (SQS) and is + // used to access the queue and perform actions on it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://sqs.us-east-1.amazonaws.com/123456789012/MyQueue" + AWSSQSQueueURLKey = attribute.Key("aws.sqs.queue.url") + + // AWSStepFunctionsActivityARNKey is the attribute Key conforming to the + // "aws.step_functions.activity.arn" semantic conventions. It represents the ARN + // of the AWS Step Functions Activity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:states:us-east-1:123456789012:activity:get-greeting" + AWSStepFunctionsActivityARNKey = attribute.Key("aws.step_functions.activity.arn") + + // AWSStepFunctionsStateMachineARNKey is the attribute Key conforming to the + // "aws.step_functions.state_machine.arn" semantic conventions. It represents + // the ARN of the AWS Step Functions State Machine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "arn:aws:states:us-east-1:123456789012:stateMachine:myStateMachine:1" + AWSStepFunctionsStateMachineARNKey = attribute.Key("aws.step_functions.state_machine.arn") +) + +// AWSBedrockGuardrailID returns an attribute KeyValue conforming to the +// "aws.bedrock.guardrail.id" semantic conventions. It represents the unique +// identifier of the AWS Bedrock Guardrail. A [guardrail] helps safeguard and +// prevent unwanted behavior from model responses or user messages. +// +// [guardrail]: https://docs.aws.amazon.com/bedrock/latest/userguide/guardrails.html +func AWSBedrockGuardrailID(val string) attribute.KeyValue { + return AWSBedrockGuardrailIDKey.String(val) +} + +// AWSBedrockKnowledgeBaseID returns an attribute KeyValue conforming to the +// "aws.bedrock.knowledge_base.id" semantic conventions. It represents the unique +// identifier of the AWS Bedrock Knowledge base. A [knowledge base] is a bank of +// information that can be queried by models to generate more relevant responses +// and augment prompts. +// +// [knowledge base]: https://docs.aws.amazon.com/bedrock/latest/userguide/knowledge-base.html +func AWSBedrockKnowledgeBaseID(val string) attribute.KeyValue { + return AWSBedrockKnowledgeBaseIDKey.String(val) +} + +// AWSDynamoDBAttributeDefinitions returns an attribute KeyValue conforming to +// the "aws.dynamodb.attribute_definitions" semantic conventions. It represents +// the JSON-serialized value of each item in the `AttributeDefinitions` request +// field. +func AWSDynamoDBAttributeDefinitions(val ...string) attribute.KeyValue { + return AWSDynamoDBAttributeDefinitionsKey.StringSlice(val) +} + +// AWSDynamoDBAttributesToGet returns an attribute KeyValue conforming to the +// "aws.dynamodb.attributes_to_get" semantic conventions. It represents the value +// of the `AttributesToGet` request parameter. +func AWSDynamoDBAttributesToGet(val ...string) attribute.KeyValue { + return AWSDynamoDBAttributesToGetKey.StringSlice(val) +} + +// AWSDynamoDBConsistentRead returns an attribute KeyValue conforming to the +// "aws.dynamodb.consistent_read" semantic conventions. It represents the value +// of the `ConsistentRead` request parameter. +func AWSDynamoDBConsistentRead(val bool) attribute.KeyValue { + return AWSDynamoDBConsistentReadKey.Bool(val) +} + +// AWSDynamoDBConsumedCapacity returns an attribute KeyValue conforming to the +// "aws.dynamodb.consumed_capacity" semantic conventions. It represents the +// JSON-serialized value of each item in the `ConsumedCapacity` response field. +func AWSDynamoDBConsumedCapacity(val ...string) attribute.KeyValue { + return AWSDynamoDBConsumedCapacityKey.StringSlice(val) +} + +// AWSDynamoDBCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.count" semantic conventions. It represents the value of the +// `Count` response parameter. +func AWSDynamoDBCount(val int) attribute.KeyValue { + return AWSDynamoDBCountKey.Int(val) +} + +// AWSDynamoDBExclusiveStartTable returns an attribute KeyValue conforming to the +// "aws.dynamodb.exclusive_start_table" semantic conventions. It represents the +// value of the `ExclusiveStartTableName` request parameter. +func AWSDynamoDBExclusiveStartTable(val string) attribute.KeyValue { + return AWSDynamoDBExclusiveStartTableKey.String(val) +} + +// AWSDynamoDBGlobalSecondaryIndexUpdates returns an attribute KeyValue +// conforming to the "aws.dynamodb.global_secondary_index_updates" semantic +// conventions. It represents the JSON-serialized value of each item in the +// `GlobalSecondaryIndexUpdates` request field. +func AWSDynamoDBGlobalSecondaryIndexUpdates(val ...string) attribute.KeyValue { + return AWSDynamoDBGlobalSecondaryIndexUpdatesKey.StringSlice(val) +} + +// AWSDynamoDBGlobalSecondaryIndexes returns an attribute KeyValue conforming to +// the "aws.dynamodb.global_secondary_indexes" semantic conventions. It +// represents the JSON-serialized value of each item of the +// `GlobalSecondaryIndexes` request field. +func AWSDynamoDBGlobalSecondaryIndexes(val ...string) attribute.KeyValue { + return AWSDynamoDBGlobalSecondaryIndexesKey.StringSlice(val) +} + +// AWSDynamoDBIndexName returns an attribute KeyValue conforming to the +// "aws.dynamodb.index_name" semantic conventions. It represents the value of the +// `IndexName` request parameter. +func AWSDynamoDBIndexName(val string) attribute.KeyValue { + return AWSDynamoDBIndexNameKey.String(val) +} + +// AWSDynamoDBItemCollectionMetrics returns an attribute KeyValue conforming to +// the "aws.dynamodb.item_collection_metrics" semantic conventions. It represents +// the JSON-serialized value of the `ItemCollectionMetrics` response field. +func AWSDynamoDBItemCollectionMetrics(val string) attribute.KeyValue { + return AWSDynamoDBItemCollectionMetricsKey.String(val) +} + +// AWSDynamoDBLimit returns an attribute KeyValue conforming to the +// "aws.dynamodb.limit" semantic conventions. It represents the value of the +// `Limit` request parameter. +func AWSDynamoDBLimit(val int) attribute.KeyValue { + return AWSDynamoDBLimitKey.Int(val) +} + +// AWSDynamoDBLocalSecondaryIndexes returns an attribute KeyValue conforming to +// the "aws.dynamodb.local_secondary_indexes" semantic conventions. It represents +// the JSON-serialized value of each item of the `LocalSecondaryIndexes` request +// field. +func AWSDynamoDBLocalSecondaryIndexes(val ...string) attribute.KeyValue { + return AWSDynamoDBLocalSecondaryIndexesKey.StringSlice(val) +} + +// AWSDynamoDBProjection returns an attribute KeyValue conforming to the +// "aws.dynamodb.projection" semantic conventions. It represents the value of the +// `ProjectionExpression` request parameter. +func AWSDynamoDBProjection(val string) attribute.KeyValue { + return AWSDynamoDBProjectionKey.String(val) +} + +// AWSDynamoDBProvisionedReadCapacity returns an attribute KeyValue conforming to +// the "aws.dynamodb.provisioned_read_capacity" semantic conventions. It +// represents the value of the `ProvisionedThroughput.ReadCapacityUnits` request +// parameter. +func AWSDynamoDBProvisionedReadCapacity(val float64) attribute.KeyValue { + return AWSDynamoDBProvisionedReadCapacityKey.Float64(val) +} + +// AWSDynamoDBProvisionedWriteCapacity returns an attribute KeyValue conforming +// to the "aws.dynamodb.provisioned_write_capacity" semantic conventions. It +// represents the value of the `ProvisionedThroughput.WriteCapacityUnits` request +// parameter. +func AWSDynamoDBProvisionedWriteCapacity(val float64) attribute.KeyValue { + return AWSDynamoDBProvisionedWriteCapacityKey.Float64(val) +} + +// AWSDynamoDBScanForward returns an attribute KeyValue conforming to the +// "aws.dynamodb.scan_forward" semantic conventions. It represents the value of +// the `ScanIndexForward` request parameter. +func AWSDynamoDBScanForward(val bool) attribute.KeyValue { + return AWSDynamoDBScanForwardKey.Bool(val) +} + +// AWSDynamoDBScannedCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.scanned_count" semantic conventions. It represents the value of +// the `ScannedCount` response parameter. +func AWSDynamoDBScannedCount(val int) attribute.KeyValue { + return AWSDynamoDBScannedCountKey.Int(val) +} + +// AWSDynamoDBSegment returns an attribute KeyValue conforming to the +// "aws.dynamodb.segment" semantic conventions. It represents the value of the +// `Segment` request parameter. +func AWSDynamoDBSegment(val int) attribute.KeyValue { + return AWSDynamoDBSegmentKey.Int(val) +} + +// AWSDynamoDBSelect returns an attribute KeyValue conforming to the +// "aws.dynamodb.select" semantic conventions. It represents the value of the +// `Select` request parameter. +func AWSDynamoDBSelect(val string) attribute.KeyValue { + return AWSDynamoDBSelectKey.String(val) +} + +// AWSDynamoDBTableCount returns an attribute KeyValue conforming to the +// "aws.dynamodb.table_count" semantic conventions. It represents the number of +// items in the `TableNames` response parameter. +func AWSDynamoDBTableCount(val int) attribute.KeyValue { + return AWSDynamoDBTableCountKey.Int(val) +} + +// AWSDynamoDBTableNames returns an attribute KeyValue conforming to the +// "aws.dynamodb.table_names" semantic conventions. It represents the keys in the +// `RequestItems` object field. +func AWSDynamoDBTableNames(val ...string) attribute.KeyValue { + return AWSDynamoDBTableNamesKey.StringSlice(val) +} + +// AWSDynamoDBTotalSegments returns an attribute KeyValue conforming to the +// "aws.dynamodb.total_segments" semantic conventions. It represents the value of +// the `TotalSegments` request parameter. +func AWSDynamoDBTotalSegments(val int) attribute.KeyValue { + return AWSDynamoDBTotalSegmentsKey.Int(val) +} + +// AWSECSClusterARN returns an attribute KeyValue conforming to the +// "aws.ecs.cluster.arn" semantic conventions. It represents the ARN of an +// [ECS cluster]. +// +// [ECS cluster]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/clusters.html +func AWSECSClusterARN(val string) attribute.KeyValue { + return AWSECSClusterARNKey.String(val) +} + +// AWSECSContainerARN returns an attribute KeyValue conforming to the +// "aws.ecs.container.arn" semantic conventions. It represents the Amazon +// Resource Name (ARN) of an [ECS container instance]. +// +// [ECS container instance]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ECS_instances.html +func AWSECSContainerARN(val string) attribute.KeyValue { + return AWSECSContainerARNKey.String(val) +} + +// AWSECSTaskARN returns an attribute KeyValue conforming to the +// "aws.ecs.task.arn" semantic conventions. It represents the ARN of a running +// [ECS task]. +// +// [ECS task]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/ecs-account-settings.html#ecs-resource-ids +func AWSECSTaskARN(val string) attribute.KeyValue { + return AWSECSTaskARNKey.String(val) +} + +// AWSECSTaskFamily returns an attribute KeyValue conforming to the +// "aws.ecs.task.family" semantic conventions. It represents the family name of +// the [ECS task definition] used to create the ECS task. +// +// [ECS task definition]: https://docs.aws.amazon.com/AmazonECS/latest/developerguide/task_definitions.html +func AWSECSTaskFamily(val string) attribute.KeyValue { + return AWSECSTaskFamilyKey.String(val) +} + +// AWSECSTaskID returns an attribute KeyValue conforming to the "aws.ecs.task.id" +// semantic conventions. It represents the ID of a running ECS task. The ID MUST +// be extracted from `task.arn`. +func AWSECSTaskID(val string) attribute.KeyValue { + return AWSECSTaskIDKey.String(val) +} + +// AWSECSTaskRevision returns an attribute KeyValue conforming to the +// "aws.ecs.task.revision" semantic conventions. It represents the revision for +// the task definition used to create the ECS task. +func AWSECSTaskRevision(val string) attribute.KeyValue { + return AWSECSTaskRevisionKey.String(val) +} + +// AWSEKSClusterARN returns an attribute KeyValue conforming to the +// "aws.eks.cluster.arn" semantic conventions. It represents the ARN of an EKS +// cluster. +func AWSEKSClusterARN(val string) attribute.KeyValue { + return AWSEKSClusterARNKey.String(val) +} + +// AWSExtendedRequestID returns an attribute KeyValue conforming to the +// "aws.extended_request_id" semantic conventions. It represents the AWS extended +// request ID as returned in the response header `x-amz-id-2`. +func AWSExtendedRequestID(val string) attribute.KeyValue { + return AWSExtendedRequestIDKey.String(val) +} + +// AWSKinesisStreamName returns an attribute KeyValue conforming to the +// "aws.kinesis.stream_name" semantic conventions. It represents the name of the +// AWS Kinesis [stream] the request refers to. Corresponds to the `--stream-name` +// parameter of the Kinesis [describe-stream] operation. +// +// [stream]: https://docs.aws.amazon.com/streams/latest/dev/introduction.html +// [describe-stream]: https://docs.aws.amazon.com/cli/latest/reference/kinesis/describe-stream.html +func AWSKinesisStreamName(val string) attribute.KeyValue { + return AWSKinesisStreamNameKey.String(val) +} + +// AWSLambdaInvokedARN returns an attribute KeyValue conforming to the +// "aws.lambda.invoked_arn" semantic conventions. It represents the full invoked +// ARN as provided on the `Context` passed to the function ( +// `Lambda-Runtime-Invoked-Function-Arn` header on the `/runtime/invocation/next` +// applicable). +func AWSLambdaInvokedARN(val string) attribute.KeyValue { + return AWSLambdaInvokedARNKey.String(val) +} + +// AWSLambdaResourceMappingID returns an attribute KeyValue conforming to the +// "aws.lambda.resource_mapping.id" semantic conventions. It represents the UUID +// of the [AWS Lambda EvenSource Mapping]. An event source is mapped to a lambda +// function. It's contents are read by Lambda and used to trigger a function. +// This isn't available in the lambda execution context or the lambda runtime +// environtment. This is going to be populated by the AWS SDK for each language +// when that UUID is present. Some of these operations are +// Create/Delete/Get/List/Update EventSourceMapping. +// +// [AWS Lambda EvenSource Mapping]: https://docs.aws.amazon.com/AWSCloudFormation/latest/UserGuide/aws-resource-lambda-eventsourcemapping.html +func AWSLambdaResourceMappingID(val string) attribute.KeyValue { + return AWSLambdaResourceMappingIDKey.String(val) +} + +// AWSLogGroupARNs returns an attribute KeyValue conforming to the +// "aws.log.group.arns" semantic conventions. It represents the Amazon Resource +// Name(s) (ARN) of the AWS log group(s). +func AWSLogGroupARNs(val ...string) attribute.KeyValue { + return AWSLogGroupARNsKey.StringSlice(val) +} + +// AWSLogGroupNames returns an attribute KeyValue conforming to the +// "aws.log.group.names" semantic conventions. It represents the name(s) of the +// AWS log group(s) an application is writing to. +func AWSLogGroupNames(val ...string) attribute.KeyValue { + return AWSLogGroupNamesKey.StringSlice(val) +} + +// AWSLogStreamARNs returns an attribute KeyValue conforming to the +// "aws.log.stream.arns" semantic conventions. It represents the ARN(s) of the +// AWS log stream(s). +func AWSLogStreamARNs(val ...string) attribute.KeyValue { + return AWSLogStreamARNsKey.StringSlice(val) +} + +// AWSLogStreamNames returns an attribute KeyValue conforming to the +// "aws.log.stream.names" semantic conventions. It represents the name(s) of the +// AWS log stream(s) an application is writing to. +func AWSLogStreamNames(val ...string) attribute.KeyValue { + return AWSLogStreamNamesKey.StringSlice(val) +} + +// AWSRequestID returns an attribute KeyValue conforming to the "aws.request_id" +// semantic conventions. It represents the AWS request ID as returned in the +// response headers `x-amzn-requestid`, `x-amzn-request-id` or `x-amz-request-id` +// . +func AWSRequestID(val string) attribute.KeyValue { + return AWSRequestIDKey.String(val) +} + +// AWSS3Bucket returns an attribute KeyValue conforming to the "aws.s3.bucket" +// semantic conventions. It represents the S3 bucket name the request refers to. +// Corresponds to the `--bucket` parameter of the [S3 API] operations. +// +// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html +func AWSS3Bucket(val string) attribute.KeyValue { + return AWSS3BucketKey.String(val) +} + +// AWSS3CopySource returns an attribute KeyValue conforming to the +// "aws.s3.copy_source" semantic conventions. It represents the source object (in +// the form `bucket`/`key`) for the copy operation. +func AWSS3CopySource(val string) attribute.KeyValue { + return AWSS3CopySourceKey.String(val) +} + +// AWSS3Delete returns an attribute KeyValue conforming to the "aws.s3.delete" +// semantic conventions. It represents the delete request container that +// specifies the objects to be deleted. +func AWSS3Delete(val string) attribute.KeyValue { + return AWSS3DeleteKey.String(val) +} + +// AWSS3Key returns an attribute KeyValue conforming to the "aws.s3.key" semantic +// conventions. It represents the S3 object key the request refers to. +// Corresponds to the `--key` parameter of the [S3 API] operations. +// +// [S3 API]: https://docs.aws.amazon.com/cli/latest/reference/s3api/index.html +func AWSS3Key(val string) attribute.KeyValue { + return AWSS3KeyKey.String(val) +} + +// AWSS3PartNumber returns an attribute KeyValue conforming to the +// "aws.s3.part_number" semantic conventions. It represents the part number of +// the part being uploaded in a multipart-upload operation. This is a positive +// integer between 1 and 10,000. +func AWSS3PartNumber(val int) attribute.KeyValue { + return AWSS3PartNumberKey.Int(val) +} + +// AWSS3UploadID returns an attribute KeyValue conforming to the +// "aws.s3.upload_id" semantic conventions. It represents the upload ID that +// identifies the multipart upload. +func AWSS3UploadID(val string) attribute.KeyValue { + return AWSS3UploadIDKey.String(val) +} + +// AWSSecretsmanagerSecretARN returns an attribute KeyValue conforming to the +// "aws.secretsmanager.secret.arn" semantic conventions. It represents the ARN of +// the Secret stored in the Secrets Mangger. +func AWSSecretsmanagerSecretARN(val string) attribute.KeyValue { + return AWSSecretsmanagerSecretARNKey.String(val) +} + +// AWSSNSTopicARN returns an attribute KeyValue conforming to the +// "aws.sns.topic.arn" semantic conventions. It represents the ARN of the AWS SNS +// Topic. An Amazon SNS [topic] is a logical access point that acts as a +// communication channel. +// +// [topic]: https://docs.aws.amazon.com/sns/latest/dg/sns-create-topic.html +func AWSSNSTopicARN(val string) attribute.KeyValue { + return AWSSNSTopicARNKey.String(val) +} + +// AWSSQSQueueURL returns an attribute KeyValue conforming to the +// "aws.sqs.queue.url" semantic conventions. It represents the URL of the AWS SQS +// Queue. It's a unique identifier for a queue in Amazon Simple Queue Service +// (SQS) and is used to access the queue and perform actions on it. +func AWSSQSQueueURL(val string) attribute.KeyValue { + return AWSSQSQueueURLKey.String(val) +} + +// AWSStepFunctionsActivityARN returns an attribute KeyValue conforming to the +// "aws.step_functions.activity.arn" semantic conventions. It represents the ARN +// of the AWS Step Functions Activity. +func AWSStepFunctionsActivityARN(val string) attribute.KeyValue { + return AWSStepFunctionsActivityARNKey.String(val) +} + +// AWSStepFunctionsStateMachineARN returns an attribute KeyValue conforming to +// the "aws.step_functions.state_machine.arn" semantic conventions. It represents +// the ARN of the AWS Step Functions State Machine. +func AWSStepFunctionsStateMachineARN(val string) attribute.KeyValue { + return AWSStepFunctionsStateMachineARNKey.String(val) +} + +// Enum values for aws.ecs.launchtype +var ( + // ec2 + // Stability: development + AWSECSLaunchtypeEC2 = AWSECSLaunchtypeKey.String("ec2") + // fargate + // Stability: development + AWSECSLaunchtypeFargate = AWSECSLaunchtypeKey.String("fargate") +) + +// Namespace: az +const ( + // AzNamespaceKey is the attribute Key conforming to the "az.namespace" semantic + // conventions. It represents the [Azure Resource Provider Namespace] as + // recognized by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Microsoft.Storage", "Microsoft.KeyVault", "Microsoft.ServiceBus" + // + // [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers + AzNamespaceKey = attribute.Key("az.namespace") + + // AzServiceRequestIDKey is the attribute Key conforming to the + // "az.service_request_id" semantic conventions. It represents the unique + // identifier of the service request. It's generated by the Azure service and + // returned with the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "00000000-0000-0000-0000-000000000000" + AzServiceRequestIDKey = attribute.Key("az.service_request_id") +) + +// AzNamespace returns an attribute KeyValue conforming to the "az.namespace" +// semantic conventions. It represents the [Azure Resource Provider Namespace] as +// recognized by the client. +// +// [Azure Resource Provider Namespace]: https://learn.microsoft.com/azure/azure-resource-manager/management/azure-services-resource-providers +func AzNamespace(val string) attribute.KeyValue { + return AzNamespaceKey.String(val) +} + +// AzServiceRequestID returns an attribute KeyValue conforming to the +// "az.service_request_id" semantic conventions. It represents the unique +// identifier of the service request. It's generated by the Azure service and +// returned with the response. +func AzServiceRequestID(val string) attribute.KeyValue { + return AzServiceRequestIDKey.String(val) +} + +// Namespace: azure +const ( + // AzureClientIDKey is the attribute Key conforming to the "azure.client.id" + // semantic conventions. It represents the unique identifier of the client + // instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "3ba4827d-4422-483f-b59f-85b74211c11d", "storage-client-1" + AzureClientIDKey = attribute.Key("azure.client.id") + + // AzureCosmosDBConnectionModeKey is the attribute Key conforming to the + // "azure.cosmosdb.connection.mode" semantic conventions. It represents the + // cosmos client connection mode. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AzureCosmosDBConnectionModeKey = attribute.Key("azure.cosmosdb.connection.mode") + + // AzureCosmosDBConsistencyLevelKey is the attribute Key conforming to the + // "azure.cosmosdb.consistency.level" semantic conventions. It represents the + // account or request [consistency level]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Eventual", "ConsistentPrefix", "BoundedStaleness", "Strong", + // "Session" + // + // [consistency level]: https://learn.microsoft.com/azure/cosmos-db/consistency-levels + AzureCosmosDBConsistencyLevelKey = attribute.Key("azure.cosmosdb.consistency.level") + + // AzureCosmosDBOperationContactedRegionsKey is the attribute Key conforming to + // the "azure.cosmosdb.operation.contacted_regions" semantic conventions. It + // represents the list of regions contacted during operation in the order that + // they were contacted. If there is more than one region listed, it indicates + // that the operation was performed on multiple regions i.e. cross-regional + // call. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "North Central US", "Australia East", "Australia Southeast" + // Note: Region name matches the format of `displayName` in [Azure Location API] + // + // [Azure Location API]: https://learn.microsoft.com/rest/api/subscription/subscriptions/list-locations?view=rest-subscription-2021-10-01&tabs=HTTP#location + AzureCosmosDBOperationContactedRegionsKey = attribute.Key("azure.cosmosdb.operation.contacted_regions") + + // AzureCosmosDBOperationRequestChargeKey is the attribute Key conforming to the + // "azure.cosmosdb.operation.request_charge" semantic conventions. It represents + // the number of request units consumed by the operation. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 46.18, 1.0 + AzureCosmosDBOperationRequestChargeKey = attribute.Key("azure.cosmosdb.operation.request_charge") + + // AzureCosmosDBRequestBodySizeKey is the attribute Key conforming to the + // "azure.cosmosdb.request.body.size" semantic conventions. It represents the + // request payload size in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + AzureCosmosDBRequestBodySizeKey = attribute.Key("azure.cosmosdb.request.body.size") + + // AzureCosmosDBResponseSubStatusCodeKey is the attribute Key conforming to the + // "azure.cosmosdb.response.sub_status_code" semantic conventions. It represents + // the cosmos DB sub status code. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1000, 1002 + AzureCosmosDBResponseSubStatusCodeKey = attribute.Key("azure.cosmosdb.response.sub_status_code") +) + +// AzureClientID returns an attribute KeyValue conforming to the +// "azure.client.id" semantic conventions. It represents the unique identifier of +// the client instance. +func AzureClientID(val string) attribute.KeyValue { + return AzureClientIDKey.String(val) +} + +// AzureCosmosDBOperationContactedRegions returns an attribute KeyValue +// conforming to the "azure.cosmosdb.operation.contacted_regions" semantic +// conventions. It represents the list of regions contacted during operation in +// the order that they were contacted. If there is more than one region listed, +// it indicates that the operation was performed on multiple regions i.e. +// cross-regional call. +func AzureCosmosDBOperationContactedRegions(val ...string) attribute.KeyValue { + return AzureCosmosDBOperationContactedRegionsKey.StringSlice(val) +} + +// AzureCosmosDBOperationRequestCharge returns an attribute KeyValue conforming +// to the "azure.cosmosdb.operation.request_charge" semantic conventions. It +// represents the number of request units consumed by the operation. +func AzureCosmosDBOperationRequestCharge(val float64) attribute.KeyValue { + return AzureCosmosDBOperationRequestChargeKey.Float64(val) +} + +// AzureCosmosDBRequestBodySize returns an attribute KeyValue conforming to the +// "azure.cosmosdb.request.body.size" semantic conventions. It represents the +// request payload size in bytes. +func AzureCosmosDBRequestBodySize(val int) attribute.KeyValue { + return AzureCosmosDBRequestBodySizeKey.Int(val) +} + +// AzureCosmosDBResponseSubStatusCode returns an attribute KeyValue conforming to +// the "azure.cosmosdb.response.sub_status_code" semantic conventions. It +// represents the cosmos DB sub status code. +func AzureCosmosDBResponseSubStatusCode(val int) attribute.KeyValue { + return AzureCosmosDBResponseSubStatusCodeKey.Int(val) +} + +// Enum values for azure.cosmosdb.connection.mode +var ( + // Gateway (HTTP) connection. + // Stability: development + AzureCosmosDBConnectionModeGateway = AzureCosmosDBConnectionModeKey.String("gateway") + // Direct connection. + // Stability: development + AzureCosmosDBConnectionModeDirect = AzureCosmosDBConnectionModeKey.String("direct") +) + +// Enum values for azure.cosmosdb.consistency.level +var ( + // strong + // Stability: development + AzureCosmosDBConsistencyLevelStrong = AzureCosmosDBConsistencyLevelKey.String("Strong") + // bounded_staleness + // Stability: development + AzureCosmosDBConsistencyLevelBoundedStaleness = AzureCosmosDBConsistencyLevelKey.String("BoundedStaleness") + // session + // Stability: development + AzureCosmosDBConsistencyLevelSession = AzureCosmosDBConsistencyLevelKey.String("Session") + // eventual + // Stability: development + AzureCosmosDBConsistencyLevelEventual = AzureCosmosDBConsistencyLevelKey.String("Eventual") + // consistent_prefix + // Stability: development + AzureCosmosDBConsistencyLevelConsistentPrefix = AzureCosmosDBConsistencyLevelKey.String("ConsistentPrefix") +) + +// Namespace: browser +const ( + // BrowserBrandsKey is the attribute Key conforming to the "browser.brands" + // semantic conventions. It represents the array of brand name and version + // separated by a space. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: " Not A;Brand 99", "Chromium 99", "Chrome 99" + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.brands`). + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + BrowserBrandsKey = attribute.Key("browser.brands") + + // BrowserLanguageKey is the attribute Key conforming to the "browser.language" + // semantic conventions. It represents the preferred language of the user using + // the browser. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "en", "en-US", "fr", "fr-FR" + // Note: This value is intended to be taken from the Navigator API + // `navigator.language`. + BrowserLanguageKey = attribute.Key("browser.language") + + // BrowserMobileKey is the attribute Key conforming to the "browser.mobile" + // semantic conventions. It represents a boolean that is true if the browser is + // running on a mobile device. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.mobile`). If unavailable, this attribute SHOULD be + // left unset. + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + BrowserMobileKey = attribute.Key("browser.mobile") + + // BrowserPlatformKey is the attribute Key conforming to the "browser.platform" + // semantic conventions. It represents the platform on which the browser is + // running. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Windows", "macOS", "Android" + // Note: This value is intended to be taken from the [UA client hints API] ( + // `navigator.userAgentData.platform`). If unavailable, the legacy + // `navigator.platform` API SHOULD NOT be used instead and this attribute SHOULD + // be left unset in order for the values to be consistent. + // The list of possible values is defined in the + // [W3C User-Agent Client Hints specification]. Note that some (but not all) of + // these values can overlap with values in the + // [`os.type` and `os.name` attributes]. However, for consistency, the values in + // the `browser.platform` attribute should capture the exact value that the user + // agent provides. + // + // [UA client hints API]: https://wicg.github.io/ua-client-hints/#interface + // [W3C User-Agent Client Hints specification]: https://wicg.github.io/ua-client-hints/#sec-ch-ua-platform + // [`os.type` and `os.name` attributes]: ./os.md + BrowserPlatformKey = attribute.Key("browser.platform") +) + +// BrowserBrands returns an attribute KeyValue conforming to the "browser.brands" +// semantic conventions. It represents the array of brand name and version +// separated by a space. +func BrowserBrands(val ...string) attribute.KeyValue { + return BrowserBrandsKey.StringSlice(val) +} + +// BrowserLanguage returns an attribute KeyValue conforming to the +// "browser.language" semantic conventions. It represents the preferred language +// of the user using the browser. +func BrowserLanguage(val string) attribute.KeyValue { + return BrowserLanguageKey.String(val) +} + +// BrowserMobile returns an attribute KeyValue conforming to the "browser.mobile" +// semantic conventions. It represents a boolean that is true if the browser is +// running on a mobile device. +func BrowserMobile(val bool) attribute.KeyValue { + return BrowserMobileKey.Bool(val) +} + +// BrowserPlatform returns an attribute KeyValue conforming to the +// "browser.platform" semantic conventions. It represents the platform on which +// the browser is running. +func BrowserPlatform(val string) attribute.KeyValue { + return BrowserPlatformKey.String(val) +} + +// Namespace: cassandra +const ( + // CassandraConsistencyLevelKey is the attribute Key conforming to the + // "cassandra.consistency.level" semantic conventions. It represents the + // consistency level of the query. Based on consistency values from [CQL]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [CQL]: https://docs.datastax.com/en/cassandra-oss/3.0/cassandra/dml/dmlConfigConsistency.html + CassandraConsistencyLevelKey = attribute.Key("cassandra.consistency.level") + + // CassandraCoordinatorDCKey is the attribute Key conforming to the + // "cassandra.coordinator.dc" semantic conventions. It represents the data + // center of the coordinating node for a query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: us-west-2 + CassandraCoordinatorDCKey = attribute.Key("cassandra.coordinator.dc") + + // CassandraCoordinatorIDKey is the attribute Key conforming to the + // "cassandra.coordinator.id" semantic conventions. It represents the ID of the + // coordinating node for a query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: be13faa2-8574-4d71-926d-27f16cf8a7af + CassandraCoordinatorIDKey = attribute.Key("cassandra.coordinator.id") + + // CassandraPageSizeKey is the attribute Key conforming to the + // "cassandra.page.size" semantic conventions. It represents the fetch size used + // for paging, i.e. how many rows will be returned at once. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 5000 + CassandraPageSizeKey = attribute.Key("cassandra.page.size") + + // CassandraQueryIdempotentKey is the attribute Key conforming to the + // "cassandra.query.idempotent" semantic conventions. It represents the whether + // or not the query is idempotent. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + CassandraQueryIdempotentKey = attribute.Key("cassandra.query.idempotent") + + // CassandraSpeculativeExecutionCountKey is the attribute Key conforming to the + // "cassandra.speculative_execution.count" semantic conventions. It represents + // the number of times a query was speculatively executed. Not set or `0` if the + // query was not executed speculatively. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 2 + CassandraSpeculativeExecutionCountKey = attribute.Key("cassandra.speculative_execution.count") +) + +// CassandraCoordinatorDC returns an attribute KeyValue conforming to the +// "cassandra.coordinator.dc" semantic conventions. It represents the data center +// of the coordinating node for a query. +func CassandraCoordinatorDC(val string) attribute.KeyValue { + return CassandraCoordinatorDCKey.String(val) +} + +// CassandraCoordinatorID returns an attribute KeyValue conforming to the +// "cassandra.coordinator.id" semantic conventions. It represents the ID of the +// coordinating node for a query. +func CassandraCoordinatorID(val string) attribute.KeyValue { + return CassandraCoordinatorIDKey.String(val) +} + +// CassandraPageSize returns an attribute KeyValue conforming to the +// "cassandra.page.size" semantic conventions. It represents the fetch size used +// for paging, i.e. how many rows will be returned at once. +func CassandraPageSize(val int) attribute.KeyValue { + return CassandraPageSizeKey.Int(val) +} + +// CassandraQueryIdempotent returns an attribute KeyValue conforming to the +// "cassandra.query.idempotent" semantic conventions. It represents the whether +// or not the query is idempotent. +func CassandraQueryIdempotent(val bool) attribute.KeyValue { + return CassandraQueryIdempotentKey.Bool(val) +} + +// CassandraSpeculativeExecutionCount returns an attribute KeyValue conforming to +// the "cassandra.speculative_execution.count" semantic conventions. It +// represents the number of times a query was speculatively executed. Not set or +// `0` if the query was not executed speculatively. +func CassandraSpeculativeExecutionCount(val int) attribute.KeyValue { + return CassandraSpeculativeExecutionCountKey.Int(val) +} + +// Enum values for cassandra.consistency.level +var ( + // all + // Stability: development + CassandraConsistencyLevelAll = CassandraConsistencyLevelKey.String("all") + // each_quorum + // Stability: development + CassandraConsistencyLevelEachQuorum = CassandraConsistencyLevelKey.String("each_quorum") + // quorum + // Stability: development + CassandraConsistencyLevelQuorum = CassandraConsistencyLevelKey.String("quorum") + // local_quorum + // Stability: development + CassandraConsistencyLevelLocalQuorum = CassandraConsistencyLevelKey.String("local_quorum") + // one + // Stability: development + CassandraConsistencyLevelOne = CassandraConsistencyLevelKey.String("one") + // two + // Stability: development + CassandraConsistencyLevelTwo = CassandraConsistencyLevelKey.String("two") + // three + // Stability: development + CassandraConsistencyLevelThree = CassandraConsistencyLevelKey.String("three") + // local_one + // Stability: development + CassandraConsistencyLevelLocalOne = CassandraConsistencyLevelKey.String("local_one") + // any + // Stability: development + CassandraConsistencyLevelAny = CassandraConsistencyLevelKey.String("any") + // serial + // Stability: development + CassandraConsistencyLevelSerial = CassandraConsistencyLevelKey.String("serial") + // local_serial + // Stability: development + CassandraConsistencyLevelLocalSerial = CassandraConsistencyLevelKey.String("local_serial") +) + +// Namespace: cicd +const ( + // CICDPipelineActionNameKey is the attribute Key conforming to the + // "cicd.pipeline.action.name" semantic conventions. It represents the kind of + // action a pipeline run is performing. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "BUILD", "RUN", "SYNC" + CICDPipelineActionNameKey = attribute.Key("cicd.pipeline.action.name") + + // CICDPipelineNameKey is the attribute Key conforming to the + // "cicd.pipeline.name" semantic conventions. It represents the human readable + // name of the pipeline within a CI/CD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Build and Test", "Lint", "Deploy Go Project", + // "deploy_to_environment" + CICDPipelineNameKey = attribute.Key("cicd.pipeline.name") + + // CICDPipelineResultKey is the attribute Key conforming to the + // "cicd.pipeline.result" semantic conventions. It represents the result of a + // pipeline run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "timeout", "skipped" + CICDPipelineResultKey = attribute.Key("cicd.pipeline.result") + + // CICDPipelineRunIDKey is the attribute Key conforming to the + // "cicd.pipeline.run.id" semantic conventions. It represents the unique + // identifier of a pipeline run within a CI/CD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "120912" + CICDPipelineRunIDKey = attribute.Key("cicd.pipeline.run.id") + + // CICDPipelineRunStateKey is the attribute Key conforming to the + // "cicd.pipeline.run.state" semantic conventions. It represents the pipeline + // run goes through these states during its lifecycle. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pending", "executing", "finalizing" + CICDPipelineRunStateKey = attribute.Key("cicd.pipeline.run.state") + + // CICDPipelineRunURLFullKey is the attribute Key conforming to the + // "cicd.pipeline.run.url.full" semantic conventions. It represents the [URL] of + // the pipeline run, providing the complete address in order to locate and + // identify the pipeline run. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763?pr=1075" + // + // [URL]: https://wikipedia.org/wiki/URL + CICDPipelineRunURLFullKey = attribute.Key("cicd.pipeline.run.url.full") + + // CICDPipelineTaskNameKey is the attribute Key conforming to the + // "cicd.pipeline.task.name" semantic conventions. It represents the human + // readable name of a task within a pipeline. Task here most closely aligns with + // a [computing process] in a pipeline. Other terms for tasks include commands, + // steps, and procedures. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Run GoLang Linter", "Go Build", "go-test", "deploy_binary" + // + // [computing process]: https://wikipedia.org/wiki/Pipeline_(computing) + CICDPipelineTaskNameKey = attribute.Key("cicd.pipeline.task.name") + + // CICDPipelineTaskRunIDKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.id" semantic conventions. It represents the unique + // identifier of a task run within a pipeline. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "12097" + CICDPipelineTaskRunIDKey = attribute.Key("cicd.pipeline.task.run.id") + + // CICDPipelineTaskRunResultKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.result" semantic conventions. It represents the + // result of a task run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "timeout", "skipped" + CICDPipelineTaskRunResultKey = attribute.Key("cicd.pipeline.task.run.result") + + // CICDPipelineTaskRunURLFullKey is the attribute Key conforming to the + // "cicd.pipeline.task.run.url.full" semantic conventions. It represents the + // [URL] of the pipeline task run, providing the complete address in order to + // locate and identify the pipeline task run. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/open-telemetry/semantic-conventions/actions/runs/9753949763/job/26920038674?pr=1075" + // + // [URL]: https://wikipedia.org/wiki/URL + CICDPipelineTaskRunURLFullKey = attribute.Key("cicd.pipeline.task.run.url.full") + + // CICDPipelineTaskTypeKey is the attribute Key conforming to the + // "cicd.pipeline.task.type" semantic conventions. It represents the type of the + // task within a pipeline. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "build", "test", "deploy" + CICDPipelineTaskTypeKey = attribute.Key("cicd.pipeline.task.type") + + // CICDSystemComponentKey is the attribute Key conforming to the + // "cicd.system.component" semantic conventions. It represents the name of a + // component of the CICD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "controller", "scheduler", "agent" + CICDSystemComponentKey = attribute.Key("cicd.system.component") + + // CICDWorkerIDKey is the attribute Key conforming to the "cicd.worker.id" + // semantic conventions. It represents the unique identifier of a worker within + // a CICD system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "abc123", "10.0.1.2", "controller" + CICDWorkerIDKey = attribute.Key("cicd.worker.id") + + // CICDWorkerNameKey is the attribute Key conforming to the "cicd.worker.name" + // semantic conventions. It represents the name of a worker within a CICD + // system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "agent-abc", "controller", "Ubuntu LTS" + CICDWorkerNameKey = attribute.Key("cicd.worker.name") + + // CICDWorkerStateKey is the attribute Key conforming to the "cicd.worker.state" + // semantic conventions. It represents the state of a CICD worker / agent. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "idle", "busy", "down" + CICDWorkerStateKey = attribute.Key("cicd.worker.state") + + // CICDWorkerURLFullKey is the attribute Key conforming to the + // "cicd.worker.url.full" semantic conventions. It represents the [URL] of the + // worker, providing the complete address in order to locate and identify the + // worker. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://cicd.example.org/worker/abc123" + // + // [URL]: https://wikipedia.org/wiki/URL + CICDWorkerURLFullKey = attribute.Key("cicd.worker.url.full") +) + +// CICDPipelineName returns an attribute KeyValue conforming to the +// "cicd.pipeline.name" semantic conventions. It represents the human readable +// name of the pipeline within a CI/CD system. +func CICDPipelineName(val string) attribute.KeyValue { + return CICDPipelineNameKey.String(val) +} + +// CICDPipelineRunID returns an attribute KeyValue conforming to the +// "cicd.pipeline.run.id" semantic conventions. It represents the unique +// identifier of a pipeline run within a CI/CD system. +func CICDPipelineRunID(val string) attribute.KeyValue { + return CICDPipelineRunIDKey.String(val) +} + +// CICDPipelineRunURLFull returns an attribute KeyValue conforming to the +// "cicd.pipeline.run.url.full" semantic conventions. It represents the [URL] of +// the pipeline run, providing the complete address in order to locate and +// identify the pipeline run. +// +// [URL]: https://wikipedia.org/wiki/URL +func CICDPipelineRunURLFull(val string) attribute.KeyValue { + return CICDPipelineRunURLFullKey.String(val) +} + +// CICDPipelineTaskName returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.name" semantic conventions. It represents the human +// readable name of a task within a pipeline. Task here most closely aligns with +// a [computing process] in a pipeline. Other terms for tasks include commands, +// steps, and procedures. +// +// [computing process]: https://wikipedia.org/wiki/Pipeline_(computing) +func CICDPipelineTaskName(val string) attribute.KeyValue { + return CICDPipelineTaskNameKey.String(val) +} + +// CICDPipelineTaskRunID returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.run.id" semantic conventions. It represents the unique +// identifier of a task run within a pipeline. +func CICDPipelineTaskRunID(val string) attribute.KeyValue { + return CICDPipelineTaskRunIDKey.String(val) +} + +// CICDPipelineTaskRunURLFull returns an attribute KeyValue conforming to the +// "cicd.pipeline.task.run.url.full" semantic conventions. It represents the +// [URL] of the pipeline task run, providing the complete address in order to +// locate and identify the pipeline task run. +// +// [URL]: https://wikipedia.org/wiki/URL +func CICDPipelineTaskRunURLFull(val string) attribute.KeyValue { + return CICDPipelineTaskRunURLFullKey.String(val) +} + +// CICDSystemComponent returns an attribute KeyValue conforming to the +// "cicd.system.component" semantic conventions. It represents the name of a +// component of the CICD system. +func CICDSystemComponent(val string) attribute.KeyValue { + return CICDSystemComponentKey.String(val) +} + +// CICDWorkerID returns an attribute KeyValue conforming to the "cicd.worker.id" +// semantic conventions. It represents the unique identifier of a worker within a +// CICD system. +func CICDWorkerID(val string) attribute.KeyValue { + return CICDWorkerIDKey.String(val) +} + +// CICDWorkerName returns an attribute KeyValue conforming to the +// "cicd.worker.name" semantic conventions. It represents the name of a worker +// within a CICD system. +func CICDWorkerName(val string) attribute.KeyValue { + return CICDWorkerNameKey.String(val) +} + +// CICDWorkerURLFull returns an attribute KeyValue conforming to the +// "cicd.worker.url.full" semantic conventions. It represents the [URL] of the +// worker, providing the complete address in order to locate and identify the +// worker. +// +// [URL]: https://wikipedia.org/wiki/URL +func CICDWorkerURLFull(val string) attribute.KeyValue { + return CICDWorkerURLFullKey.String(val) +} + +// Enum values for cicd.pipeline.action.name +var ( + // The pipeline run is executing a build. + // Stability: development + CICDPipelineActionNameBuild = CICDPipelineActionNameKey.String("BUILD") + // The pipeline run is executing. + // Stability: development + CICDPipelineActionNameRun = CICDPipelineActionNameKey.String("RUN") + // The pipeline run is executing a sync. + // Stability: development + CICDPipelineActionNameSync = CICDPipelineActionNameKey.String("SYNC") +) + +// Enum values for cicd.pipeline.result +var ( + // The pipeline run finished successfully. + // Stability: development + CICDPipelineResultSuccess = CICDPipelineResultKey.String("success") + // The pipeline run did not finish successfully, eg. due to a compile error or a + // failing test. Such failures are usually detected by non-zero exit codes of + // the tools executed in the pipeline run. + // Stability: development + CICDPipelineResultFailure = CICDPipelineResultKey.String("failure") + // The pipeline run failed due to an error in the CICD system, eg. due to the + // worker being killed. + // Stability: development + CICDPipelineResultError = CICDPipelineResultKey.String("error") + // A timeout caused the pipeline run to be interrupted. + // Stability: development + CICDPipelineResultTimeout = CICDPipelineResultKey.String("timeout") + // The pipeline run was cancelled, eg. by a user manually cancelling the + // pipeline run. + // Stability: development + CICDPipelineResultCancellation = CICDPipelineResultKey.String("cancellation") + // The pipeline run was skipped, eg. due to a precondition not being met. + // Stability: development + CICDPipelineResultSkip = CICDPipelineResultKey.String("skip") +) + +// Enum values for cicd.pipeline.run.state +var ( + // The run pending state spans from the event triggering the pipeline run until + // the execution of the run starts (eg. time spent in a queue, provisioning + // agents, creating run resources). + // + // Stability: development + CICDPipelineRunStatePending = CICDPipelineRunStateKey.String("pending") + // The executing state spans the execution of any run tasks (eg. build, test). + // Stability: development + CICDPipelineRunStateExecuting = CICDPipelineRunStateKey.String("executing") + // The finalizing state spans from when the run has finished executing (eg. + // cleanup of run resources). + // Stability: development + CICDPipelineRunStateFinalizing = CICDPipelineRunStateKey.String("finalizing") +) + +// Enum values for cicd.pipeline.task.run.result +var ( + // The task run finished successfully. + // Stability: development + CICDPipelineTaskRunResultSuccess = CICDPipelineTaskRunResultKey.String("success") + // The task run did not finish successfully, eg. due to a compile error or a + // failing test. Such failures are usually detected by non-zero exit codes of + // the tools executed in the task run. + // Stability: development + CICDPipelineTaskRunResultFailure = CICDPipelineTaskRunResultKey.String("failure") + // The task run failed due to an error in the CICD system, eg. due to the worker + // being killed. + // Stability: development + CICDPipelineTaskRunResultError = CICDPipelineTaskRunResultKey.String("error") + // A timeout caused the task run to be interrupted. + // Stability: development + CICDPipelineTaskRunResultTimeout = CICDPipelineTaskRunResultKey.String("timeout") + // The task run was cancelled, eg. by a user manually cancelling the task run. + // Stability: development + CICDPipelineTaskRunResultCancellation = CICDPipelineTaskRunResultKey.String("cancellation") + // The task run was skipped, eg. due to a precondition not being met. + // Stability: development + CICDPipelineTaskRunResultSkip = CICDPipelineTaskRunResultKey.String("skip") +) + +// Enum values for cicd.pipeline.task.type +var ( + // build + // Stability: development + CICDPipelineTaskTypeBuild = CICDPipelineTaskTypeKey.String("build") + // test + // Stability: development + CICDPipelineTaskTypeTest = CICDPipelineTaskTypeKey.String("test") + // deploy + // Stability: development + CICDPipelineTaskTypeDeploy = CICDPipelineTaskTypeKey.String("deploy") +) + +// Enum values for cicd.worker.state +var ( + // The worker is not performing work for the CICD system. It is available to the + // CICD system to perform work on (online / idle). + // Stability: development + CICDWorkerStateAvailable = CICDWorkerStateKey.String("available") + // The worker is performing work for the CICD system. + // Stability: development + CICDWorkerStateBusy = CICDWorkerStateKey.String("busy") + // The worker is not available to the CICD system (disconnected / down). + // Stability: development + CICDWorkerStateOffline = CICDWorkerStateKey.String("offline") +) + +// Namespace: client +const ( + // ClientAddressKey is the attribute Key conforming to the "client.address" + // semantic conventions. It represents the client address - domain name if + // available without reverse DNS lookup; otherwise, IP address or Unix domain + // socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "client.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the server side, and when communicating through an + // intermediary, `client.address` SHOULD represent the client address behind any + // intermediaries, for example proxies, if it's available. + ClientAddressKey = attribute.Key("client.address") + + // ClientPortKey is the attribute Key conforming to the "client.port" semantic + // conventions. It represents the client port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + // Note: When observed from the server side, and when communicating through an + // intermediary, `client.port` SHOULD represent the client port behind any + // intermediaries, for example proxies, if it's available. + ClientPortKey = attribute.Key("client.port") +) + +// ClientAddress returns an attribute KeyValue conforming to the "client.address" +// semantic conventions. It represents the client address - domain name if +// available without reverse DNS lookup; otherwise, IP address or Unix domain +// socket name. +func ClientAddress(val string) attribute.KeyValue { + return ClientAddressKey.String(val) +} + +// ClientPort returns an attribute KeyValue conforming to the "client.port" +// semantic conventions. It represents the client port number. +func ClientPort(val int) attribute.KeyValue { + return ClientPortKey.Int(val) +} + +// Namespace: cloud +const ( + // CloudAccountIDKey is the attribute Key conforming to the "cloud.account.id" + // semantic conventions. It represents the cloud account ID the resource is + // assigned to. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "111111111111", "opentelemetry" + CloudAccountIDKey = attribute.Key("cloud.account.id") + + // CloudAvailabilityZoneKey is the attribute Key conforming to the + // "cloud.availability_zone" semantic conventions. It represents the cloud + // regions often have multiple, isolated locations known as zones to increase + // availability. Availability zone represents the zone where the resource is + // running. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-east-1c" + // Note: Availability zones are called "zones" on Alibaba Cloud and Google + // Cloud. + CloudAvailabilityZoneKey = attribute.Key("cloud.availability_zone") + + // CloudPlatformKey is the attribute Key conforming to the "cloud.platform" + // semantic conventions. It represents the cloud platform in use. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The prefix of the service SHOULD match the one specified in + // `cloud.provider`. + CloudPlatformKey = attribute.Key("cloud.platform") + + // CloudProviderKey is the attribute Key conforming to the "cloud.provider" + // semantic conventions. It represents the name of the cloud provider. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + CloudProviderKey = attribute.Key("cloud.provider") + + // CloudRegionKey is the attribute Key conforming to the "cloud.region" semantic + // conventions. It represents the geographical region within a cloud provider. + // When associated with a resource, this attribute specifies the region where + // the resource operates. When calling services or APIs deployed on a cloud, + // this attribute identifies the region where the called destination is + // deployed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-central1", "us-east-1" + // Note: Refer to your provider's docs to see the available regions, for example + // [Alibaba Cloud regions], [AWS regions], [Azure regions], + // [Google Cloud regions], or [Tencent Cloud regions]. + // + // [Alibaba Cloud regions]: https://www.alibabacloud.com/help/doc-detail/40654.htm + // [AWS regions]: https://aws.amazon.com/about-aws/global-infrastructure/regions_az/ + // [Azure regions]: https://azure.microsoft.com/global-infrastructure/geographies/ + // [Google Cloud regions]: https://cloud.google.com/about/locations + // [Tencent Cloud regions]: https://www.tencentcloud.com/document/product/213/6091 + CloudRegionKey = attribute.Key("cloud.region") + + // CloudResourceIDKey is the attribute Key conforming to the "cloud.resource_id" + // semantic conventions. It represents the cloud provider-specific native + // identifier of the monitored cloud resource (e.g. an [ARN] on AWS, a + // [fully qualified resource ID] on Azure, a [full resource name] on GCP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "arn:aws:lambda:REGION:ACCOUNT_ID:function:my-function", + // "//run.googleapis.com/projects/PROJECT_ID/locations/LOCATION_ID/services/SERVICE_ID", + // "/subscriptions//resourceGroups/ + // /providers/Microsoft.Web/sites//functions/" + // Note: On some cloud providers, it may not be possible to determine the full + // ID at startup, + // so it may be necessary to set `cloud.resource_id` as a span attribute + // instead. + // + // The exact value to use for `cloud.resource_id` depends on the cloud provider. + // The following well-known definitions MUST be used if you set this attribute + // and they apply: + // + // - **AWS Lambda:** The function [ARN]. + // Take care not to use the "invoked ARN" directly but replace any + // [alias suffix] + // with the resolved function version, as the same runtime instance may be + // invocable with + // multiple different aliases. + // - **GCP:** The [URI of the resource] + // - **Azure:** The [Fully Qualified Resource ID] of the invoked function, + // *not* the function app, having the form + // + // `/subscriptions//resourceGroups//providers/Microsoft.Web/sites//functions/` + // . + // This means that a span attribute MUST be used, as an Azure function app + // can host multiple functions that would usually share + // a TracerProvider. + // + // + // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html + // [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id + // [full resource name]: https://google.aip.dev/122#full-resource-names + // [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html + // [alias suffix]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-aliases.html + // [URI of the resource]: https://cloud.google.com/iam/docs/full-resource-names + // [Fully Qualified Resource ID]: https://docs.microsoft.com/rest/api/resources/resources/get-by-id + CloudResourceIDKey = attribute.Key("cloud.resource_id") +) + +// CloudAccountID returns an attribute KeyValue conforming to the +// "cloud.account.id" semantic conventions. It represents the cloud account ID +// the resource is assigned to. +func CloudAccountID(val string) attribute.KeyValue { + return CloudAccountIDKey.String(val) +} + +// CloudAvailabilityZone returns an attribute KeyValue conforming to the +// "cloud.availability_zone" semantic conventions. It represents the cloud +// regions often have multiple, isolated locations known as zones to increase +// availability. Availability zone represents the zone where the resource is +// running. +func CloudAvailabilityZone(val string) attribute.KeyValue { + return CloudAvailabilityZoneKey.String(val) +} + +// CloudRegion returns an attribute KeyValue conforming to the "cloud.region" +// semantic conventions. It represents the geographical region within a cloud +// provider. When associated with a resource, this attribute specifies the region +// where the resource operates. When calling services or APIs deployed on a +// cloud, this attribute identifies the region where the called destination is +// deployed. +func CloudRegion(val string) attribute.KeyValue { + return CloudRegionKey.String(val) +} + +// CloudResourceID returns an attribute KeyValue conforming to the +// "cloud.resource_id" semantic conventions. It represents the cloud +// provider-specific native identifier of the monitored cloud resource (e.g. an +// [ARN] on AWS, a [fully qualified resource ID] on Azure, a [full resource name] +// on GCP). +// +// [ARN]: https://docs.aws.amazon.com/general/latest/gr/aws-arns-and-namespaces.html +// [fully qualified resource ID]: https://learn.microsoft.com/rest/api/resources/resources/get-by-id +// [full resource name]: https://google.aip.dev/122#full-resource-names +func CloudResourceID(val string) attribute.KeyValue { + return CloudResourceIDKey.String(val) +} + +// Enum values for cloud.platform +var ( + // Alibaba Cloud Elastic Compute Service + // Stability: development + CloudPlatformAlibabaCloudECS = CloudPlatformKey.String("alibaba_cloud_ecs") + // Alibaba Cloud Function Compute + // Stability: development + CloudPlatformAlibabaCloudFC = CloudPlatformKey.String("alibaba_cloud_fc") + // Red Hat OpenShift on Alibaba Cloud + // Stability: development + CloudPlatformAlibabaCloudOpenShift = CloudPlatformKey.String("alibaba_cloud_openshift") + // AWS Elastic Compute Cloud + // Stability: development + CloudPlatformAWSEC2 = CloudPlatformKey.String("aws_ec2") + // AWS Elastic Container Service + // Stability: development + CloudPlatformAWSECS = CloudPlatformKey.String("aws_ecs") + // AWS Elastic Kubernetes Service + // Stability: development + CloudPlatformAWSEKS = CloudPlatformKey.String("aws_eks") + // AWS Lambda + // Stability: development + CloudPlatformAWSLambda = CloudPlatformKey.String("aws_lambda") + // AWS Elastic Beanstalk + // Stability: development + CloudPlatformAWSElasticBeanstalk = CloudPlatformKey.String("aws_elastic_beanstalk") + // AWS App Runner + // Stability: development + CloudPlatformAWSAppRunner = CloudPlatformKey.String("aws_app_runner") + // Red Hat OpenShift on AWS (ROSA) + // Stability: development + CloudPlatformAWSOpenShift = CloudPlatformKey.String("aws_openshift") + // Azure Virtual Machines + // Stability: development + CloudPlatformAzureVM = CloudPlatformKey.String("azure_vm") + // Azure Container Apps + // Stability: development + CloudPlatformAzureContainerApps = CloudPlatformKey.String("azure_container_apps") + // Azure Container Instances + // Stability: development + CloudPlatformAzureContainerInstances = CloudPlatformKey.String("azure_container_instances") + // Azure Kubernetes Service + // Stability: development + CloudPlatformAzureAKS = CloudPlatformKey.String("azure_aks") + // Azure Functions + // Stability: development + CloudPlatformAzureFunctions = CloudPlatformKey.String("azure_functions") + // Azure App Service + // Stability: development + CloudPlatformAzureAppService = CloudPlatformKey.String("azure_app_service") + // Azure Red Hat OpenShift + // Stability: development + CloudPlatformAzureOpenShift = CloudPlatformKey.String("azure_openshift") + // Google Bare Metal Solution (BMS) + // Stability: development + CloudPlatformGCPBareMetalSolution = CloudPlatformKey.String("gcp_bare_metal_solution") + // Google Cloud Compute Engine (GCE) + // Stability: development + CloudPlatformGCPComputeEngine = CloudPlatformKey.String("gcp_compute_engine") + // Google Cloud Run + // Stability: development + CloudPlatformGCPCloudRun = CloudPlatformKey.String("gcp_cloud_run") + // Google Cloud Kubernetes Engine (GKE) + // Stability: development + CloudPlatformGCPKubernetesEngine = CloudPlatformKey.String("gcp_kubernetes_engine") + // Google Cloud Functions (GCF) + // Stability: development + CloudPlatformGCPCloudFunctions = CloudPlatformKey.String("gcp_cloud_functions") + // Google Cloud App Engine (GAE) + // Stability: development + CloudPlatformGCPAppEngine = CloudPlatformKey.String("gcp_app_engine") + // Red Hat OpenShift on Google Cloud + // Stability: development + CloudPlatformGCPOpenShift = CloudPlatformKey.String("gcp_openshift") + // Red Hat OpenShift on IBM Cloud + // Stability: development + CloudPlatformIBMCloudOpenShift = CloudPlatformKey.String("ibm_cloud_openshift") + // Compute on Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudPlatformOracleCloudCompute = CloudPlatformKey.String("oracle_cloud_compute") + // Kubernetes Engine (OKE) on Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudPlatformOracleCloudOKE = CloudPlatformKey.String("oracle_cloud_oke") + // Tencent Cloud Cloud Virtual Machine (CVM) + // Stability: development + CloudPlatformTencentCloudCVM = CloudPlatformKey.String("tencent_cloud_cvm") + // Tencent Cloud Elastic Kubernetes Service (EKS) + // Stability: development + CloudPlatformTencentCloudEKS = CloudPlatformKey.String("tencent_cloud_eks") + // Tencent Cloud Serverless Cloud Function (SCF) + // Stability: development + CloudPlatformTencentCloudSCF = CloudPlatformKey.String("tencent_cloud_scf") +) + +// Enum values for cloud.provider +var ( + // Alibaba Cloud + // Stability: development + CloudProviderAlibabaCloud = CloudProviderKey.String("alibaba_cloud") + // Amazon Web Services + // Stability: development + CloudProviderAWS = CloudProviderKey.String("aws") + // Microsoft Azure + // Stability: development + CloudProviderAzure = CloudProviderKey.String("azure") + // Google Cloud Platform + // Stability: development + CloudProviderGCP = CloudProviderKey.String("gcp") + // Heroku Platform as a Service + // Stability: development + CloudProviderHeroku = CloudProviderKey.String("heroku") + // IBM Cloud + // Stability: development + CloudProviderIBMCloud = CloudProviderKey.String("ibm_cloud") + // Oracle Cloud Infrastructure (OCI) + // Stability: development + CloudProviderOracleCloud = CloudProviderKey.String("oracle_cloud") + // Tencent Cloud + // Stability: development + CloudProviderTencentCloud = CloudProviderKey.String("tencent_cloud") +) + +// Namespace: cloudevents +const ( + // CloudEventsEventIDKey is the attribute Key conforming to the + // "cloudevents.event_id" semantic conventions. It represents the [event_id] + // uniquely identifies the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123e4567-e89b-12d3-a456-426614174000", "0001" + // + // [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id + CloudEventsEventIDKey = attribute.Key("cloudevents.event_id") + + // CloudEventsEventSourceKey is the attribute Key conforming to the + // "cloudevents.event_source" semantic conventions. It represents the [source] + // identifies the context in which an event happened. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://github.com/cloudevents", "/cloudevents/spec/pull/123", + // "my-service" + // + // [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1 + CloudEventsEventSourceKey = attribute.Key("cloudevents.event_source") + + // CloudEventsEventSpecVersionKey is the attribute Key conforming to the + // "cloudevents.event_spec_version" semantic conventions. It represents the + // [version of the CloudEvents specification] which the event uses. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + // + // [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion + CloudEventsEventSpecVersionKey = attribute.Key("cloudevents.event_spec_version") + + // CloudEventsEventSubjectKey is the attribute Key conforming to the + // "cloudevents.event_subject" semantic conventions. It represents the [subject] + // of the event in the context of the event producer (identified by source). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: mynewfile.jpg + // + // [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject + CloudEventsEventSubjectKey = attribute.Key("cloudevents.event_subject") + + // CloudEventsEventTypeKey is the attribute Key conforming to the + // "cloudevents.event_type" semantic conventions. It represents the [event_type] + // contains a value describing the type of event related to the originating + // occurrence. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "com.github.pull_request.opened", "com.example.object.deleted.v2" + // + // [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type + CloudEventsEventTypeKey = attribute.Key("cloudevents.event_type") +) + +// CloudEventsEventID returns an attribute KeyValue conforming to the +// "cloudevents.event_id" semantic conventions. It represents the [event_id] +// uniquely identifies the event. +// +// [event_id]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#id +func CloudEventsEventID(val string) attribute.KeyValue { + return CloudEventsEventIDKey.String(val) +} + +// CloudEventsEventSource returns an attribute KeyValue conforming to the +// "cloudevents.event_source" semantic conventions. It represents the [source] +// identifies the context in which an event happened. +// +// [source]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#source-1 +func CloudEventsEventSource(val string) attribute.KeyValue { + return CloudEventsEventSourceKey.String(val) +} + +// CloudEventsEventSpecVersion returns an attribute KeyValue conforming to the +// "cloudevents.event_spec_version" semantic conventions. It represents the +// [version of the CloudEvents specification] which the event uses. +// +// [version of the CloudEvents specification]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#specversion +func CloudEventsEventSpecVersion(val string) attribute.KeyValue { + return CloudEventsEventSpecVersionKey.String(val) +} + +// CloudEventsEventSubject returns an attribute KeyValue conforming to the +// "cloudevents.event_subject" semantic conventions. It represents the [subject] +// of the event in the context of the event producer (identified by source). +// +// [subject]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#subject +func CloudEventsEventSubject(val string) attribute.KeyValue { + return CloudEventsEventSubjectKey.String(val) +} + +// CloudEventsEventType returns an attribute KeyValue conforming to the +// "cloudevents.event_type" semantic conventions. It represents the [event_type] +// contains a value describing the type of event related to the originating +// occurrence. +// +// [event_type]: https://github.com/cloudevents/spec/blob/v1.0.2/cloudevents/spec.md#type +func CloudEventsEventType(val string) attribute.KeyValue { + return CloudEventsEventTypeKey.String(val) +} + +// Namespace: cloudfoundry +const ( + // CloudFoundryAppIDKey is the attribute Key conforming to the + // "cloudfoundry.app.id" semantic conventions. It represents the guid of the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.application_id`. This is the same value as + // reported by `cf app --guid`. + CloudFoundryAppIDKey = attribute.Key("cloudfoundry.app.id") + + // CloudFoundryAppInstanceIDKey is the attribute Key conforming to the + // "cloudfoundry.app.instance.id" semantic conventions. It represents the index + // of the application instance. 0 when just one instance is active. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0", "1" + // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope] + // . + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the application instance index for applications + // deployed on the runtime. + // + // Application instrumentation should use the value from environment + // variable `CF_INSTANCE_INDEX`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + CloudFoundryAppInstanceIDKey = attribute.Key("cloudfoundry.app.instance.id") + + // CloudFoundryAppNameKey is the attribute Key conforming to the + // "cloudfoundry.app.name" semantic conventions. It represents the name of the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-app-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.application_name`. This is the same value + // as reported by `cf apps`. + CloudFoundryAppNameKey = attribute.Key("cloudfoundry.app.name") + + // CloudFoundryOrgIDKey is the attribute Key conforming to the + // "cloudfoundry.org.id" semantic conventions. It represents the guid of the + // CloudFoundry org the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.org_id`. This is the same value as + // reported by `cf org --guid`. + CloudFoundryOrgIDKey = attribute.Key("cloudfoundry.org.id") + + // CloudFoundryOrgNameKey is the attribute Key conforming to the + // "cloudfoundry.org.name" semantic conventions. It represents the name of the + // CloudFoundry organization the app is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-org-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.org_name`. This is the same value as + // reported by `cf orgs`. + CloudFoundryOrgNameKey = attribute.Key("cloudfoundry.org.name") + + // CloudFoundryProcessIDKey is the attribute Key conforming to the + // "cloudfoundry.process.id" semantic conventions. It represents the UID + // identifying the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.process_id`. It is supposed to be equal to + // `VCAP_APPLICATION.app_id` for applications deployed to the runtime. + // For system components, this could be the actual PID. + CloudFoundryProcessIDKey = attribute.Key("cloudfoundry.process.id") + + // CloudFoundryProcessTypeKey is the attribute Key conforming to the + // "cloudfoundry.process.type" semantic conventions. It represents the type of + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "web" + // Note: CloudFoundry applications can consist of multiple jobs. Usually the + // main process will be of type `web`. There can be additional background + // tasks or side-cars with different process types. + CloudFoundryProcessTypeKey = attribute.Key("cloudfoundry.process.type") + + // CloudFoundrySpaceIDKey is the attribute Key conforming to the + // "cloudfoundry.space.id" semantic conventions. It represents the guid of the + // CloudFoundry space the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.space_id`. This is the same value as + // reported by `cf space --guid`. + CloudFoundrySpaceIDKey = attribute.Key("cloudfoundry.space.id") + + // CloudFoundrySpaceNameKey is the attribute Key conforming to the + // "cloudfoundry.space.name" semantic conventions. It represents the name of the + // CloudFoundry space the application is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-space-name" + // Note: Application instrumentation should use the value from environment + // variable `VCAP_APPLICATION.space_name`. This is the same value as + // reported by `cf spaces`. + CloudFoundrySpaceNameKey = attribute.Key("cloudfoundry.space.name") + + // CloudFoundrySystemIDKey is the attribute Key conforming to the + // "cloudfoundry.system.id" semantic conventions. It represents a guid or + // another name describing the event source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cf/gorouter" + // Note: CloudFoundry defines the `source_id` in the [Loggregator v2 envelope]. + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the component name, e.g. "gorouter", for + // CloudFoundry components. + // + // When system components are instrumented, values from the + // [Bosh spec] + // should be used. The `system.id` should be set to + // `spec.deployment/spec.name`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec + CloudFoundrySystemIDKey = attribute.Key("cloudfoundry.system.id") + + // CloudFoundrySystemInstanceIDKey is the attribute Key conforming to the + // "cloudfoundry.system.instance.id" semantic conventions. It represents a guid + // describing the concrete instance of the event source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: CloudFoundry defines the `instance_id` in the [Loggregator v2 envelope] + // . + // It is used for logs and metrics emitted by CloudFoundry. It is + // supposed to contain the vm id for CloudFoundry components. + // + // When system components are instrumented, values from the + // [Bosh spec] + // should be used. The `system.instance.id` should be set to `spec.id`. + // + // [Loggregator v2 envelope]: https://github.com/cloudfoundry/loggregator-api#v2-envelope + // [Bosh spec]: https://bosh.io/docs/jobs/#properties-spec + CloudFoundrySystemInstanceIDKey = attribute.Key("cloudfoundry.system.instance.id") +) + +// CloudFoundryAppID returns an attribute KeyValue conforming to the +// "cloudfoundry.app.id" semantic conventions. It represents the guid of the +// application. +func CloudFoundryAppID(val string) attribute.KeyValue { + return CloudFoundryAppIDKey.String(val) +} + +// CloudFoundryAppInstanceID returns an attribute KeyValue conforming to the +// "cloudfoundry.app.instance.id" semantic conventions. It represents the index +// of the application instance. 0 when just one instance is active. +func CloudFoundryAppInstanceID(val string) attribute.KeyValue { + return CloudFoundryAppInstanceIDKey.String(val) +} + +// CloudFoundryAppName returns an attribute KeyValue conforming to the +// "cloudfoundry.app.name" semantic conventions. It represents the name of the +// application. +func CloudFoundryAppName(val string) attribute.KeyValue { + return CloudFoundryAppNameKey.String(val) +} + +// CloudFoundryOrgID returns an attribute KeyValue conforming to the +// "cloudfoundry.org.id" semantic conventions. It represents the guid of the +// CloudFoundry org the application is running in. +func CloudFoundryOrgID(val string) attribute.KeyValue { + return CloudFoundryOrgIDKey.String(val) +} + +// CloudFoundryOrgName returns an attribute KeyValue conforming to the +// "cloudfoundry.org.name" semantic conventions. It represents the name of the +// CloudFoundry organization the app is running in. +func CloudFoundryOrgName(val string) attribute.KeyValue { + return CloudFoundryOrgNameKey.String(val) +} + +// CloudFoundryProcessID returns an attribute KeyValue conforming to the +// "cloudfoundry.process.id" semantic conventions. It represents the UID +// identifying the process. +func CloudFoundryProcessID(val string) attribute.KeyValue { + return CloudFoundryProcessIDKey.String(val) +} + +// CloudFoundryProcessType returns an attribute KeyValue conforming to the +// "cloudfoundry.process.type" semantic conventions. It represents the type of +// process. +func CloudFoundryProcessType(val string) attribute.KeyValue { + return CloudFoundryProcessTypeKey.String(val) +} + +// CloudFoundrySpaceID returns an attribute KeyValue conforming to the +// "cloudfoundry.space.id" semantic conventions. It represents the guid of the +// CloudFoundry space the application is running in. +func CloudFoundrySpaceID(val string) attribute.KeyValue { + return CloudFoundrySpaceIDKey.String(val) +} + +// CloudFoundrySpaceName returns an attribute KeyValue conforming to the +// "cloudfoundry.space.name" semantic conventions. It represents the name of the +// CloudFoundry space the application is running in. +func CloudFoundrySpaceName(val string) attribute.KeyValue { + return CloudFoundrySpaceNameKey.String(val) +} + +// CloudFoundrySystemID returns an attribute KeyValue conforming to the +// "cloudfoundry.system.id" semantic conventions. It represents a guid or another +// name describing the event source. +func CloudFoundrySystemID(val string) attribute.KeyValue { + return CloudFoundrySystemIDKey.String(val) +} + +// CloudFoundrySystemInstanceID returns an attribute KeyValue conforming to the +// "cloudfoundry.system.instance.id" semantic conventions. It represents a guid +// describing the concrete instance of the event source. +func CloudFoundrySystemInstanceID(val string) attribute.KeyValue { + return CloudFoundrySystemInstanceIDKey.String(val) +} + +// Namespace: code +const ( + // CodeColumnNumberKey is the attribute Key conforming to the + // "code.column.number" semantic conventions. It represents the column number in + // `code.file.path` best representing the operation. It SHOULD point within the + // code unit named in `code.function.name`. This attribute MUST NOT be used on + // the Profile signal since the data is already captured in 'message Line'. This + // constraint is imposed to prevent redundancy and maintain data integrity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + CodeColumnNumberKey = attribute.Key("code.column.number") + + // CodeFilePathKey is the attribute Key conforming to the "code.file.path" + // semantic conventions. It represents the source code file name that identifies + // the code unit as uniquely as possible (preferably an absolute file path). + // This attribute MUST NOT be used on the Profile signal since the data is + // already captured in 'message Function'. This constraint is imposed to prevent + // redundancy and maintain data integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: /usr/local/MyApplication/content_root/app/index.php + CodeFilePathKey = attribute.Key("code.file.path") + + // CodeFunctionNameKey is the attribute Key conforming to the + // "code.function.name" semantic conventions. It represents the method or + // function fully-qualified name without arguments. The value should fit the + // natural representation of the language runtime, which is also likely the same + // used within `code.stacktrace` attribute value. This attribute MUST NOT be + // used on the Profile signal since the data is already captured in 'message + // Function'. This constraint is imposed to prevent redundancy and maintain data + // integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "com.example.MyHttpService.serveRequest", + // "GuzzleHttp\Client::transfer", "fopen" + // Note: Values and format depends on each language runtime, thus it is + // impossible to provide an exhaustive list of examples. + // The values are usually the same (or prefixes of) the ones found in native + // stack trace representation stored in + // `code.stacktrace` without information on arguments. + // + // Examples: + // + // - Java method: `com.example.MyHttpService.serveRequest` + // - Java anonymous class method: `com.mycompany.Main$1.myMethod` + // - Java lambda method: + // `com.mycompany.Main$$Lambda/0x0000748ae4149c00.myMethod` + // - PHP function: `GuzzleHttp\Client::transfer` + // - Go function: `github.com/my/repo/pkg.foo.func5` + // - Elixir: `OpenTelemetry.Ctx.new` + // - Erlang: `opentelemetry_ctx:new` + // - Rust: `playground::my_module::my_cool_func` + // - C function: `fopen` + CodeFunctionNameKey = attribute.Key("code.function.name") + + // CodeLineNumberKey is the attribute Key conforming to the "code.line.number" + // semantic conventions. It represents the line number in `code.file.path` best + // representing the operation. It SHOULD point within the code unit named in + // `code.function.name`. This attribute MUST NOT be used on the Profile signal + // since the data is already captured in 'message Line'. This constraint is + // imposed to prevent redundancy and maintain data integrity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + CodeLineNumberKey = attribute.Key("code.line.number") + + // CodeStacktraceKey is the attribute Key conforming to the "code.stacktrace" + // semantic conventions. It represents a stacktrace as a string in the natural + // representation for the language runtime. The representation is identical to + // [`exception.stacktrace`]. This attribute MUST NOT be used on the Profile + // signal since the data is already captured in 'message Location'. This + // constraint is imposed to prevent redundancy and maintain data integrity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at + // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at + // com.example.GenerateTrace.main(GenerateTrace.java:5) + // + // [`exception.stacktrace`]: /docs/exceptions/exceptions-spans.md#stacktrace-representation + CodeStacktraceKey = attribute.Key("code.stacktrace") +) + +// CodeColumnNumber returns an attribute KeyValue conforming to the +// "code.column.number" semantic conventions. It represents the column number in +// `code.file.path` best representing the operation. It SHOULD point within the +// code unit named in `code.function.name`. This attribute MUST NOT be used on +// the Profile signal since the data is already captured in 'message Line'. This +// constraint is imposed to prevent redundancy and maintain data integrity. +func CodeColumnNumber(val int) attribute.KeyValue { + return CodeColumnNumberKey.Int(val) +} + +// CodeFilePath returns an attribute KeyValue conforming to the "code.file.path" +// semantic conventions. It represents the source code file name that identifies +// the code unit as uniquely as possible (preferably an absolute file path). This +// attribute MUST NOT be used on the Profile signal since the data is already +// captured in 'message Function'. This constraint is imposed to prevent +// redundancy and maintain data integrity. +func CodeFilePath(val string) attribute.KeyValue { + return CodeFilePathKey.String(val) +} + +// CodeFunctionName returns an attribute KeyValue conforming to the +// "code.function.name" semantic conventions. It represents the method or +// function fully-qualified name without arguments. The value should fit the +// natural representation of the language runtime, which is also likely the same +// used within `code.stacktrace` attribute value. This attribute MUST NOT be used +// on the Profile signal since the data is already captured in 'message +// Function'. This constraint is imposed to prevent redundancy and maintain data +// integrity. +func CodeFunctionName(val string) attribute.KeyValue { + return CodeFunctionNameKey.String(val) +} + +// CodeLineNumber returns an attribute KeyValue conforming to the +// "code.line.number" semantic conventions. It represents the line number in +// `code.file.path` best representing the operation. It SHOULD point within the +// code unit named in `code.function.name`. This attribute MUST NOT be used on +// the Profile signal since the data is already captured in 'message Line'. This +// constraint is imposed to prevent redundancy and maintain data integrity. +func CodeLineNumber(val int) attribute.KeyValue { + return CodeLineNumberKey.Int(val) +} + +// CodeStacktrace returns an attribute KeyValue conforming to the +// "code.stacktrace" semantic conventions. It represents a stacktrace as a string +// in the natural representation for the language runtime. The representation is +// identical to [`exception.stacktrace`]. This attribute MUST NOT be used on the +// Profile signal since the data is already captured in 'message Location'. This +// constraint is imposed to prevent redundancy and maintain data integrity. +// +// [`exception.stacktrace`]: /docs/exceptions/exceptions-spans.md#stacktrace-representation +func CodeStacktrace(val string) attribute.KeyValue { + return CodeStacktraceKey.String(val) +} + +// Namespace: container +const ( + // ContainerCommandKey is the attribute Key conforming to the + // "container.command" semantic conventions. It represents the command used to + // run the container (i.e. the command name). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol" + // Note: If using embedded credentials or sensitive data, it is recommended to + // remove them to prevent potential leakage. + ContainerCommandKey = attribute.Key("container.command") + + // ContainerCommandArgsKey is the attribute Key conforming to the + // "container.command_args" semantic conventions. It represents the all the + // command arguments (including the command/executable itself) run by the + // container. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol", "--config", "config.yaml" + ContainerCommandArgsKey = attribute.Key("container.command_args") + + // ContainerCommandLineKey is the attribute Key conforming to the + // "container.command_line" semantic conventions. It represents the full command + // run by the container as a single string representing the full command. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcontribcol --config config.yaml" + ContainerCommandLineKey = attribute.Key("container.command_line") + + // ContainerCSIPluginNameKey is the attribute Key conforming to the + // "container.csi.plugin.name" semantic conventions. It represents the name of + // the CSI ([Container Storage Interface]) plugin used by the volume. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pd.csi.storage.gke.io" + // Note: This can sometimes be referred to as a "driver" in CSI implementations. + // This should represent the `name` field of the GetPluginInfo RPC. + // + // [Container Storage Interface]: https://github.com/container-storage-interface/spec + ContainerCSIPluginNameKey = attribute.Key("container.csi.plugin.name") + + // ContainerCSIVolumeIDKey is the attribute Key conforming to the + // "container.csi.volume.id" semantic conventions. It represents the unique + // volume ID returned by the CSI ([Container Storage Interface]) plugin. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "projects/my-gcp-project/zones/my-gcp-zone/disks/my-gcp-disk" + // Note: This can sometimes be referred to as a "volume handle" in CSI + // implementations. This should represent the `Volume.volume_id` field in CSI + // spec. + // + // [Container Storage Interface]: https://github.com/container-storage-interface/spec + ContainerCSIVolumeIDKey = attribute.Key("container.csi.volume.id") + + // ContainerIDKey is the attribute Key conforming to the "container.id" semantic + // conventions. It represents the container ID. Usually a UUID, as for example + // used to [identify Docker containers]. The UUID might be abbreviated. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a3bf90e006b2" + // + // [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification + ContainerIDKey = attribute.Key("container.id") + + // ContainerImageIDKey is the attribute Key conforming to the + // "container.image.id" semantic conventions. It represents the runtime specific + // image identifier. Usually a hash algorithm followed by a UUID. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "sha256:19c92d0a00d1b66d897bceaa7319bee0dd38a10a851c60bcec9474aa3f01e50f" + // Note: Docker defines a sha256 of the image id; `container.image.id` + // corresponds to the `Image` field from the Docker container inspect [API] + // endpoint. + // K8s defines a link to the container registry repository with digest + // `"imageID": "registry.azurecr.io /namespace/service/dockerfile@sha256:bdeabd40c3a8a492eaf9e8e44d0ebbb84bac7ee25ac0cf8a7159d25f62555625"` + // . + // The ID is assigned by the container runtime and can vary in different + // environments. Consider using `oci.manifest.digest` if it is important to + // identify the same image in different environments/runtimes. + // + // [API]: https://docs.docker.com/engine/api/v1.43/#tag/Container/operation/ContainerInspect + ContainerImageIDKey = attribute.Key("container.image.id") + + // ContainerImageNameKey is the attribute Key conforming to the + // "container.image.name" semantic conventions. It represents the name of the + // image the container was built on. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "gcr.io/opentelemetry/operator" + ContainerImageNameKey = attribute.Key("container.image.name") + + // ContainerImageRepoDigestsKey is the attribute Key conforming to the + // "container.image.repo_digests" semantic conventions. It represents the repo + // digests of the container image as provided by the container runtime. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "example@sha256:afcc7f1ac1b49db317a7196c902e61c6c3c4607d63599ee1a82d702d249a0ccb", + // "internal.registry.example.com:5000/example@sha256:b69959407d21e8a062e0416bf13405bb2b71ed7a84dde4158ebafacfa06f5578" + // Note: [Docker] and [CRI] report those under the `RepoDigests` field. + // + // [Docker]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect + // [CRI]: https://github.com/kubernetes/cri-api/blob/c75ef5b473bbe2d0a4fc92f82235efd665ea8e9f/pkg/apis/runtime/v1/api.proto#L1237-L1238 + ContainerImageRepoDigestsKey = attribute.Key("container.image.repo_digests") + + // ContainerImageTagsKey is the attribute Key conforming to the + // "container.image.tags" semantic conventions. It represents the container + // image tags. An example can be found in [Docker Image Inspect]. Should be only + // the `` section of the full name for example from + // `registry.example.com/my-org/my-image:`. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "v1.27.1", "3.5.7-0" + // + // [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect + ContainerImageTagsKey = attribute.Key("container.image.tags") + + // ContainerNameKey is the attribute Key conforming to the "container.name" + // semantic conventions. It represents the container name used by container + // runtime. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-autoconf" + ContainerNameKey = attribute.Key("container.name") + + // ContainerRuntimeKey is the attribute Key conforming to the + // "container.runtime" semantic conventions. It represents the container runtime + // managing this container. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "docker", "containerd", "rkt" + ContainerRuntimeKey = attribute.Key("container.runtime") +) + +// ContainerCommand returns an attribute KeyValue conforming to the +// "container.command" semantic conventions. It represents the command used to +// run the container (i.e. the command name). +func ContainerCommand(val string) attribute.KeyValue { + return ContainerCommandKey.String(val) +} + +// ContainerCommandArgs returns an attribute KeyValue conforming to the +// "container.command_args" semantic conventions. It represents the all the +// command arguments (including the command/executable itself) run by the +// container. +func ContainerCommandArgs(val ...string) attribute.KeyValue { + return ContainerCommandArgsKey.StringSlice(val) +} + +// ContainerCommandLine returns an attribute KeyValue conforming to the +// "container.command_line" semantic conventions. It represents the full command +// run by the container as a single string representing the full command. +func ContainerCommandLine(val string) attribute.KeyValue { + return ContainerCommandLineKey.String(val) +} + +// ContainerCSIPluginName returns an attribute KeyValue conforming to the +// "container.csi.plugin.name" semantic conventions. It represents the name of +// the CSI ([Container Storage Interface]) plugin used by the volume. +// +// [Container Storage Interface]: https://github.com/container-storage-interface/spec +func ContainerCSIPluginName(val string) attribute.KeyValue { + return ContainerCSIPluginNameKey.String(val) +} + +// ContainerCSIVolumeID returns an attribute KeyValue conforming to the +// "container.csi.volume.id" semantic conventions. It represents the unique +// volume ID returned by the CSI ([Container Storage Interface]) plugin. +// +// [Container Storage Interface]: https://github.com/container-storage-interface/spec +func ContainerCSIVolumeID(val string) attribute.KeyValue { + return ContainerCSIVolumeIDKey.String(val) +} + +// ContainerID returns an attribute KeyValue conforming to the "container.id" +// semantic conventions. It represents the container ID. Usually a UUID, as for +// example used to [identify Docker containers]. The UUID might be abbreviated. +// +// [identify Docker containers]: https://docs.docker.com/engine/containers/run/#container-identification +func ContainerID(val string) attribute.KeyValue { + return ContainerIDKey.String(val) +} + +// ContainerImageID returns an attribute KeyValue conforming to the +// "container.image.id" semantic conventions. It represents the runtime specific +// image identifier. Usually a hash algorithm followed by a UUID. +func ContainerImageID(val string) attribute.KeyValue { + return ContainerImageIDKey.String(val) +} + +// ContainerImageName returns an attribute KeyValue conforming to the +// "container.image.name" semantic conventions. It represents the name of the +// image the container was built on. +func ContainerImageName(val string) attribute.KeyValue { + return ContainerImageNameKey.String(val) +} + +// ContainerImageRepoDigests returns an attribute KeyValue conforming to the +// "container.image.repo_digests" semantic conventions. It represents the repo +// digests of the container image as provided by the container runtime. +func ContainerImageRepoDigests(val ...string) attribute.KeyValue { + return ContainerImageRepoDigestsKey.StringSlice(val) +} + +// ContainerImageTags returns an attribute KeyValue conforming to the +// "container.image.tags" semantic conventions. It represents the container image +// tags. An example can be found in [Docker Image Inspect]. Should be only the +// `` section of the full name for example from +// `registry.example.com/my-org/my-image:`. +// +// [Docker Image Inspect]: https://docs.docker.com/engine/api/v1.43/#tag/Image/operation/ImageInspect +func ContainerImageTags(val ...string) attribute.KeyValue { + return ContainerImageTagsKey.StringSlice(val) +} + +// ContainerName returns an attribute KeyValue conforming to the "container.name" +// semantic conventions. It represents the container name used by container +// runtime. +func ContainerName(val string) attribute.KeyValue { + return ContainerNameKey.String(val) +} + +// ContainerRuntime returns an attribute KeyValue conforming to the +// "container.runtime" semantic conventions. It represents the container runtime +// managing this container. +func ContainerRuntime(val string) attribute.KeyValue { + return ContainerRuntimeKey.String(val) +} + +// Namespace: cpu +const ( + // CPULogicalNumberKey is the attribute Key conforming to the + // "cpu.logical_number" semantic conventions. It represents the logical CPU + // number [0..n-1]. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + CPULogicalNumberKey = attribute.Key("cpu.logical_number") + + // CPUModeKey is the attribute Key conforming to the "cpu.mode" semantic + // conventions. It represents the mode of the CPU. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "user", "system" + CPUModeKey = attribute.Key("cpu.mode") +) + +// CPULogicalNumber returns an attribute KeyValue conforming to the +// "cpu.logical_number" semantic conventions. It represents the logical CPU +// number [0..n-1]. +func CPULogicalNumber(val int) attribute.KeyValue { + return CPULogicalNumberKey.Int(val) +} + +// Enum values for cpu.mode +var ( + // user + // Stability: development + CPUModeUser = CPUModeKey.String("user") + // system + // Stability: development + CPUModeSystem = CPUModeKey.String("system") + // nice + // Stability: development + CPUModeNice = CPUModeKey.String("nice") + // idle + // Stability: development + CPUModeIdle = CPUModeKey.String("idle") + // iowait + // Stability: development + CPUModeIOWait = CPUModeKey.String("iowait") + // interrupt + // Stability: development + CPUModeInterrupt = CPUModeKey.String("interrupt") + // steal + // Stability: development + CPUModeSteal = CPUModeKey.String("steal") + // kernel + // Stability: development + CPUModeKernel = CPUModeKey.String("kernel") +) + +// Namespace: db +const ( + // DBClientConnectionPoolNameKey is the attribute Key conforming to the + // "db.client.connection.pool.name" semantic conventions. It represents the name + // of the connection pool; unique within the instrumented application. In case + // the connection pool implementation doesn't provide a name, instrumentation + // SHOULD use a combination of parameters that would make the name unique, for + // example, combining attributes `server.address`, `server.port`, and + // `db.namespace`, formatted as `server.address:server.port/db.namespace`. + // Instrumentations that generate connection pool name following different + // patterns SHOULD document it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myDataSource" + DBClientConnectionPoolNameKey = attribute.Key("db.client.connection.pool.name") + + // DBClientConnectionStateKey is the attribute Key conforming to the + // "db.client.connection.state" semantic conventions. It represents the state of + // a connection in the pool. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "idle" + DBClientConnectionStateKey = attribute.Key("db.client.connection.state") + + // DBCollectionNameKey is the attribute Key conforming to the + // "db.collection.name" semantic conventions. It represents the name of a + // collection (table, container) within the database. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "public.users", "customers" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // The collection name SHOULD NOT be extracted from `db.query.text`, + // when the database system supports query text with multiple collections + // in non-batch operations. + // + // For batch operations, if the individual operations are known to have the same + // collection name then that collection name SHOULD be used. + DBCollectionNameKey = attribute.Key("db.collection.name") + + // DBNamespaceKey is the attribute Key conforming to the "db.namespace" semantic + // conventions. It represents the name of the database, fully qualified within + // the server address and port. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "customers", "test.users" + // Note: If a database system has multiple namespace components, they SHOULD be + // concatenated from the most general to the most specific namespace component, + // using `|` as a separator between the components. Any missing components (and + // their associated separators) SHOULD be omitted. + // Semantic conventions for individual database systems SHOULD document what + // `db.namespace` means in the context of that system. + // It is RECOMMENDED to capture the value as provided by the application without + // attempting to do any case normalization. + DBNamespaceKey = attribute.Key("db.namespace") + + // DBOperationBatchSizeKey is the attribute Key conforming to the + // "db.operation.batch.size" semantic conventions. It represents the number of + // queries included in a batch operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 2, 3, 4 + // Note: Operations are only considered batches when they contain two or more + // operations, and so `db.operation.batch.size` SHOULD never be `1`. + DBOperationBatchSizeKey = attribute.Key("db.operation.batch.size") + + // DBOperationNameKey is the attribute Key conforming to the "db.operation.name" + // semantic conventions. It represents the name of the operation or command + // being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "findAndModify", "HMSET", "SELECT" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // The operation name SHOULD NOT be extracted from `db.query.text`, + // when the database system supports query text with multiple operations + // in non-batch operations. + // + // If spaces can occur in the operation name, multiple consecutive spaces + // SHOULD be normalized to a single space. + // + // For batch operations, if the individual operations are known to have the same + // operation name + // then that operation name SHOULD be used prepended by `BATCH `, + // otherwise `db.operation.name` SHOULD be `BATCH` or some other database + // system specific term if more applicable. + DBOperationNameKey = attribute.Key("db.operation.name") + + // DBQuerySummaryKey is the attribute Key conforming to the "db.query.summary" + // semantic conventions. It represents the low cardinality summary of a database + // query. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "SELECT wuser_table", "INSERT shipping_details SELECT orders", "get + // user by id" + // Note: The query summary describes a class of database queries and is useful + // as a grouping key, especially when analyzing telemetry for database + // calls involving complex queries. + // + // Summary may be available to the instrumentation through + // instrumentation hooks or other means. If it is not available, + // instrumentations + // that support query parsing SHOULD generate a summary following + // [Generating query summary] + // section. + // + // [Generating query summary]: /docs/database/database-spans.md#generating-a-summary-of-the-query + DBQuerySummaryKey = attribute.Key("db.query.summary") + + // DBQueryTextKey is the attribute Key conforming to the "db.query.text" + // semantic conventions. It represents the database query being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "SELECT * FROM wuser_table where username = ?", "SET mykey ?" + // Note: For sanitization see [Sanitization of `db.query.text`]. + // For batch operations, if the individual operations are known to have the same + // query text then that query text SHOULD be used, otherwise all of the + // individual query texts SHOULD be concatenated with separator `; ` or some + // other database system specific separator if more applicable. + // Parameterized query text SHOULD NOT be sanitized. Even though parameterized + // query text can potentially have sensitive data, by using a parameterized + // query the user is giving a strong signal that any sensitive data will be + // passed as parameter values, and the benefit to observability of capturing the + // static part of the query text by default outweighs the risk. + // + // [Sanitization of `db.query.text`]: /docs/database/database-spans.md#sanitization-of-dbquerytext + DBQueryTextKey = attribute.Key("db.query.text") + + // DBResponseReturnedRowsKey is the attribute Key conforming to the + // "db.response.returned_rows" semantic conventions. It represents the number of + // rows returned by the operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 10, 30, 1000 + DBResponseReturnedRowsKey = attribute.Key("db.response.returned_rows") + + // DBResponseStatusCodeKey is the attribute Key conforming to the + // "db.response.status_code" semantic conventions. It represents the database + // response status code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "102", "ORA-17002", "08P01", "404" + // Note: The status code returned by the database. Usually it represents an + // error code, but may also represent partial success, warning, or differentiate + // between various types of successful outcomes. + // Semantic conventions for individual database systems SHOULD document what + // `db.response.status_code` means in the context of that system. + DBResponseStatusCodeKey = attribute.Key("db.response.status_code") + + // DBStoredProcedureNameKey is the attribute Key conforming to the + // "db.stored_procedure.name" semantic conventions. It represents the name of a + // stored procedure within the database. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GetCustomer" + // Note: It is RECOMMENDED to capture the value as provided by the application + // without attempting to do any case normalization. + // + // For batch operations, if the individual operations are known to have the same + // stored procedure name then that stored procedure name SHOULD be used. + DBStoredProcedureNameKey = attribute.Key("db.stored_procedure.name") + + // DBSystemNameKey is the attribute Key conforming to the "db.system.name" + // semantic conventions. It represents the database management system (DBMS) + // product as identified by the client instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + // Note: The actual DBMS may differ from the one identified by the client. For + // example, when using PostgreSQL client libraries to connect to a CockroachDB, + // the `db.system.name` is set to `postgresql` based on the instrumentation's + // best knowledge. + DBSystemNameKey = attribute.Key("db.system.name") +) + +// DBClientConnectionPoolName returns an attribute KeyValue conforming to the +// "db.client.connection.pool.name" semantic conventions. It represents the name +// of the connection pool; unique within the instrumented application. In case +// the connection pool implementation doesn't provide a name, instrumentation +// SHOULD use a combination of parameters that would make the name unique, for +// example, combining attributes `server.address`, `server.port`, and +// `db.namespace`, formatted as `server.address:server.port/db.namespace`. +// Instrumentations that generate connection pool name following different +// patterns SHOULD document it. +func DBClientConnectionPoolName(val string) attribute.KeyValue { + return DBClientConnectionPoolNameKey.String(val) +} + +// DBCollectionName returns an attribute KeyValue conforming to the +// "db.collection.name" semantic conventions. It represents the name of a +// collection (table, container) within the database. +func DBCollectionName(val string) attribute.KeyValue { + return DBCollectionNameKey.String(val) +} + +// DBNamespace returns an attribute KeyValue conforming to the "db.namespace" +// semantic conventions. It represents the name of the database, fully qualified +// within the server address and port. +func DBNamespace(val string) attribute.KeyValue { + return DBNamespaceKey.String(val) +} + +// DBOperationBatchSize returns an attribute KeyValue conforming to the +// "db.operation.batch.size" semantic conventions. It represents the number of +// queries included in a batch operation. +func DBOperationBatchSize(val int) attribute.KeyValue { + return DBOperationBatchSizeKey.Int(val) +} + +// DBOperationName returns an attribute KeyValue conforming to the +// "db.operation.name" semantic conventions. It represents the name of the +// operation or command being executed. +func DBOperationName(val string) attribute.KeyValue { + return DBOperationNameKey.String(val) +} + +// DBQuerySummary returns an attribute KeyValue conforming to the +// "db.query.summary" semantic conventions. It represents the low cardinality +// summary of a database query. +func DBQuerySummary(val string) attribute.KeyValue { + return DBQuerySummaryKey.String(val) +} + +// DBQueryText returns an attribute KeyValue conforming to the "db.query.text" +// semantic conventions. It represents the database query being executed. +func DBQueryText(val string) attribute.KeyValue { + return DBQueryTextKey.String(val) +} + +// DBResponseReturnedRows returns an attribute KeyValue conforming to the +// "db.response.returned_rows" semantic conventions. It represents the number of +// rows returned by the operation. +func DBResponseReturnedRows(val int) attribute.KeyValue { + return DBResponseReturnedRowsKey.Int(val) +} + +// DBResponseStatusCode returns an attribute KeyValue conforming to the +// "db.response.status_code" semantic conventions. It represents the database +// response status code. +func DBResponseStatusCode(val string) attribute.KeyValue { + return DBResponseStatusCodeKey.String(val) +} + +// DBStoredProcedureName returns an attribute KeyValue conforming to the +// "db.stored_procedure.name" semantic conventions. It represents the name of a +// stored procedure within the database. +func DBStoredProcedureName(val string) attribute.KeyValue { + return DBStoredProcedureNameKey.String(val) +} + +// Enum values for db.client.connection.state +var ( + // idle + // Stability: development + DBClientConnectionStateIdle = DBClientConnectionStateKey.String("idle") + // used + // Stability: development + DBClientConnectionStateUsed = DBClientConnectionStateKey.String("used") +) + +// Enum values for db.system.name +var ( + // Some other SQL database. Fallback only. + // Stability: development + DBSystemNameOtherSQL = DBSystemNameKey.String("other_sql") + // [Adabas (Adaptable Database System)] + // Stability: development + // + // [Adabas (Adaptable Database System)]: https://documentation.softwareag.com/?pf=adabas + DBSystemNameSoftwareagAdabas = DBSystemNameKey.String("softwareag.adabas") + // [Actian Ingres] + // Stability: development + // + // [Actian Ingres]: https://www.actian.com/databases/ingres/ + DBSystemNameActianIngres = DBSystemNameKey.String("actian.ingres") + // [Amazon DynamoDB] + // Stability: development + // + // [Amazon DynamoDB]: https://aws.amazon.com/pm/dynamodb/ + DBSystemNameAWSDynamoDB = DBSystemNameKey.String("aws.dynamodb") + // [Amazon Redshift] + // Stability: development + // + // [Amazon Redshift]: https://aws.amazon.com/redshift/ + DBSystemNameAWSRedshift = DBSystemNameKey.String("aws.redshift") + // [Azure Cosmos DB] + // Stability: development + // + // [Azure Cosmos DB]: https://learn.microsoft.com/azure/cosmos-db + DBSystemNameAzureCosmosDB = DBSystemNameKey.String("azure.cosmosdb") + // [InterSystems Caché] + // Stability: development + // + // [InterSystems Caché]: https://www.intersystems.com/products/cache/ + DBSystemNameIntersystemsCache = DBSystemNameKey.String("intersystems.cache") + // [Apache Cassandra] + // Stability: development + // + // [Apache Cassandra]: https://cassandra.apache.org/ + DBSystemNameCassandra = DBSystemNameKey.String("cassandra") + // [ClickHouse] + // Stability: development + // + // [ClickHouse]: https://clickhouse.com/ + DBSystemNameClickHouse = DBSystemNameKey.String("clickhouse") + // [CockroachDB] + // Stability: development + // + // [CockroachDB]: https://www.cockroachlabs.com/ + DBSystemNameCockroachDB = DBSystemNameKey.String("cockroachdb") + // [Couchbase] + // Stability: development + // + // [Couchbase]: https://www.couchbase.com/ + DBSystemNameCouchbase = DBSystemNameKey.String("couchbase") + // [Apache CouchDB] + // Stability: development + // + // [Apache CouchDB]: https://couchdb.apache.org/ + DBSystemNameCouchDB = DBSystemNameKey.String("couchdb") + // [Apache Derby] + // Stability: development + // + // [Apache Derby]: https://db.apache.org/derby/ + DBSystemNameDerby = DBSystemNameKey.String("derby") + // [Elasticsearch] + // Stability: development + // + // [Elasticsearch]: https://www.elastic.co/elasticsearch + DBSystemNameElasticsearch = DBSystemNameKey.String("elasticsearch") + // [Firebird] + // Stability: development + // + // [Firebird]: https://www.firebirdsql.org/ + DBSystemNameFirebirdSQL = DBSystemNameKey.String("firebirdsql") + // [Google Cloud Spanner] + // Stability: development + // + // [Google Cloud Spanner]: https://cloud.google.com/spanner + DBSystemNameGCPSpanner = DBSystemNameKey.String("gcp.spanner") + // [Apache Geode] + // Stability: development + // + // [Apache Geode]: https://geode.apache.org/ + DBSystemNameGeode = DBSystemNameKey.String("geode") + // [H2 Database] + // Stability: development + // + // [H2 Database]: https://h2database.com/ + DBSystemNameH2database = DBSystemNameKey.String("h2database") + // [Apache HBase] + // Stability: development + // + // [Apache HBase]: https://hbase.apache.org/ + DBSystemNameHBase = DBSystemNameKey.String("hbase") + // [Apache Hive] + // Stability: development + // + // [Apache Hive]: https://hive.apache.org/ + DBSystemNameHive = DBSystemNameKey.String("hive") + // [HyperSQL Database] + // Stability: development + // + // [HyperSQL Database]: https://hsqldb.org/ + DBSystemNameHSQLDB = DBSystemNameKey.String("hsqldb") + // [IBM Db2] + // Stability: development + // + // [IBM Db2]: https://www.ibm.com/db2 + DBSystemNameIBMDB2 = DBSystemNameKey.String("ibm.db2") + // [IBM Informix] + // Stability: development + // + // [IBM Informix]: https://www.ibm.com/products/informix + DBSystemNameIBMInformix = DBSystemNameKey.String("ibm.informix") + // [IBM Netezza] + // Stability: development + // + // [IBM Netezza]: https://www.ibm.com/products/netezza + DBSystemNameIBMNetezza = DBSystemNameKey.String("ibm.netezza") + // [InfluxDB] + // Stability: development + // + // [InfluxDB]: https://www.influxdata.com/ + DBSystemNameInfluxDB = DBSystemNameKey.String("influxdb") + // [Instant] + // Stability: development + // + // [Instant]: https://www.instantdb.com/ + DBSystemNameInstantDB = DBSystemNameKey.String("instantdb") + // [MariaDB] + // Stability: stable + // + // [MariaDB]: https://mariadb.org/ + DBSystemNameMariaDB = DBSystemNameKey.String("mariadb") + // [Memcached] + // Stability: development + // + // [Memcached]: https://memcached.org/ + DBSystemNameMemcached = DBSystemNameKey.String("memcached") + // [MongoDB] + // Stability: development + // + // [MongoDB]: https://www.mongodb.com/ + DBSystemNameMongoDB = DBSystemNameKey.String("mongodb") + // [Microsoft SQL Server] + // Stability: stable + // + // [Microsoft SQL Server]: https://www.microsoft.com/sql-server + DBSystemNameMicrosoftSQLServer = DBSystemNameKey.String("microsoft.sql_server") + // [MySQL] + // Stability: stable + // + // [MySQL]: https://www.mysql.com/ + DBSystemNameMySQL = DBSystemNameKey.String("mysql") + // [Neo4j] + // Stability: development + // + // [Neo4j]: https://neo4j.com/ + DBSystemNameNeo4j = DBSystemNameKey.String("neo4j") + // [OpenSearch] + // Stability: development + // + // [OpenSearch]: https://opensearch.org/ + DBSystemNameOpenSearch = DBSystemNameKey.String("opensearch") + // [Oracle Database] + // Stability: development + // + // [Oracle Database]: https://www.oracle.com/database/ + DBSystemNameOracleDB = DBSystemNameKey.String("oracle.db") + // [PostgreSQL] + // Stability: stable + // + // [PostgreSQL]: https://www.postgresql.org/ + DBSystemNamePostgreSQL = DBSystemNameKey.String("postgresql") + // [Redis] + // Stability: development + // + // [Redis]: https://redis.io/ + DBSystemNameRedis = DBSystemNameKey.String("redis") + // [SAP HANA] + // Stability: development + // + // [SAP HANA]: https://www.sap.com/products/technology-platform/hana/what-is-sap-hana.html + DBSystemNameSAPHANA = DBSystemNameKey.String("sap.hana") + // [SAP MaxDB] + // Stability: development + // + // [SAP MaxDB]: https://maxdb.sap.com/ + DBSystemNameSAPMaxDB = DBSystemNameKey.String("sap.maxdb") + // [SQLite] + // Stability: development + // + // [SQLite]: https://www.sqlite.org/ + DBSystemNameSQLite = DBSystemNameKey.String("sqlite") + // [Teradata] + // Stability: development + // + // [Teradata]: https://www.teradata.com/ + DBSystemNameTeradata = DBSystemNameKey.String("teradata") + // [Trino] + // Stability: development + // + // [Trino]: https://trino.io/ + DBSystemNameTrino = DBSystemNameKey.String("trino") +) + +// Namespace: deployment +const ( + // DeploymentEnvironmentNameKey is the attribute Key conforming to the + // "deployment.environment.name" semantic conventions. It represents the name of + // the [deployment environment] (aka deployment tier). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "staging", "production" + // Note: `deployment.environment.name` does not affect the uniqueness + // constraints defined through + // the `service.namespace`, `service.name` and `service.instance.id` resource + // attributes. + // This implies that resources carrying the following attribute combinations + // MUST be + // considered to be identifying the same service: + // + // - `service.name=frontend`, `deployment.environment.name=production` + // - `service.name=frontend`, `deployment.environment.name=staging`. + // + // + // [deployment environment]: https://wikipedia.org/wiki/Deployment_environment + DeploymentEnvironmentNameKey = attribute.Key("deployment.environment.name") + + // DeploymentIDKey is the attribute Key conforming to the "deployment.id" + // semantic conventions. It represents the id of the deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1208" + DeploymentIDKey = attribute.Key("deployment.id") + + // DeploymentNameKey is the attribute Key conforming to the "deployment.name" + // semantic conventions. It represents the name of the deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "deploy my app", "deploy-frontend" + DeploymentNameKey = attribute.Key("deployment.name") + + // DeploymentStatusKey is the attribute Key conforming to the + // "deployment.status" semantic conventions. It represents the status of the + // deployment. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + DeploymentStatusKey = attribute.Key("deployment.status") +) + +// DeploymentEnvironmentName returns an attribute KeyValue conforming to the +// "deployment.environment.name" semantic conventions. It represents the name of +// the [deployment environment] (aka deployment tier). +// +// [deployment environment]: https://wikipedia.org/wiki/Deployment_environment +func DeploymentEnvironmentName(val string) attribute.KeyValue { + return DeploymentEnvironmentNameKey.String(val) +} + +// DeploymentID returns an attribute KeyValue conforming to the "deployment.id" +// semantic conventions. It represents the id of the deployment. +func DeploymentID(val string) attribute.KeyValue { + return DeploymentIDKey.String(val) +} + +// DeploymentName returns an attribute KeyValue conforming to the +// "deployment.name" semantic conventions. It represents the name of the +// deployment. +func DeploymentName(val string) attribute.KeyValue { + return DeploymentNameKey.String(val) +} + +// Enum values for deployment.status +var ( + // failed + // Stability: development + DeploymentStatusFailed = DeploymentStatusKey.String("failed") + // succeeded + // Stability: development + DeploymentStatusSucceeded = DeploymentStatusKey.String("succeeded") +) + +// Namespace: destination +const ( + // DestinationAddressKey is the attribute Key conforming to the + // "destination.address" semantic conventions. It represents the destination + // address - domain name if available without reverse DNS lookup; otherwise, IP + // address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "destination.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the source side, and when communicating through an + // intermediary, `destination.address` SHOULD represent the destination address + // behind any intermediaries, for example proxies, if it's available. + DestinationAddressKey = attribute.Key("destination.address") + + // DestinationPortKey is the attribute Key conforming to the "destination.port" + // semantic conventions. It represents the destination port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3389, 2888 + DestinationPortKey = attribute.Key("destination.port") +) + +// DestinationAddress returns an attribute KeyValue conforming to the +// "destination.address" semantic conventions. It represents the destination +// address - domain name if available without reverse DNS lookup; otherwise, IP +// address or Unix domain socket name. +func DestinationAddress(val string) attribute.KeyValue { + return DestinationAddressKey.String(val) +} + +// DestinationPort returns an attribute KeyValue conforming to the +// "destination.port" semantic conventions. It represents the destination port +// number. +func DestinationPort(val int) attribute.KeyValue { + return DestinationPortKey.Int(val) +} + +// Namespace: device +const ( + // DeviceIDKey is the attribute Key conforming to the "device.id" semantic + // conventions. It represents a unique identifier representing the device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123456789012345", "01:23:45:67:89:AB" + // Note: Its value SHOULD be identical for all apps on a device and it SHOULD + // NOT change if an app is uninstalled and re-installed. + // However, it might be resettable by the user for all apps on a device. + // Hardware IDs (e.g. vendor-specific serial number, IMEI or MAC address) MAY be + // used as values. + // + // More information about Android identifier best practices can be found [here] + // . + // + // > [!WARNING]> This attribute may contain sensitive (PII) information. Caution + // > should be taken when storing personal data or anything which can identify a + // > user. GDPR and data protection laws may apply, + // > ensure you do your own due diligence.> Due to these reasons, this + // > identifier is not recommended for consumer applications and will likely + // > result in rejection from both Google Play and App Store. + // > However, it may be appropriate for specific enterprise scenarios, such as + // > kiosk devices or enterprise-managed devices, with appropriate compliance + // > clearance. + // > Any instrumentation providing this identifier MUST implement it as an + // > opt-in feature.> See [`app.installation.id`]> for a more + // > privacy-preserving alternative. + // + // [here]: https://developer.android.com/training/articles/user-data-ids + // [`app.installation.id`]: /docs/registry/attributes/app.md#app-installation-id + DeviceIDKey = attribute.Key("device.id") + + // DeviceManufacturerKey is the attribute Key conforming to the + // "device.manufacturer" semantic conventions. It represents the name of the + // device manufacturer. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Apple", "Samsung" + // Note: The Android OS provides this field via [Build]. iOS apps SHOULD + // hardcode the value `Apple`. + // + // [Build]: https://developer.android.com/reference/android/os/Build#MANUFACTURER + DeviceManufacturerKey = attribute.Key("device.manufacturer") + + // DeviceModelIdentifierKey is the attribute Key conforming to the + // "device.model.identifier" semantic conventions. It represents the model + // identifier for the device. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iPhone3,4", "SM-G920F" + // Note: It's recommended this value represents a machine-readable version of + // the model identifier rather than the market or consumer-friendly name of the + // device. + DeviceModelIdentifierKey = attribute.Key("device.model.identifier") + + // DeviceModelNameKey is the attribute Key conforming to the "device.model.name" + // semantic conventions. It represents the marketing name for the device model. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iPhone 6s Plus", "Samsung Galaxy S6" + // Note: It's recommended this value represents a human-readable version of the + // device model rather than a machine-readable alternative. + DeviceModelNameKey = attribute.Key("device.model.name") +) + +// DeviceID returns an attribute KeyValue conforming to the "device.id" semantic +// conventions. It represents a unique identifier representing the device. +func DeviceID(val string) attribute.KeyValue { + return DeviceIDKey.String(val) +} + +// DeviceManufacturer returns an attribute KeyValue conforming to the +// "device.manufacturer" semantic conventions. It represents the name of the +// device manufacturer. +func DeviceManufacturer(val string) attribute.KeyValue { + return DeviceManufacturerKey.String(val) +} + +// DeviceModelIdentifier returns an attribute KeyValue conforming to the +// "device.model.identifier" semantic conventions. It represents the model +// identifier for the device. +func DeviceModelIdentifier(val string) attribute.KeyValue { + return DeviceModelIdentifierKey.String(val) +} + +// DeviceModelName returns an attribute KeyValue conforming to the +// "device.model.name" semantic conventions. It represents the marketing name for +// the device model. +func DeviceModelName(val string) attribute.KeyValue { + return DeviceModelNameKey.String(val) +} + +// Namespace: disk +const ( + // DiskIODirectionKey is the attribute Key conforming to the "disk.io.direction" + // semantic conventions. It represents the disk IO operation direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "read" + DiskIODirectionKey = attribute.Key("disk.io.direction") +) + +// Enum values for disk.io.direction +var ( + // read + // Stability: development + DiskIODirectionRead = DiskIODirectionKey.String("read") + // write + // Stability: development + DiskIODirectionWrite = DiskIODirectionKey.String("write") +) + +// Namespace: dns +const ( + // DNSQuestionNameKey is the attribute Key conforming to the "dns.question.name" + // semantic conventions. It represents the name being queried. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "www.example.com", "opentelemetry.io" + // Note: If the name field contains non-printable characters (below 32 or above + // 126), those characters should be represented as escaped base 10 integers + // (\DDD). Back slashes and quotes should be escaped. Tabs, carriage returns, + // and line feeds should be converted to \t, \r, and \n respectively. + DNSQuestionNameKey = attribute.Key("dns.question.name") +) + +// DNSQuestionName returns an attribute KeyValue conforming to the +// "dns.question.name" semantic conventions. It represents the name being +// queried. +func DNSQuestionName(val string) attribute.KeyValue { + return DNSQuestionNameKey.String(val) +} + +// Namespace: elasticsearch +const ( + // ElasticsearchNodeNameKey is the attribute Key conforming to the + // "elasticsearch.node.name" semantic conventions. It represents the represents + // the human-readable identifier of the node/instance to which a request was + // routed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "instance-0000000001" + ElasticsearchNodeNameKey = attribute.Key("elasticsearch.node.name") +) + +// ElasticsearchNodeName returns an attribute KeyValue conforming to the +// "elasticsearch.node.name" semantic conventions. It represents the represents +// the human-readable identifier of the node/instance to which a request was +// routed. +func ElasticsearchNodeName(val string) attribute.KeyValue { + return ElasticsearchNodeNameKey.String(val) +} + +// Namespace: enduser +const ( + // EnduserIDKey is the attribute Key conforming to the "enduser.id" semantic + // conventions. It represents the unique identifier of an end user in the + // system. It maybe a username, email address, or other identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "username" + // Note: Unique identifier of an end user in the system. + // + // > [!Warning] + // > This field contains sensitive (PII) information. + EnduserIDKey = attribute.Key("enduser.id") + + // EnduserPseudoIDKey is the attribute Key conforming to the "enduser.pseudo.id" + // semantic conventions. It represents the pseudonymous identifier of an end + // user. This identifier should be a random value that is not directly linked or + // associated with the end user's actual identity. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "QdH5CAWJgqVT4rOr0qtumf" + // Note: Pseudonymous identifier of an end user. + // + // > [!Warning] + // > This field contains sensitive (linkable PII) information. + EnduserPseudoIDKey = attribute.Key("enduser.pseudo.id") +) + +// EnduserID returns an attribute KeyValue conforming to the "enduser.id" +// semantic conventions. It represents the unique identifier of an end user in +// the system. It maybe a username, email address, or other identifier. +func EnduserID(val string) attribute.KeyValue { + return EnduserIDKey.String(val) +} + +// EnduserPseudoID returns an attribute KeyValue conforming to the +// "enduser.pseudo.id" semantic conventions. It represents the pseudonymous +// identifier of an end user. This identifier should be a random value that is +// not directly linked or associated with the end user's actual identity. +func EnduserPseudoID(val string) attribute.KeyValue { + return EnduserPseudoIDKey.String(val) +} + +// Namespace: error +const ( + // ErrorMessageKey is the attribute Key conforming to the "error.message" + // semantic conventions. It represents a message providing more detail about an + // error in human-readable form. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Unexpected input type: string", "The user has exceeded their + // storage quota" + // Note: `error.message` should provide additional context and detail about an + // error. + // It is NOT RECOMMENDED to duplicate the value of `error.type` in + // `error.message`. + // It is also NOT RECOMMENDED to duplicate the value of `exception.message` in + // `error.message`. + // + // `error.message` is NOT RECOMMENDED for metrics or spans due to its unbounded + // cardinality and overlap with span status. + ErrorMessageKey = attribute.Key("error.message") + + // ErrorTypeKey is the attribute Key conforming to the "error.type" semantic + // conventions. It represents the describes a class of error the operation ended + // with. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "timeout", "java.net.UnknownHostException", + // "server_certificate_invalid", "500" + // Note: The `error.type` SHOULD be predictable, and SHOULD have low + // cardinality. + // + // When `error.type` is set to a type (e.g., an exception type), its + // canonical class name identifying the type within the artifact SHOULD be used. + // + // Instrumentations SHOULD document the list of errors they report. + // + // The cardinality of `error.type` within one instrumentation library SHOULD be + // low. + // Telemetry consumers that aggregate data from multiple instrumentation + // libraries and applications + // should be prepared for `error.type` to have high cardinality at query time + // when no + // additional filters are applied. + // + // If the operation has completed successfully, instrumentations SHOULD NOT set + // `error.type`. + // + // If a specific domain defines its own set of error identifiers (such as HTTP + // or gRPC status codes), + // it's RECOMMENDED to: + // + // - Use a domain-specific attribute + // - Set `error.type` to capture all errors, regardless of whether they are + // defined within the domain-specific set or not. + ErrorTypeKey = attribute.Key("error.type") +) + +// ErrorMessage returns an attribute KeyValue conforming to the "error.message" +// semantic conventions. It represents a message providing more detail about an +// error in human-readable form. +func ErrorMessage(val string) attribute.KeyValue { + return ErrorMessageKey.String(val) +} + +// Enum values for error.type +var ( + // A fallback error value to be used when the instrumentation doesn't define a + // custom value. + // + // Stability: stable + ErrorTypeOther = ErrorTypeKey.String("_OTHER") +) + +// Namespace: exception +const ( + // ExceptionMessageKey is the attribute Key conforming to the + // "exception.message" semantic conventions. It represents the exception + // message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "Division by zero", "Can't convert 'int' object to str implicitly" + ExceptionMessageKey = attribute.Key("exception.message") + + // ExceptionStacktraceKey is the attribute Key conforming to the + // "exception.stacktrace" semantic conventions. It represents a stacktrace as a + // string in the natural representation for the language runtime. The + // representation is to be determined and documented by each language SIG. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: Exception in thread "main" java.lang.RuntimeException: Test + // exception\n at com.example.GenerateTrace.methodB(GenerateTrace.java:13)\n at + // com.example.GenerateTrace.methodA(GenerateTrace.java:9)\n at + // com.example.GenerateTrace.main(GenerateTrace.java:5) + ExceptionStacktraceKey = attribute.Key("exception.stacktrace") + + // ExceptionTypeKey is the attribute Key conforming to the "exception.type" + // semantic conventions. It represents the type of the exception (its + // fully-qualified class name, if applicable). The dynamic type of the exception + // should be preferred over the static type in languages that support it. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "java.net.ConnectException", "OSError" + ExceptionTypeKey = attribute.Key("exception.type") +) + +// ExceptionMessage returns an attribute KeyValue conforming to the +// "exception.message" semantic conventions. It represents the exception message. +func ExceptionMessage(val string) attribute.KeyValue { + return ExceptionMessageKey.String(val) +} + +// ExceptionStacktrace returns an attribute KeyValue conforming to the +// "exception.stacktrace" semantic conventions. It represents a stacktrace as a +// string in the natural representation for the language runtime. The +// representation is to be determined and documented by each language SIG. +func ExceptionStacktrace(val string) attribute.KeyValue { + return ExceptionStacktraceKey.String(val) +} + +// ExceptionType returns an attribute KeyValue conforming to the "exception.type" +// semantic conventions. It represents the type of the exception (its +// fully-qualified class name, if applicable). The dynamic type of the exception +// should be preferred over the static type in languages that support it. +func ExceptionType(val string) attribute.KeyValue { + return ExceptionTypeKey.String(val) +} + +// Namespace: faas +const ( + // FaaSColdstartKey is the attribute Key conforming to the "faas.coldstart" + // semantic conventions. It represents a boolean that is true if the serverless + // function is executed for the first time (aka cold-start). + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSColdstartKey = attribute.Key("faas.coldstart") + + // FaaSCronKey is the attribute Key conforming to the "faas.cron" semantic + // conventions. It represents a string containing the schedule period as + // [Cron Expression]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0/5 * * * ? * + // + // [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm + FaaSCronKey = attribute.Key("faas.cron") + + // FaaSDocumentCollectionKey is the attribute Key conforming to the + // "faas.document.collection" semantic conventions. It represents the name of + // the source on which the triggering operation was performed. For example, in + // Cloud Storage or S3 corresponds to the bucket name, and in Cosmos DB to the + // database name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myBucketName", "myDbName" + FaaSDocumentCollectionKey = attribute.Key("faas.document.collection") + + // FaaSDocumentNameKey is the attribute Key conforming to the + // "faas.document.name" semantic conventions. It represents the document + // name/table subjected to the operation. For example, in Cloud Storage or S3 is + // the name of the file, and in Cosmos DB the table name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "myFile.txt", "myTableName" + FaaSDocumentNameKey = attribute.Key("faas.document.name") + + // FaaSDocumentOperationKey is the attribute Key conforming to the + // "faas.document.operation" semantic conventions. It represents the describes + // the type of the operation that was performed on the data. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSDocumentOperationKey = attribute.Key("faas.document.operation") + + // FaaSDocumentTimeKey is the attribute Key conforming to the + // "faas.document.time" semantic conventions. It represents a string containing + // the time when the data was accessed in the [ISO 8601] format expressed in + // [UTC]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 2020-01-23T13:47:06Z + // + // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html + // [UTC]: https://www.w3.org/TR/NOTE-datetime + FaaSDocumentTimeKey = attribute.Key("faas.document.time") + + // FaaSInstanceKey is the attribute Key conforming to the "faas.instance" + // semantic conventions. It represents the execution environment ID as a string, + // that will be potentially reused for other invocations to the same + // function/function version. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021/06/28/[$LATEST]2f399eb14537447da05ab2a2e39309de" + // Note: - **AWS Lambda:** Use the (full) log stream name. + FaaSInstanceKey = attribute.Key("faas.instance") + + // FaaSInvocationIDKey is the attribute Key conforming to the + // "faas.invocation_id" semantic conventions. It represents the invocation ID of + // the current function invocation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: af9d5aa4-a685-4c5f-a22b-444f80b3cc28 + FaaSInvocationIDKey = attribute.Key("faas.invocation_id") + + // FaaSInvokedNameKey is the attribute Key conforming to the "faas.invoked_name" + // semantic conventions. It represents the name of the invoked function. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: my-function + // Note: SHOULD be equal to the `faas.name` resource attribute of the invoked + // function. + FaaSInvokedNameKey = attribute.Key("faas.invoked_name") + + // FaaSInvokedProviderKey is the attribute Key conforming to the + // "faas.invoked_provider" semantic conventions. It represents the cloud + // provider of the invoked function. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: SHOULD be equal to the `cloud.provider` resource attribute of the + // invoked function. + FaaSInvokedProviderKey = attribute.Key("faas.invoked_provider") + + // FaaSInvokedRegionKey is the attribute Key conforming to the + // "faas.invoked_region" semantic conventions. It represents the cloud region of + // the invoked function. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: eu-central-1 + // Note: SHOULD be equal to the `cloud.region` resource attribute of the invoked + // function. + FaaSInvokedRegionKey = attribute.Key("faas.invoked_region") + + // FaaSMaxMemoryKey is the attribute Key conforming to the "faas.max_memory" + // semantic conventions. It represents the amount of memory available to the + // serverless function converted to Bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: It's recommended to set this attribute since e.g. too little memory can + // easily stop a Java AWS Lambda function from working correctly. On AWS Lambda, + // the environment variable `AWS_LAMBDA_FUNCTION_MEMORY_SIZE` provides this + // information (which must be multiplied by 1,048,576). + FaaSMaxMemoryKey = attribute.Key("faas.max_memory") + + // FaaSNameKey is the attribute Key conforming to the "faas.name" semantic + // conventions. It represents the name of the single function that this runtime + // instance executes. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-function", "myazurefunctionapp/some-function-name" + // Note: This is the name of the function as configured/deployed on the FaaS + // platform and is usually different from the name of the callback + // function (which may be stored in the + // [`code.namespace`/`code.function.name`] + // span attributes). + // + // For some cloud providers, the above definition is ambiguous. The following + // definition of function name MUST be used for this attribute + // (and consequently the span name) for the listed cloud providers/products: + // + // - **Azure:** The full name `/`, i.e., function app name + // followed by a forward slash followed by the function name (this form + // can also be seen in the resource JSON for the function). + // This means that a span attribute MUST be used, as an Azure function + // app can host multiple functions that would usually share + // a TracerProvider (see also the `cloud.resource_id` attribute). + // + // + // [`code.namespace`/`code.function.name`]: /docs/general/attributes.md#source-code-attributes + FaaSNameKey = attribute.Key("faas.name") + + // FaaSTimeKey is the attribute Key conforming to the "faas.time" semantic + // conventions. It represents a string containing the function invocation time + // in the [ISO 8601] format expressed in [UTC]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 2020-01-23T13:47:06Z + // + // [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html + // [UTC]: https://www.w3.org/TR/NOTE-datetime + FaaSTimeKey = attribute.Key("faas.time") + + // FaaSTriggerKey is the attribute Key conforming to the "faas.trigger" semantic + // conventions. It represents the type of the trigger which caused this function + // invocation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FaaSTriggerKey = attribute.Key("faas.trigger") + + // FaaSVersionKey is the attribute Key conforming to the "faas.version" semantic + // conventions. It represents the immutable version of the function being + // executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "26", "pinkfroid-00002" + // Note: Depending on the cloud provider and platform, use: + // + // - **AWS Lambda:** The [function version] + // (an integer represented as a decimal string). + // - **Google Cloud Run (Services):** The [revision] + // (i.e., the function name plus the revision suffix). + // - **Google Cloud Functions:** The value of the + // [`K_REVISION` environment variable]. + // - **Azure Functions:** Not applicable. Do not set this attribute. + // + // + // [function version]: https://docs.aws.amazon.com/lambda/latest/dg/configuration-versions.html + // [revision]: https://cloud.google.com/run/docs/managing/revisions + // [`K_REVISION` environment variable]: https://cloud.google.com/functions/docs/env-var#runtime_environment_variables_set_automatically + FaaSVersionKey = attribute.Key("faas.version") +) + +// FaaSColdstart returns an attribute KeyValue conforming to the "faas.coldstart" +// semantic conventions. It represents a boolean that is true if the serverless +// function is executed for the first time (aka cold-start). +func FaaSColdstart(val bool) attribute.KeyValue { + return FaaSColdstartKey.Bool(val) +} + +// FaaSCron returns an attribute KeyValue conforming to the "faas.cron" semantic +// conventions. It represents a string containing the schedule period as +// [Cron Expression]. +// +// [Cron Expression]: https://docs.oracle.com/cd/E12058_01/doc/doc.1014/e12030/cron_expressions.htm +func FaaSCron(val string) attribute.KeyValue { + return FaaSCronKey.String(val) +} + +// FaaSDocumentCollection returns an attribute KeyValue conforming to the +// "faas.document.collection" semantic conventions. It represents the name of the +// source on which the triggering operation was performed. For example, in Cloud +// Storage or S3 corresponds to the bucket name, and in Cosmos DB to the database +// name. +func FaaSDocumentCollection(val string) attribute.KeyValue { + return FaaSDocumentCollectionKey.String(val) +} + +// FaaSDocumentName returns an attribute KeyValue conforming to the +// "faas.document.name" semantic conventions. It represents the document +// name/table subjected to the operation. For example, in Cloud Storage or S3 is +// the name of the file, and in Cosmos DB the table name. +func FaaSDocumentName(val string) attribute.KeyValue { + return FaaSDocumentNameKey.String(val) +} + +// FaaSDocumentTime returns an attribute KeyValue conforming to the +// "faas.document.time" semantic conventions. It represents a string containing +// the time when the data was accessed in the [ISO 8601] format expressed in +// [UTC]. +// +// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html +// [UTC]: https://www.w3.org/TR/NOTE-datetime +func FaaSDocumentTime(val string) attribute.KeyValue { + return FaaSDocumentTimeKey.String(val) +} + +// FaaSInstance returns an attribute KeyValue conforming to the "faas.instance" +// semantic conventions. It represents the execution environment ID as a string, +// that will be potentially reused for other invocations to the same +// function/function version. +func FaaSInstance(val string) attribute.KeyValue { + return FaaSInstanceKey.String(val) +} + +// FaaSInvocationID returns an attribute KeyValue conforming to the +// "faas.invocation_id" semantic conventions. It represents the invocation ID of +// the current function invocation. +func FaaSInvocationID(val string) attribute.KeyValue { + return FaaSInvocationIDKey.String(val) +} + +// FaaSInvokedName returns an attribute KeyValue conforming to the +// "faas.invoked_name" semantic conventions. It represents the name of the +// invoked function. +func FaaSInvokedName(val string) attribute.KeyValue { + return FaaSInvokedNameKey.String(val) +} + +// FaaSInvokedRegion returns an attribute KeyValue conforming to the +// "faas.invoked_region" semantic conventions. It represents the cloud region of +// the invoked function. +func FaaSInvokedRegion(val string) attribute.KeyValue { + return FaaSInvokedRegionKey.String(val) +} + +// FaaSMaxMemory returns an attribute KeyValue conforming to the +// "faas.max_memory" semantic conventions. It represents the amount of memory +// available to the serverless function converted to Bytes. +func FaaSMaxMemory(val int) attribute.KeyValue { + return FaaSMaxMemoryKey.Int(val) +} + +// FaaSName returns an attribute KeyValue conforming to the "faas.name" semantic +// conventions. It represents the name of the single function that this runtime +// instance executes. +func FaaSName(val string) attribute.KeyValue { + return FaaSNameKey.String(val) +} + +// FaaSTime returns an attribute KeyValue conforming to the "faas.time" semantic +// conventions. It represents a string containing the function invocation time in +// the [ISO 8601] format expressed in [UTC]. +// +// [ISO 8601]: https://www.iso.org/iso-8601-date-and-time-format.html +// [UTC]: https://www.w3.org/TR/NOTE-datetime +func FaaSTime(val string) attribute.KeyValue { + return FaaSTimeKey.String(val) +} + +// FaaSVersion returns an attribute KeyValue conforming to the "faas.version" +// semantic conventions. It represents the immutable version of the function +// being executed. +func FaaSVersion(val string) attribute.KeyValue { + return FaaSVersionKey.String(val) +} + +// Enum values for faas.document.operation +var ( + // When a new object is created. + // Stability: development + FaaSDocumentOperationInsert = FaaSDocumentOperationKey.String("insert") + // When an object is modified. + // Stability: development + FaaSDocumentOperationEdit = FaaSDocumentOperationKey.String("edit") + // When an object is deleted. + // Stability: development + FaaSDocumentOperationDelete = FaaSDocumentOperationKey.String("delete") +) + +// Enum values for faas.invoked_provider +var ( + // Alibaba Cloud + // Stability: development + FaaSInvokedProviderAlibabaCloud = FaaSInvokedProviderKey.String("alibaba_cloud") + // Amazon Web Services + // Stability: development + FaaSInvokedProviderAWS = FaaSInvokedProviderKey.String("aws") + // Microsoft Azure + // Stability: development + FaaSInvokedProviderAzure = FaaSInvokedProviderKey.String("azure") + // Google Cloud Platform + // Stability: development + FaaSInvokedProviderGCP = FaaSInvokedProviderKey.String("gcp") + // Tencent Cloud + // Stability: development + FaaSInvokedProviderTencentCloud = FaaSInvokedProviderKey.String("tencent_cloud") +) + +// Enum values for faas.trigger +var ( + // A response to some data source operation such as a database or filesystem + // read/write + // Stability: development + FaaSTriggerDatasource = FaaSTriggerKey.String("datasource") + // To provide an answer to an inbound HTTP request + // Stability: development + FaaSTriggerHTTP = FaaSTriggerKey.String("http") + // A function is set to be executed when messages are sent to a messaging system + // Stability: development + FaaSTriggerPubSub = FaaSTriggerKey.String("pubsub") + // A function is scheduled to be executed regularly + // Stability: development + FaaSTriggerTimer = FaaSTriggerKey.String("timer") + // If none of the others apply + // Stability: development + FaaSTriggerOther = FaaSTriggerKey.String("other") +) + +// Namespace: feature_flag +const ( + // FeatureFlagContextIDKey is the attribute Key conforming to the + // "feature_flag.context.id" semantic conventions. It represents the unique + // identifier for the flag evaluation context. For example, the targeting key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "5157782b-2203-4c80-a857-dbbd5e7761db" + FeatureFlagContextIDKey = attribute.Key("feature_flag.context.id") + + // FeatureFlagKeyKey is the attribute Key conforming to the "feature_flag.key" + // semantic conventions. It represents the lookup key of the feature flag. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "logo-color" + FeatureFlagKeyKey = attribute.Key("feature_flag.key") + + // FeatureFlagProviderNameKey is the attribute Key conforming to the + // "feature_flag.provider.name" semantic conventions. It represents the + // identifies the feature flag provider. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Flag Manager" + FeatureFlagProviderNameKey = attribute.Key("feature_flag.provider.name") + + // FeatureFlagResultReasonKey is the attribute Key conforming to the + // "feature_flag.result.reason" semantic conventions. It represents the reason + // code which shows how a feature flag value was determined. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "static", "targeting_match", "error", "default" + FeatureFlagResultReasonKey = attribute.Key("feature_flag.result.reason") + + // FeatureFlagResultValueKey is the attribute Key conforming to the + // "feature_flag.result.value" semantic conventions. It represents the evaluated + // value of the feature flag. + // + // Type: any + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "#ff0000", true, 3 + // Note: With some feature flag providers, feature flag results can be quite + // large or contain private or sensitive details. + // Because of this, `feature_flag.result.variant` is often the preferred + // attribute if it is available. + // + // It may be desirable to redact or otherwise limit the size and scope of + // `feature_flag.result.value` if possible. + // Because the evaluated flag value is unstructured and may be any type, it is + // left to the instrumentation author to determine how best to achieve this. + FeatureFlagResultValueKey = attribute.Key("feature_flag.result.value") + + // FeatureFlagResultVariantKey is the attribute Key conforming to the + // "feature_flag.result.variant" semantic conventions. It represents a semantic + // identifier for an evaluated flag value. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "red", "true", "on" + // Note: A semantic identifier, commonly referred to as a variant, provides a + // means + // for referring to a value without including the value itself. This can + // provide additional context for understanding the meaning behind a value. + // For example, the variant `red` maybe be used for the value `#c05543`. + FeatureFlagResultVariantKey = attribute.Key("feature_flag.result.variant") + + // FeatureFlagSetIDKey is the attribute Key conforming to the + // "feature_flag.set.id" semantic conventions. It represents the identifier of + // the [flag set] to which the feature flag belongs. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "proj-1", "ab98sgs", "service1/dev" + // + // [flag set]: https://openfeature.dev/specification/glossary/#flag-set + FeatureFlagSetIDKey = attribute.Key("feature_flag.set.id") + + // FeatureFlagVersionKey is the attribute Key conforming to the + // "feature_flag.version" semantic conventions. It represents the version of the + // ruleset used during the evaluation. This may be any stable value which + // uniquely identifies the ruleset. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1", "01ABCDEF" + FeatureFlagVersionKey = attribute.Key("feature_flag.version") +) + +// FeatureFlagContextID returns an attribute KeyValue conforming to the +// "feature_flag.context.id" semantic conventions. It represents the unique +// identifier for the flag evaluation context. For example, the targeting key. +func FeatureFlagContextID(val string) attribute.KeyValue { + return FeatureFlagContextIDKey.String(val) +} + +// FeatureFlagKey returns an attribute KeyValue conforming to the +// "feature_flag.key" semantic conventions. It represents the lookup key of the +// feature flag. +func FeatureFlagKey(val string) attribute.KeyValue { + return FeatureFlagKeyKey.String(val) +} + +// FeatureFlagProviderName returns an attribute KeyValue conforming to the +// "feature_flag.provider.name" semantic conventions. It represents the +// identifies the feature flag provider. +func FeatureFlagProviderName(val string) attribute.KeyValue { + return FeatureFlagProviderNameKey.String(val) +} + +// FeatureFlagResultVariant returns an attribute KeyValue conforming to the +// "feature_flag.result.variant" semantic conventions. It represents a semantic +// identifier for an evaluated flag value. +func FeatureFlagResultVariant(val string) attribute.KeyValue { + return FeatureFlagResultVariantKey.String(val) +} + +// FeatureFlagSetID returns an attribute KeyValue conforming to the +// "feature_flag.set.id" semantic conventions. It represents the identifier of +// the [flag set] to which the feature flag belongs. +// +// [flag set]: https://openfeature.dev/specification/glossary/#flag-set +func FeatureFlagSetID(val string) attribute.KeyValue { + return FeatureFlagSetIDKey.String(val) +} + +// FeatureFlagVersion returns an attribute KeyValue conforming to the +// "feature_flag.version" semantic conventions. It represents the version of the +// ruleset used during the evaluation. This may be any stable value which +// uniquely identifies the ruleset. +func FeatureFlagVersion(val string) attribute.KeyValue { + return FeatureFlagVersionKey.String(val) +} + +// Enum values for feature_flag.result.reason +var ( + // The resolved value is static (no dynamic evaluation). + // Stability: development + FeatureFlagResultReasonStatic = FeatureFlagResultReasonKey.String("static") + // The resolved value fell back to a pre-configured value (no dynamic evaluation + // occurred or dynamic evaluation yielded no result). + // Stability: development + FeatureFlagResultReasonDefault = FeatureFlagResultReasonKey.String("default") + // The resolved value was the result of a dynamic evaluation, such as a rule or + // specific user-targeting. + // Stability: development + FeatureFlagResultReasonTargetingMatch = FeatureFlagResultReasonKey.String("targeting_match") + // The resolved value was the result of pseudorandom assignment. + // Stability: development + FeatureFlagResultReasonSplit = FeatureFlagResultReasonKey.String("split") + // The resolved value was retrieved from cache. + // Stability: development + FeatureFlagResultReasonCached = FeatureFlagResultReasonKey.String("cached") + // The resolved value was the result of the flag being disabled in the + // management system. + // Stability: development + FeatureFlagResultReasonDisabled = FeatureFlagResultReasonKey.String("disabled") + // The reason for the resolved value could not be determined. + // Stability: development + FeatureFlagResultReasonUnknown = FeatureFlagResultReasonKey.String("unknown") + // The resolved value is non-authoritative or possibly out of date + // Stability: development + FeatureFlagResultReasonStale = FeatureFlagResultReasonKey.String("stale") + // The resolved value was the result of an error. + // Stability: development + FeatureFlagResultReasonError = FeatureFlagResultReasonKey.String("error") +) + +// Namespace: file +const ( + // FileAccessedKey is the attribute Key conforming to the "file.accessed" + // semantic conventions. It represents the time when the file was last accessed, + // in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: This attribute might not be supported by some file systems — NFS, + // FAT32, in embedded OS, etc. + FileAccessedKey = attribute.Key("file.accessed") + + // FileAttributesKey is the attribute Key conforming to the "file.attributes" + // semantic conventions. It represents the array of file attributes. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "readonly", "hidden" + // Note: Attributes names depend on the OS or file system. Here’s a + // non-exhaustive list of values expected for this attribute: `archive`, + // `compressed`, `directory`, `encrypted`, `execute`, `hidden`, `immutable`, + // `journaled`, `read`, `readonly`, `symbolic link`, `system`, `temporary`, + // `write`. + FileAttributesKey = attribute.Key("file.attributes") + + // FileChangedKey is the attribute Key conforming to the "file.changed" semantic + // conventions. It represents the time when the file attributes or metadata was + // last changed, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: `file.changed` captures the time when any of the file's properties or + // attributes (including the content) are changed, while `file.modified` + // captures the timestamp when the file content is modified. + FileChangedKey = attribute.Key("file.changed") + + // FileCreatedKey is the attribute Key conforming to the "file.created" semantic + // conventions. It represents the time when the file was created, in ISO 8601 + // format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + // Note: This attribute might not be supported by some file systems — NFS, + // FAT32, in embedded OS, etc. + FileCreatedKey = attribute.Key("file.created") + + // FileDirectoryKey is the attribute Key conforming to the "file.directory" + // semantic conventions. It represents the directory where the file is located. + // It should include the drive letter, when appropriate. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/home/user", "C:\Program Files\MyApp" + FileDirectoryKey = attribute.Key("file.directory") + + // FileExtensionKey is the attribute Key conforming to the "file.extension" + // semantic conventions. It represents the file extension, excluding the leading + // dot. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "png", "gz" + // Note: When the file name has multiple extensions (example.tar.gz), only the + // last one should be captured ("gz", not "tar.gz"). + FileExtensionKey = attribute.Key("file.extension") + + // FileForkNameKey is the attribute Key conforming to the "file.fork_name" + // semantic conventions. It represents the name of the fork. A fork is + // additional data associated with a filesystem object. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Zone.Identifer" + // Note: On Linux, a resource fork is used to store additional data with a + // filesystem object. A file always has at least one fork for the data portion, + // and additional forks may exist. + // On NTFS, this is analogous to an Alternate Data Stream (ADS), and the default + // data stream for a file is just called $DATA. Zone.Identifier is commonly used + // by Windows to track contents downloaded from the Internet. An ADS is + // typically of the form: C:\path\to\filename.extension:some_fork_name, and + // some_fork_name is the value that should populate `fork_name`. + // `filename.extension` should populate `file.name`, and `extension` should + // populate `file.extension`. The full path, `file.path`, will include the fork + // name. + FileForkNameKey = attribute.Key("file.fork_name") + + // FileGroupIDKey is the attribute Key conforming to the "file.group.id" + // semantic conventions. It represents the primary Group ID (GID) of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1000" + FileGroupIDKey = attribute.Key("file.group.id") + + // FileGroupNameKey is the attribute Key conforming to the "file.group.name" + // semantic conventions. It represents the primary group name of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "users" + FileGroupNameKey = attribute.Key("file.group.name") + + // FileInodeKey is the attribute Key conforming to the "file.inode" semantic + // conventions. It represents the inode representing the file in the filesystem. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "256383" + FileInodeKey = attribute.Key("file.inode") + + // FileModeKey is the attribute Key conforming to the "file.mode" semantic + // conventions. It represents the mode of the file in octal representation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0640" + FileModeKey = attribute.Key("file.mode") + + // FileModifiedKey is the attribute Key conforming to the "file.modified" + // semantic conventions. It represents the time when the file content was last + // modified, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T12:00:00Z" + FileModifiedKey = attribute.Key("file.modified") + + // FileNameKey is the attribute Key conforming to the "file.name" semantic + // conventions. It represents the name of the file including the extension, + // without the directory. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "example.png" + FileNameKey = attribute.Key("file.name") + + // FileOwnerIDKey is the attribute Key conforming to the "file.owner.id" + // semantic conventions. It represents the user ID (UID) or security identifier + // (SID) of the file owner. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1000" + FileOwnerIDKey = attribute.Key("file.owner.id") + + // FileOwnerNameKey is the attribute Key conforming to the "file.owner.name" + // semantic conventions. It represents the username of the file owner. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + FileOwnerNameKey = attribute.Key("file.owner.name") + + // FilePathKey is the attribute Key conforming to the "file.path" semantic + // conventions. It represents the full path to the file, including the file + // name. It should include the drive letter, when appropriate. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/home/alice/example.png", "C:\Program Files\MyApp\myapp.exe" + FilePathKey = attribute.Key("file.path") + + // FileSizeKey is the attribute Key conforming to the "file.size" semantic + // conventions. It represents the file size in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + FileSizeKey = attribute.Key("file.size") + + // FileSymbolicLinkTargetPathKey is the attribute Key conforming to the + // "file.symbolic_link.target_path" semantic conventions. It represents the path + // to the target of a symbolic link. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/usr/bin/python3" + // Note: This attribute is only applicable to symbolic links. + FileSymbolicLinkTargetPathKey = attribute.Key("file.symbolic_link.target_path") +) + +// FileAccessed returns an attribute KeyValue conforming to the "file.accessed" +// semantic conventions. It represents the time when the file was last accessed, +// in ISO 8601 format. +func FileAccessed(val string) attribute.KeyValue { + return FileAccessedKey.String(val) +} + +// FileAttributes returns an attribute KeyValue conforming to the +// "file.attributes" semantic conventions. It represents the array of file +// attributes. +func FileAttributes(val ...string) attribute.KeyValue { + return FileAttributesKey.StringSlice(val) +} + +// FileChanged returns an attribute KeyValue conforming to the "file.changed" +// semantic conventions. It represents the time when the file attributes or +// metadata was last changed, in ISO 8601 format. +func FileChanged(val string) attribute.KeyValue { + return FileChangedKey.String(val) +} + +// FileCreated returns an attribute KeyValue conforming to the "file.created" +// semantic conventions. It represents the time when the file was created, in ISO +// 8601 format. +func FileCreated(val string) attribute.KeyValue { + return FileCreatedKey.String(val) +} + +// FileDirectory returns an attribute KeyValue conforming to the "file.directory" +// semantic conventions. It represents the directory where the file is located. +// It should include the drive letter, when appropriate. +func FileDirectory(val string) attribute.KeyValue { + return FileDirectoryKey.String(val) +} + +// FileExtension returns an attribute KeyValue conforming to the "file.extension" +// semantic conventions. It represents the file extension, excluding the leading +// dot. +func FileExtension(val string) attribute.KeyValue { + return FileExtensionKey.String(val) +} + +// FileForkName returns an attribute KeyValue conforming to the "file.fork_name" +// semantic conventions. It represents the name of the fork. A fork is additional +// data associated with a filesystem object. +func FileForkName(val string) attribute.KeyValue { + return FileForkNameKey.String(val) +} + +// FileGroupID returns an attribute KeyValue conforming to the "file.group.id" +// semantic conventions. It represents the primary Group ID (GID) of the file. +func FileGroupID(val string) attribute.KeyValue { + return FileGroupIDKey.String(val) +} + +// FileGroupName returns an attribute KeyValue conforming to the +// "file.group.name" semantic conventions. It represents the primary group name +// of the file. +func FileGroupName(val string) attribute.KeyValue { + return FileGroupNameKey.String(val) +} + +// FileInode returns an attribute KeyValue conforming to the "file.inode" +// semantic conventions. It represents the inode representing the file in the +// filesystem. +func FileInode(val string) attribute.KeyValue { + return FileInodeKey.String(val) +} + +// FileMode returns an attribute KeyValue conforming to the "file.mode" semantic +// conventions. It represents the mode of the file in octal representation. +func FileMode(val string) attribute.KeyValue { + return FileModeKey.String(val) +} + +// FileModified returns an attribute KeyValue conforming to the "file.modified" +// semantic conventions. It represents the time when the file content was last +// modified, in ISO 8601 format. +func FileModified(val string) attribute.KeyValue { + return FileModifiedKey.String(val) +} + +// FileName returns an attribute KeyValue conforming to the "file.name" semantic +// conventions. It represents the name of the file including the extension, +// without the directory. +func FileName(val string) attribute.KeyValue { + return FileNameKey.String(val) +} + +// FileOwnerID returns an attribute KeyValue conforming to the "file.owner.id" +// semantic conventions. It represents the user ID (UID) or security identifier +// (SID) of the file owner. +func FileOwnerID(val string) attribute.KeyValue { + return FileOwnerIDKey.String(val) +} + +// FileOwnerName returns an attribute KeyValue conforming to the +// "file.owner.name" semantic conventions. It represents the username of the file +// owner. +func FileOwnerName(val string) attribute.KeyValue { + return FileOwnerNameKey.String(val) +} + +// FilePath returns an attribute KeyValue conforming to the "file.path" semantic +// conventions. It represents the full path to the file, including the file name. +// It should include the drive letter, when appropriate. +func FilePath(val string) attribute.KeyValue { + return FilePathKey.String(val) +} + +// FileSize returns an attribute KeyValue conforming to the "file.size" semantic +// conventions. It represents the file size in bytes. +func FileSize(val int) attribute.KeyValue { + return FileSizeKey.Int(val) +} + +// FileSymbolicLinkTargetPath returns an attribute KeyValue conforming to the +// "file.symbolic_link.target_path" semantic conventions. It represents the path +// to the target of a symbolic link. +func FileSymbolicLinkTargetPath(val string) attribute.KeyValue { + return FileSymbolicLinkTargetPathKey.String(val) +} + +// Namespace: gcp +const ( + // GCPAppHubApplicationContainerKey is the attribute Key conforming to the + // "gcp.apphub.application.container" semantic conventions. It represents the + // container within GCP where the AppHub application is defined. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "projects/my-container-project" + GCPAppHubApplicationContainerKey = attribute.Key("gcp.apphub.application.container") + + // GCPAppHubApplicationIDKey is the attribute Key conforming to the + // "gcp.apphub.application.id" semantic conventions. It represents the name of + // the application as configured in AppHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-application" + GCPAppHubApplicationIDKey = attribute.Key("gcp.apphub.application.id") + + // GCPAppHubApplicationLocationKey is the attribute Key conforming to the + // "gcp.apphub.application.location" semantic conventions. It represents the GCP + // zone or region where the application is defined. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "us-central1" + GCPAppHubApplicationLocationKey = attribute.Key("gcp.apphub.application.location") + + // GCPAppHubServiceCriticalityTypeKey is the attribute Key conforming to the + // "gcp.apphub.service.criticality_type" semantic conventions. It represents the + // criticality of a service indicates its importance to the business. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub type enum] + // + // [See AppHub type enum]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type + GCPAppHubServiceCriticalityTypeKey = attribute.Key("gcp.apphub.service.criticality_type") + + // GCPAppHubServiceEnvironmentTypeKey is the attribute Key conforming to the + // "gcp.apphub.service.environment_type" semantic conventions. It represents the + // environment of a service is the stage of a software lifecycle. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub environment type] + // + // [See AppHub environment type]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type_1 + GCPAppHubServiceEnvironmentTypeKey = attribute.Key("gcp.apphub.service.environment_type") + + // GCPAppHubServiceIDKey is the attribute Key conforming to the + // "gcp.apphub.service.id" semantic conventions. It represents the name of the + // service as configured in AppHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-service" + GCPAppHubServiceIDKey = attribute.Key("gcp.apphub.service.id") + + // GCPAppHubWorkloadCriticalityTypeKey is the attribute Key conforming to the + // "gcp.apphub.workload.criticality_type" semantic conventions. It represents + // the criticality of a workload indicates its importance to the business. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub type enum] + // + // [See AppHub type enum]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type + GCPAppHubWorkloadCriticalityTypeKey = attribute.Key("gcp.apphub.workload.criticality_type") + + // GCPAppHubWorkloadEnvironmentTypeKey is the attribute Key conforming to the + // "gcp.apphub.workload.environment_type" semantic conventions. It represents + // the environment of a workload is the stage of a software lifecycle. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: [See AppHub environment type] + // + // [See AppHub environment type]: https://cloud.google.com/app-hub/docs/reference/rest/v1/Attributes#type_1 + GCPAppHubWorkloadEnvironmentTypeKey = attribute.Key("gcp.apphub.workload.environment_type") + + // GCPAppHubWorkloadIDKey is the attribute Key conforming to the + // "gcp.apphub.workload.id" semantic conventions. It represents the name of the + // workload as configured in AppHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-workload" + GCPAppHubWorkloadIDKey = attribute.Key("gcp.apphub.workload.id") + + // GCPClientServiceKey is the attribute Key conforming to the + // "gcp.client.service" semantic conventions. It represents the identifies the + // Google Cloud service for which the official client library is intended. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "appengine", "run", "firestore", "alloydb", "spanner" + // Note: Intended to be a stable identifier for Google Cloud client libraries + // that is uniform across implementation languages. The value should be derived + // from the canonical service domain for the service; for example, + // 'foo.googleapis.com' should result in a value of 'foo'. + GCPClientServiceKey = attribute.Key("gcp.client.service") + + // GCPCloudRunJobExecutionKey is the attribute Key conforming to the + // "gcp.cloud_run.job.execution" semantic conventions. It represents the name of + // the Cloud Run [execution] being run for the Job, as set by the + // [`CLOUD_RUN_EXECUTION`] environment variable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "job-name-xxxx", "sample-job-mdw84" + // + // [execution]: https://cloud.google.com/run/docs/managing/job-executions + // [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars + GCPCloudRunJobExecutionKey = attribute.Key("gcp.cloud_run.job.execution") + + // GCPCloudRunJobTaskIndexKey is the attribute Key conforming to the + // "gcp.cloud_run.job.task_index" semantic conventions. It represents the index + // for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`] + // environment variable. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 1 + // + // [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars + GCPCloudRunJobTaskIndexKey = attribute.Key("gcp.cloud_run.job.task_index") + + // GCPGCEInstanceHostnameKey is the attribute Key conforming to the + // "gcp.gce.instance.hostname" semantic conventions. It represents the hostname + // of a GCE instance. This is the full value of the default or [custom hostname] + // . + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-host1234.example.com", + // "sample-vm.us-west1-b.c.my-project.internal" + // + // [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm + GCPGCEInstanceHostnameKey = attribute.Key("gcp.gce.instance.hostname") + + // GCPGCEInstanceNameKey is the attribute Key conforming to the + // "gcp.gce.instance.name" semantic conventions. It represents the instance name + // of a GCE instance. This is the value provided by `host.name`, the visible + // name of the instance in the Cloud Console UI, and the prefix for the default + // hostname of the instance as defined by the [default internal DNS name]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "instance-1", "my-vm-name" + // + // [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names + GCPGCEInstanceNameKey = attribute.Key("gcp.gce.instance.name") +) + +// GCPAppHubApplicationContainer returns an attribute KeyValue conforming to the +// "gcp.apphub.application.container" semantic conventions. It represents the +// container within GCP where the AppHub application is defined. +func GCPAppHubApplicationContainer(val string) attribute.KeyValue { + return GCPAppHubApplicationContainerKey.String(val) +} + +// GCPAppHubApplicationID returns an attribute KeyValue conforming to the +// "gcp.apphub.application.id" semantic conventions. It represents the name of +// the application as configured in AppHub. +func GCPAppHubApplicationID(val string) attribute.KeyValue { + return GCPAppHubApplicationIDKey.String(val) +} + +// GCPAppHubApplicationLocation returns an attribute KeyValue conforming to the +// "gcp.apphub.application.location" semantic conventions. It represents the GCP +// zone or region where the application is defined. +func GCPAppHubApplicationLocation(val string) attribute.KeyValue { + return GCPAppHubApplicationLocationKey.String(val) +} + +// GCPAppHubServiceID returns an attribute KeyValue conforming to the +// "gcp.apphub.service.id" semantic conventions. It represents the name of the +// service as configured in AppHub. +func GCPAppHubServiceID(val string) attribute.KeyValue { + return GCPAppHubServiceIDKey.String(val) +} + +// GCPAppHubWorkloadID returns an attribute KeyValue conforming to the +// "gcp.apphub.workload.id" semantic conventions. It represents the name of the +// workload as configured in AppHub. +func GCPAppHubWorkloadID(val string) attribute.KeyValue { + return GCPAppHubWorkloadIDKey.String(val) +} + +// GCPClientService returns an attribute KeyValue conforming to the +// "gcp.client.service" semantic conventions. It represents the identifies the +// Google Cloud service for which the official client library is intended. +func GCPClientService(val string) attribute.KeyValue { + return GCPClientServiceKey.String(val) +} + +// GCPCloudRunJobExecution returns an attribute KeyValue conforming to the +// "gcp.cloud_run.job.execution" semantic conventions. It represents the name of +// the Cloud Run [execution] being run for the Job, as set by the +// [`CLOUD_RUN_EXECUTION`] environment variable. +// +// [execution]: https://cloud.google.com/run/docs/managing/job-executions +// [`CLOUD_RUN_EXECUTION`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars +func GCPCloudRunJobExecution(val string) attribute.KeyValue { + return GCPCloudRunJobExecutionKey.String(val) +} + +// GCPCloudRunJobTaskIndex returns an attribute KeyValue conforming to the +// "gcp.cloud_run.job.task_index" semantic conventions. It represents the index +// for a task within an execution as provided by the [`CLOUD_RUN_TASK_INDEX`] +// environment variable. +// +// [`CLOUD_RUN_TASK_INDEX`]: https://cloud.google.com/run/docs/container-contract#jobs-env-vars +func GCPCloudRunJobTaskIndex(val int) attribute.KeyValue { + return GCPCloudRunJobTaskIndexKey.Int(val) +} + +// GCPGCEInstanceHostname returns an attribute KeyValue conforming to the +// "gcp.gce.instance.hostname" semantic conventions. It represents the hostname +// of a GCE instance. This is the full value of the default or [custom hostname] +// . +// +// [custom hostname]: https://cloud.google.com/compute/docs/instances/custom-hostname-vm +func GCPGCEInstanceHostname(val string) attribute.KeyValue { + return GCPGCEInstanceHostnameKey.String(val) +} + +// GCPGCEInstanceName returns an attribute KeyValue conforming to the +// "gcp.gce.instance.name" semantic conventions. It represents the instance name +// of a GCE instance. This is the value provided by `host.name`, the visible name +// of the instance in the Cloud Console UI, and the prefix for the default +// hostname of the instance as defined by the [default internal DNS name]. +// +// [default internal DNS name]: https://cloud.google.com/compute/docs/internal-dns#instance-fully-qualified-domain-names +func GCPGCEInstanceName(val string) attribute.KeyValue { + return GCPGCEInstanceNameKey.String(val) +} + +// Enum values for gcp.apphub.service.criticality_type +var ( + // Mission critical service. + // Stability: development + GCPAppHubServiceCriticalityTypeMissionCritical = GCPAppHubServiceCriticalityTypeKey.String("MISSION_CRITICAL") + // High impact. + // Stability: development + GCPAppHubServiceCriticalityTypeHigh = GCPAppHubServiceCriticalityTypeKey.String("HIGH") + // Medium impact. + // Stability: development + GCPAppHubServiceCriticalityTypeMedium = GCPAppHubServiceCriticalityTypeKey.String("MEDIUM") + // Low impact. + // Stability: development + GCPAppHubServiceCriticalityTypeLow = GCPAppHubServiceCriticalityTypeKey.String("LOW") +) + +// Enum values for gcp.apphub.service.environment_type +var ( + // Production environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeProduction = GCPAppHubServiceEnvironmentTypeKey.String("PRODUCTION") + // Staging environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeStaging = GCPAppHubServiceEnvironmentTypeKey.String("STAGING") + // Test environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeTest = GCPAppHubServiceEnvironmentTypeKey.String("TEST") + // Development environment. + // Stability: development + GCPAppHubServiceEnvironmentTypeDevelopment = GCPAppHubServiceEnvironmentTypeKey.String("DEVELOPMENT") +) + +// Enum values for gcp.apphub.workload.criticality_type +var ( + // Mission critical service. + // Stability: development + GCPAppHubWorkloadCriticalityTypeMissionCritical = GCPAppHubWorkloadCriticalityTypeKey.String("MISSION_CRITICAL") + // High impact. + // Stability: development + GCPAppHubWorkloadCriticalityTypeHigh = GCPAppHubWorkloadCriticalityTypeKey.String("HIGH") + // Medium impact. + // Stability: development + GCPAppHubWorkloadCriticalityTypeMedium = GCPAppHubWorkloadCriticalityTypeKey.String("MEDIUM") + // Low impact. + // Stability: development + GCPAppHubWorkloadCriticalityTypeLow = GCPAppHubWorkloadCriticalityTypeKey.String("LOW") +) + +// Enum values for gcp.apphub.workload.environment_type +var ( + // Production environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeProduction = GCPAppHubWorkloadEnvironmentTypeKey.String("PRODUCTION") + // Staging environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeStaging = GCPAppHubWorkloadEnvironmentTypeKey.String("STAGING") + // Test environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeTest = GCPAppHubWorkloadEnvironmentTypeKey.String("TEST") + // Development environment. + // Stability: development + GCPAppHubWorkloadEnvironmentTypeDevelopment = GCPAppHubWorkloadEnvironmentTypeKey.String("DEVELOPMENT") +) + +// Namespace: gen_ai +const ( + // GenAIAgentDescriptionKey is the attribute Key conforming to the + // "gen_ai.agent.description" semantic conventions. It represents the free-form + // description of the GenAI agent provided by the application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Helps with math problems", "Generates fiction stories" + GenAIAgentDescriptionKey = attribute.Key("gen_ai.agent.description") + + // GenAIAgentIDKey is the attribute Key conforming to the "gen_ai.agent.id" + // semantic conventions. It represents the unique identifier of the GenAI agent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "asst_5j66UpCpwteGg4YSxUnt7lPY" + GenAIAgentIDKey = attribute.Key("gen_ai.agent.id") + + // GenAIAgentNameKey is the attribute Key conforming to the "gen_ai.agent.name" + // semantic conventions. It represents the human-readable name of the GenAI + // agent provided by the application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Math Tutor", "Fiction Writer" + GenAIAgentNameKey = attribute.Key("gen_ai.agent.name") + + // GenAIConversationIDKey is the attribute Key conforming to the + // "gen_ai.conversation.id" semantic conventions. It represents the unique + // identifier for a conversation (session, thread), used to store and correlate + // messages within this conversation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "conv_5j66UpCpwteGg4YSxUnt7lPY" + GenAIConversationIDKey = attribute.Key("gen_ai.conversation.id") + + // GenAIDataSourceIDKey is the attribute Key conforming to the + // "gen_ai.data_source.id" semantic conventions. It represents the data source + // identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "H7STPQYOND" + // Note: Data sources are used by AI agents and RAG applications to store + // grounding data. A data source may be an external database, object store, + // document collection, website, or any other storage system used by the GenAI + // agent or application. The `gen_ai.data_source.id` SHOULD match the identifier + // used by the GenAI system rather than a name specific to the external storage, + // such as a database or object store. Semantic conventions referencing + // `gen_ai.data_source.id` MAY also leverage additional attributes, such as + // `db.*`, to further identify and describe the data source. + GenAIDataSourceIDKey = attribute.Key("gen_ai.data_source.id") + + // GenAIOpenAIRequestServiceTierKey is the attribute Key conforming to the + // "gen_ai.openai.request.service_tier" semantic conventions. It represents the + // service tier requested. May be a specific tier, default, or auto. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "auto", "default" + GenAIOpenAIRequestServiceTierKey = attribute.Key("gen_ai.openai.request.service_tier") + + // GenAIOpenAIResponseServiceTierKey is the attribute Key conforming to the + // "gen_ai.openai.response.service_tier" semantic conventions. It represents the + // service tier used for the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "scale", "default" + GenAIOpenAIResponseServiceTierKey = attribute.Key("gen_ai.openai.response.service_tier") + + // GenAIOpenAIResponseSystemFingerprintKey is the attribute Key conforming to + // the "gen_ai.openai.response.system_fingerprint" semantic conventions. It + // represents a fingerprint to track any eventual change in the Generative AI + // environment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "fp_44709d6fcb" + GenAIOpenAIResponseSystemFingerprintKey = attribute.Key("gen_ai.openai.response.system_fingerprint") + + // GenAIOperationNameKey is the attribute Key conforming to the + // "gen_ai.operation.name" semantic conventions. It represents the name of the + // operation being performed. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: If one of the predefined values applies, but specific system uses a + // different name it's RECOMMENDED to document it in the semantic conventions + // for specific GenAI system and use system-specific name in the + // instrumentation. If a different name is not documented, instrumentation + // libraries SHOULD use applicable predefined value. + GenAIOperationNameKey = attribute.Key("gen_ai.operation.name") + + // GenAIOutputTypeKey is the attribute Key conforming to the + // "gen_ai.output.type" semantic conventions. It represents the represents the + // content type requested by the client. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This attribute SHOULD be used when the client requests output of a + // specific type. The model may return zero or more outputs of this type. + // This attribute specifies the output modality and not the actual output + // format. For example, if an image is requested, the actual output could be a + // URL pointing to an image file. + // Additional output format details may be recorded in the future in the + // `gen_ai.output.{type}.*` attributes. + GenAIOutputTypeKey = attribute.Key("gen_ai.output.type") + + // GenAIRequestChoiceCountKey is the attribute Key conforming to the + // "gen_ai.request.choice.count" semantic conventions. It represents the target + // number of candidate completions to return. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3 + GenAIRequestChoiceCountKey = attribute.Key("gen_ai.request.choice.count") + + // GenAIRequestEncodingFormatsKey is the attribute Key conforming to the + // "gen_ai.request.encoding_formats" semantic conventions. It represents the + // encoding formats requested in an embeddings operation, if specified. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "base64"], ["float", "binary" + // Note: In some GenAI systems the encoding formats are called embedding types. + // Also, some GenAI systems only accept a single format per request. + GenAIRequestEncodingFormatsKey = attribute.Key("gen_ai.request.encoding_formats") + + // GenAIRequestFrequencyPenaltyKey is the attribute Key conforming to the + // "gen_ai.request.frequency_penalty" semantic conventions. It represents the + // frequency penalty setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.1 + GenAIRequestFrequencyPenaltyKey = attribute.Key("gen_ai.request.frequency_penalty") + + // GenAIRequestMaxTokensKey is the attribute Key conforming to the + // "gen_ai.request.max_tokens" semantic conventions. It represents the maximum + // number of tokens the model generates for a request. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIRequestMaxTokensKey = attribute.Key("gen_ai.request.max_tokens") + + // GenAIRequestModelKey is the attribute Key conforming to the + // "gen_ai.request.model" semantic conventions. It represents the name of the + // GenAI model a request is being made to. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: gpt-4 + GenAIRequestModelKey = attribute.Key("gen_ai.request.model") + + // GenAIRequestPresencePenaltyKey is the attribute Key conforming to the + // "gen_ai.request.presence_penalty" semantic conventions. It represents the + // presence penalty setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.1 + GenAIRequestPresencePenaltyKey = attribute.Key("gen_ai.request.presence_penalty") + + // GenAIRequestSeedKey is the attribute Key conforming to the + // "gen_ai.request.seed" semantic conventions. It represents the requests with + // same seed value more likely to return same result. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIRequestSeedKey = attribute.Key("gen_ai.request.seed") + + // GenAIRequestStopSequencesKey is the attribute Key conforming to the + // "gen_ai.request.stop_sequences" semantic conventions. It represents the list + // of sequences that the model will use to stop generating further tokens. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "forest", "lived" + GenAIRequestStopSequencesKey = attribute.Key("gen_ai.request.stop_sequences") + + // GenAIRequestTemperatureKey is the attribute Key conforming to the + // "gen_ai.request.temperature" semantic conventions. It represents the + // temperature setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0.0 + GenAIRequestTemperatureKey = attribute.Key("gen_ai.request.temperature") + + // GenAIRequestTopKKey is the attribute Key conforming to the + // "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling + // setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + GenAIRequestTopKKey = attribute.Key("gen_ai.request.top_k") + + // GenAIRequestTopPKey is the attribute Key conforming to the + // "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling + // setting for the GenAI request. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1.0 + GenAIRequestTopPKey = attribute.Key("gen_ai.request.top_p") + + // GenAIResponseFinishReasonsKey is the attribute Key conforming to the + // "gen_ai.response.finish_reasons" semantic conventions. It represents the + // array of reasons the model stopped generating tokens, corresponding to each + // generation received. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "stop"], ["stop", "length" + GenAIResponseFinishReasonsKey = attribute.Key("gen_ai.response.finish_reasons") + + // GenAIResponseIDKey is the attribute Key conforming to the + // "gen_ai.response.id" semantic conventions. It represents the unique + // identifier for the completion. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "chatcmpl-123" + GenAIResponseIDKey = attribute.Key("gen_ai.response.id") + + // GenAIResponseModelKey is the attribute Key conforming to the + // "gen_ai.response.model" semantic conventions. It represents the name of the + // model that generated the response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "gpt-4-0613" + GenAIResponseModelKey = attribute.Key("gen_ai.response.model") + + // GenAISystemKey is the attribute Key conforming to the "gen_ai.system" + // semantic conventions. It represents the Generative AI product as identified + // by the client or server instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: openai + // Note: The `gen_ai.system` describes a family of GenAI models with specific + // model identified + // by `gen_ai.request.model` and `gen_ai.response.model` attributes. + // + // The actual GenAI product may differ from the one identified by the client. + // Multiple systems, including Azure OpenAI and Gemini, are accessible by OpenAI + // client + // libraries. In such cases, the `gen_ai.system` is set to `openai` based on the + // instrumentation's best knowledge, instead of the actual system. The + // `server.address` + // attribute may help identify the actual system in use for `openai`. + // + // For custom model, a custom friendly name SHOULD be used. + // If none of these options apply, the `gen_ai.system` SHOULD be set to `_OTHER` + // . + GenAISystemKey = attribute.Key("gen_ai.system") + + // GenAITokenTypeKey is the attribute Key conforming to the "gen_ai.token.type" + // semantic conventions. It represents the type of token being counted. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "input", "output" + GenAITokenTypeKey = attribute.Key("gen_ai.token.type") + + // GenAIToolCallIDKey is the attribute Key conforming to the + // "gen_ai.tool.call.id" semantic conventions. It represents the tool call + // identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "call_mszuSIzqtI65i1wAUOE8w5H4" + GenAIToolCallIDKey = attribute.Key("gen_ai.tool.call.id") + + // GenAIToolDescriptionKey is the attribute Key conforming to the + // "gen_ai.tool.description" semantic conventions. It represents the tool + // description. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Multiply two numbers" + GenAIToolDescriptionKey = attribute.Key("gen_ai.tool.description") + + // GenAIToolNameKey is the attribute Key conforming to the "gen_ai.tool.name" + // semantic conventions. It represents the name of the tool utilized by the + // agent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Flights" + GenAIToolNameKey = attribute.Key("gen_ai.tool.name") + + // GenAIToolTypeKey is the attribute Key conforming to the "gen_ai.tool.type" + // semantic conventions. It represents the type of the tool utilized by the + // agent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "function", "extension", "datastore" + // Note: Extension: A tool executed on the agent-side to directly call external + // APIs, bridging the gap between the agent and real-world systems. + // Agent-side operations involve actions that are performed by the agent on the + // server or within the agent's controlled environment. + // Function: A tool executed on the client-side, where the agent generates + // parameters for a predefined function, and the client executes the logic. + // Client-side operations are actions taken on the user's end or within the + // client application. + // Datastore: A tool used by the agent to access and query structured or + // unstructured external data for retrieval-augmented tasks or knowledge + // updates. + GenAIToolTypeKey = attribute.Key("gen_ai.tool.type") + + // GenAIUsageInputTokensKey is the attribute Key conforming to the + // "gen_ai.usage.input_tokens" semantic conventions. It represents the number of + // tokens used in the GenAI input (prompt). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 100 + GenAIUsageInputTokensKey = attribute.Key("gen_ai.usage.input_tokens") + + // GenAIUsageOutputTokensKey is the attribute Key conforming to the + // "gen_ai.usage.output_tokens" semantic conventions. It represents the number + // of tokens used in the GenAI response (completion). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 180 + GenAIUsageOutputTokensKey = attribute.Key("gen_ai.usage.output_tokens") +) + +// GenAIAgentDescription returns an attribute KeyValue conforming to the +// "gen_ai.agent.description" semantic conventions. It represents the free-form +// description of the GenAI agent provided by the application. +func GenAIAgentDescription(val string) attribute.KeyValue { + return GenAIAgentDescriptionKey.String(val) +} + +// GenAIAgentID returns an attribute KeyValue conforming to the "gen_ai.agent.id" +// semantic conventions. It represents the unique identifier of the GenAI agent. +func GenAIAgentID(val string) attribute.KeyValue { + return GenAIAgentIDKey.String(val) +} + +// GenAIAgentName returns an attribute KeyValue conforming to the +// "gen_ai.agent.name" semantic conventions. It represents the human-readable +// name of the GenAI agent provided by the application. +func GenAIAgentName(val string) attribute.KeyValue { + return GenAIAgentNameKey.String(val) +} + +// GenAIConversationID returns an attribute KeyValue conforming to the +// "gen_ai.conversation.id" semantic conventions. It represents the unique +// identifier for a conversation (session, thread), used to store and correlate +// messages within this conversation. +func GenAIConversationID(val string) attribute.KeyValue { + return GenAIConversationIDKey.String(val) +} + +// GenAIDataSourceID returns an attribute KeyValue conforming to the +// "gen_ai.data_source.id" semantic conventions. It represents the data source +// identifier. +func GenAIDataSourceID(val string) attribute.KeyValue { + return GenAIDataSourceIDKey.String(val) +} + +// GenAIOpenAIResponseServiceTier returns an attribute KeyValue conforming to the +// "gen_ai.openai.response.service_tier" semantic conventions. It represents the +// service tier used for the response. +func GenAIOpenAIResponseServiceTier(val string) attribute.KeyValue { + return GenAIOpenAIResponseServiceTierKey.String(val) +} + +// GenAIOpenAIResponseSystemFingerprint returns an attribute KeyValue conforming +// to the "gen_ai.openai.response.system_fingerprint" semantic conventions. It +// represents a fingerprint to track any eventual change in the Generative AI +// environment. +func GenAIOpenAIResponseSystemFingerprint(val string) attribute.KeyValue { + return GenAIOpenAIResponseSystemFingerprintKey.String(val) +} + +// GenAIRequestChoiceCount returns an attribute KeyValue conforming to the +// "gen_ai.request.choice.count" semantic conventions. It represents the target +// number of candidate completions to return. +func GenAIRequestChoiceCount(val int) attribute.KeyValue { + return GenAIRequestChoiceCountKey.Int(val) +} + +// GenAIRequestEncodingFormats returns an attribute KeyValue conforming to the +// "gen_ai.request.encoding_formats" semantic conventions. It represents the +// encoding formats requested in an embeddings operation, if specified. +func GenAIRequestEncodingFormats(val ...string) attribute.KeyValue { + return GenAIRequestEncodingFormatsKey.StringSlice(val) +} + +// GenAIRequestFrequencyPenalty returns an attribute KeyValue conforming to the +// "gen_ai.request.frequency_penalty" semantic conventions. It represents the +// frequency penalty setting for the GenAI request. +func GenAIRequestFrequencyPenalty(val float64) attribute.KeyValue { + return GenAIRequestFrequencyPenaltyKey.Float64(val) +} + +// GenAIRequestMaxTokens returns an attribute KeyValue conforming to the +// "gen_ai.request.max_tokens" semantic conventions. It represents the maximum +// number of tokens the model generates for a request. +func GenAIRequestMaxTokens(val int) attribute.KeyValue { + return GenAIRequestMaxTokensKey.Int(val) +} + +// GenAIRequestModel returns an attribute KeyValue conforming to the +// "gen_ai.request.model" semantic conventions. It represents the name of the +// GenAI model a request is being made to. +func GenAIRequestModel(val string) attribute.KeyValue { + return GenAIRequestModelKey.String(val) +} + +// GenAIRequestPresencePenalty returns an attribute KeyValue conforming to the +// "gen_ai.request.presence_penalty" semantic conventions. It represents the +// presence penalty setting for the GenAI request. +func GenAIRequestPresencePenalty(val float64) attribute.KeyValue { + return GenAIRequestPresencePenaltyKey.Float64(val) +} + +// GenAIRequestSeed returns an attribute KeyValue conforming to the +// "gen_ai.request.seed" semantic conventions. It represents the requests with +// same seed value more likely to return same result. +func GenAIRequestSeed(val int) attribute.KeyValue { + return GenAIRequestSeedKey.Int(val) +} + +// GenAIRequestStopSequences returns an attribute KeyValue conforming to the +// "gen_ai.request.stop_sequences" semantic conventions. It represents the list +// of sequences that the model will use to stop generating further tokens. +func GenAIRequestStopSequences(val ...string) attribute.KeyValue { + return GenAIRequestStopSequencesKey.StringSlice(val) +} + +// GenAIRequestTemperature returns an attribute KeyValue conforming to the +// "gen_ai.request.temperature" semantic conventions. It represents the +// temperature setting for the GenAI request. +func GenAIRequestTemperature(val float64) attribute.KeyValue { + return GenAIRequestTemperatureKey.Float64(val) +} + +// GenAIRequestTopK returns an attribute KeyValue conforming to the +// "gen_ai.request.top_k" semantic conventions. It represents the top_k sampling +// setting for the GenAI request. +func GenAIRequestTopK(val float64) attribute.KeyValue { + return GenAIRequestTopKKey.Float64(val) +} + +// GenAIRequestTopP returns an attribute KeyValue conforming to the +// "gen_ai.request.top_p" semantic conventions. It represents the top_p sampling +// setting for the GenAI request. +func GenAIRequestTopP(val float64) attribute.KeyValue { + return GenAIRequestTopPKey.Float64(val) +} + +// GenAIResponseFinishReasons returns an attribute KeyValue conforming to the +// "gen_ai.response.finish_reasons" semantic conventions. It represents the array +// of reasons the model stopped generating tokens, corresponding to each +// generation received. +func GenAIResponseFinishReasons(val ...string) attribute.KeyValue { + return GenAIResponseFinishReasonsKey.StringSlice(val) +} + +// GenAIResponseID returns an attribute KeyValue conforming to the +// "gen_ai.response.id" semantic conventions. It represents the unique identifier +// for the completion. +func GenAIResponseID(val string) attribute.KeyValue { + return GenAIResponseIDKey.String(val) +} + +// GenAIResponseModel returns an attribute KeyValue conforming to the +// "gen_ai.response.model" semantic conventions. It represents the name of the +// model that generated the response. +func GenAIResponseModel(val string) attribute.KeyValue { + return GenAIResponseModelKey.String(val) +} + +// GenAIToolCallID returns an attribute KeyValue conforming to the +// "gen_ai.tool.call.id" semantic conventions. It represents the tool call +// identifier. +func GenAIToolCallID(val string) attribute.KeyValue { + return GenAIToolCallIDKey.String(val) +} + +// GenAIToolDescription returns an attribute KeyValue conforming to the +// "gen_ai.tool.description" semantic conventions. It represents the tool +// description. +func GenAIToolDescription(val string) attribute.KeyValue { + return GenAIToolDescriptionKey.String(val) +} + +// GenAIToolName returns an attribute KeyValue conforming to the +// "gen_ai.tool.name" semantic conventions. It represents the name of the tool +// utilized by the agent. +func GenAIToolName(val string) attribute.KeyValue { + return GenAIToolNameKey.String(val) +} + +// GenAIToolType returns an attribute KeyValue conforming to the +// "gen_ai.tool.type" semantic conventions. It represents the type of the tool +// utilized by the agent. +func GenAIToolType(val string) attribute.KeyValue { + return GenAIToolTypeKey.String(val) +} + +// GenAIUsageInputTokens returns an attribute KeyValue conforming to the +// "gen_ai.usage.input_tokens" semantic conventions. It represents the number of +// tokens used in the GenAI input (prompt). +func GenAIUsageInputTokens(val int) attribute.KeyValue { + return GenAIUsageInputTokensKey.Int(val) +} + +// GenAIUsageOutputTokens returns an attribute KeyValue conforming to the +// "gen_ai.usage.output_tokens" semantic conventions. It represents the number of +// tokens used in the GenAI response (completion). +func GenAIUsageOutputTokens(val int) attribute.KeyValue { + return GenAIUsageOutputTokensKey.Int(val) +} + +// Enum values for gen_ai.openai.request.service_tier +var ( + // The system will utilize scale tier credits until they are exhausted. + // Stability: development + GenAIOpenAIRequestServiceTierAuto = GenAIOpenAIRequestServiceTierKey.String("auto") + // The system will utilize the default scale tier. + // Stability: development + GenAIOpenAIRequestServiceTierDefault = GenAIOpenAIRequestServiceTierKey.String("default") +) + +// Enum values for gen_ai.operation.name +var ( + // Chat completion operation such as [OpenAI Chat API] + // Stability: development + // + // [OpenAI Chat API]: https://platform.openai.com/docs/api-reference/chat + GenAIOperationNameChat = GenAIOperationNameKey.String("chat") + // Multimodal content generation operation such as [Gemini Generate Content] + // Stability: development + // + // [Gemini Generate Content]: https://ai.google.dev/api/generate-content + GenAIOperationNameGenerateContent = GenAIOperationNameKey.String("generate_content") + // Text completions operation such as [OpenAI Completions API (Legacy)] + // Stability: development + // + // [OpenAI Completions API (Legacy)]: https://platform.openai.com/docs/api-reference/completions + GenAIOperationNameTextCompletion = GenAIOperationNameKey.String("text_completion") + // Embeddings operation such as [OpenAI Create embeddings API] + // Stability: development + // + // [OpenAI Create embeddings API]: https://platform.openai.com/docs/api-reference/embeddings/create + GenAIOperationNameEmbeddings = GenAIOperationNameKey.String("embeddings") + // Create GenAI agent + // Stability: development + GenAIOperationNameCreateAgent = GenAIOperationNameKey.String("create_agent") + // Invoke GenAI agent + // Stability: development + GenAIOperationNameInvokeAgent = GenAIOperationNameKey.String("invoke_agent") + // Execute a tool + // Stability: development + GenAIOperationNameExecuteTool = GenAIOperationNameKey.String("execute_tool") +) + +// Enum values for gen_ai.output.type +var ( + // Plain text + // Stability: development + GenAIOutputTypeText = GenAIOutputTypeKey.String("text") + // JSON object with known or unknown schema + // Stability: development + GenAIOutputTypeJSON = GenAIOutputTypeKey.String("json") + // Image + // Stability: development + GenAIOutputTypeImage = GenAIOutputTypeKey.String("image") + // Speech + // Stability: development + GenAIOutputTypeSpeech = GenAIOutputTypeKey.String("speech") +) + +// Enum values for gen_ai.system +var ( + // OpenAI + // Stability: development + GenAISystemOpenAI = GenAISystemKey.String("openai") + // Any Google generative AI endpoint + // Stability: development + GenAISystemGCPGenAI = GenAISystemKey.String("gcp.gen_ai") + // Vertex AI + // Stability: development + GenAISystemGCPVertexAI = GenAISystemKey.String("gcp.vertex_ai") + // Gemini + // Stability: development + GenAISystemGCPGemini = GenAISystemKey.String("gcp.gemini") + // Deprecated: Use 'gcp.vertex_ai' instead. + GenAISystemVertexAI = GenAISystemKey.String("vertex_ai") + // Deprecated: Use 'gcp.gemini' instead. + GenAISystemGemini = GenAISystemKey.String("gemini") + // Anthropic + // Stability: development + GenAISystemAnthropic = GenAISystemKey.String("anthropic") + // Cohere + // Stability: development + GenAISystemCohere = GenAISystemKey.String("cohere") + // Azure AI Inference + // Stability: development + GenAISystemAzAIInference = GenAISystemKey.String("az.ai.inference") + // Azure OpenAI + // Stability: development + GenAISystemAzAIOpenAI = GenAISystemKey.String("az.ai.openai") + // IBM Watsonx AI + // Stability: development + GenAISystemIBMWatsonxAI = GenAISystemKey.String("ibm.watsonx.ai") + // AWS Bedrock + // Stability: development + GenAISystemAWSBedrock = GenAISystemKey.String("aws.bedrock") + // Perplexity + // Stability: development + GenAISystemPerplexity = GenAISystemKey.String("perplexity") + // xAI + // Stability: development + GenAISystemXai = GenAISystemKey.String("xai") + // DeepSeek + // Stability: development + GenAISystemDeepseek = GenAISystemKey.String("deepseek") + // Groq + // Stability: development + GenAISystemGroq = GenAISystemKey.String("groq") + // Mistral AI + // Stability: development + GenAISystemMistralAI = GenAISystemKey.String("mistral_ai") +) + +// Enum values for gen_ai.token.type +var ( + // Input tokens (prompt, input, etc.) + // Stability: development + GenAITokenTypeInput = GenAITokenTypeKey.String("input") + // Deprecated: Replaced by `output`. + GenAITokenTypeCompletion = GenAITokenTypeKey.String("output") + // Output tokens (completion, response, etc.) + // Stability: development + GenAITokenTypeOutput = GenAITokenTypeKey.String("output") +) + +// Namespace: geo +const ( + // GeoContinentCodeKey is the attribute Key conforming to the + // "geo.continent.code" semantic conventions. It represents the two-letter code + // representing continent’s name. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + GeoContinentCodeKey = attribute.Key("geo.continent.code") + + // GeoCountryISOCodeKey is the attribute Key conforming to the + // "geo.country.iso_code" semantic conventions. It represents the two-letter ISO + // Country Code ([ISO 3166-1 alpha2]). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CA" + // + // [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes + GeoCountryISOCodeKey = attribute.Key("geo.country.iso_code") + + // GeoLocalityNameKey is the attribute Key conforming to the "geo.locality.name" + // semantic conventions. It represents the locality name. Represents the name of + // a city, town, village, or similar populated place. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Montreal", "Berlin" + GeoLocalityNameKey = attribute.Key("geo.locality.name") + + // GeoLocationLatKey is the attribute Key conforming to the "geo.location.lat" + // semantic conventions. It represents the latitude of the geo location in + // [WGS84]. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 45.505918 + // + // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 + GeoLocationLatKey = attribute.Key("geo.location.lat") + + // GeoLocationLonKey is the attribute Key conforming to the "geo.location.lon" + // semantic conventions. It represents the longitude of the geo location in + // [WGS84]. + // + // Type: double + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: -73.61483 + // + // [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 + GeoLocationLonKey = attribute.Key("geo.location.lon") + + // GeoPostalCodeKey is the attribute Key conforming to the "geo.postal_code" + // semantic conventions. It represents the postal code associated with the + // location. Values appropriate for this field may also be known as a postcode + // or ZIP code and will vary widely from country to country. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "94040" + GeoPostalCodeKey = attribute.Key("geo.postal_code") + + // GeoRegionISOCodeKey is the attribute Key conforming to the + // "geo.region.iso_code" semantic conventions. It represents the region ISO code + // ([ISO 3166-2]). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CA-QC" + // + // [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2 + GeoRegionISOCodeKey = attribute.Key("geo.region.iso_code") +) + +// GeoCountryISOCode returns an attribute KeyValue conforming to the +// "geo.country.iso_code" semantic conventions. It represents the two-letter ISO +// Country Code ([ISO 3166-1 alpha2]). +// +// [ISO 3166-1 alpha2]: https://wikipedia.org/wiki/ISO_3166-1#Codes +func GeoCountryISOCode(val string) attribute.KeyValue { + return GeoCountryISOCodeKey.String(val) +} + +// GeoLocalityName returns an attribute KeyValue conforming to the +// "geo.locality.name" semantic conventions. It represents the locality name. +// Represents the name of a city, town, village, or similar populated place. +func GeoLocalityName(val string) attribute.KeyValue { + return GeoLocalityNameKey.String(val) +} + +// GeoLocationLat returns an attribute KeyValue conforming to the +// "geo.location.lat" semantic conventions. It represents the latitude of the geo +// location in [WGS84]. +// +// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 +func GeoLocationLat(val float64) attribute.KeyValue { + return GeoLocationLatKey.Float64(val) +} + +// GeoLocationLon returns an attribute KeyValue conforming to the +// "geo.location.lon" semantic conventions. It represents the longitude of the +// geo location in [WGS84]. +// +// [WGS84]: https://wikipedia.org/wiki/World_Geodetic_System#WGS84 +func GeoLocationLon(val float64) attribute.KeyValue { + return GeoLocationLonKey.Float64(val) +} + +// GeoPostalCode returns an attribute KeyValue conforming to the +// "geo.postal_code" semantic conventions. It represents the postal code +// associated with the location. Values appropriate for this field may also be +// known as a postcode or ZIP code and will vary widely from country to country. +func GeoPostalCode(val string) attribute.KeyValue { + return GeoPostalCodeKey.String(val) +} + +// GeoRegionISOCode returns an attribute KeyValue conforming to the +// "geo.region.iso_code" semantic conventions. It represents the region ISO code +// ([ISO 3166-2]). +// +// [ISO 3166-2]: https://wikipedia.org/wiki/ISO_3166-2 +func GeoRegionISOCode(val string) attribute.KeyValue { + return GeoRegionISOCodeKey.String(val) +} + +// Enum values for geo.continent.code +var ( + // Africa + // Stability: development + GeoContinentCodeAf = GeoContinentCodeKey.String("AF") + // Antarctica + // Stability: development + GeoContinentCodeAn = GeoContinentCodeKey.String("AN") + // Asia + // Stability: development + GeoContinentCodeAs = GeoContinentCodeKey.String("AS") + // Europe + // Stability: development + GeoContinentCodeEu = GeoContinentCodeKey.String("EU") + // North America + // Stability: development + GeoContinentCodeNa = GeoContinentCodeKey.String("NA") + // Oceania + // Stability: development + GeoContinentCodeOc = GeoContinentCodeKey.String("OC") + // South America + // Stability: development + GeoContinentCodeSa = GeoContinentCodeKey.String("SA") +) + +// Namespace: go +const ( + // GoMemoryTypeKey is the attribute Key conforming to the "go.memory.type" + // semantic conventions. It represents the type of memory. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "other", "stack" + GoMemoryTypeKey = attribute.Key("go.memory.type") +) + +// Enum values for go.memory.type +var ( + // Memory allocated from the heap that is reserved for stack space, whether or + // not it is currently in-use. + // Stability: development + GoMemoryTypeStack = GoMemoryTypeKey.String("stack") + // Memory used by the Go runtime, excluding other categories of memory usage + // described in this enumeration. + // Stability: development + GoMemoryTypeOther = GoMemoryTypeKey.String("other") +) + +// Namespace: graphql +const ( + // GraphQLDocumentKey is the attribute Key conforming to the "graphql.document" + // semantic conventions. It represents the GraphQL document being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: query findBookById { bookById(id: ?) { name } } + // Note: The value may be sanitized to exclude sensitive information. + GraphQLDocumentKey = attribute.Key("graphql.document") + + // GraphQLOperationNameKey is the attribute Key conforming to the + // "graphql.operation.name" semantic conventions. It represents the name of the + // operation being executed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: findBookById + GraphQLOperationNameKey = attribute.Key("graphql.operation.name") + + // GraphQLOperationTypeKey is the attribute Key conforming to the + // "graphql.operation.type" semantic conventions. It represents the type of the + // operation being executed. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "query", "mutation", "subscription" + GraphQLOperationTypeKey = attribute.Key("graphql.operation.type") +) + +// GraphQLDocument returns an attribute KeyValue conforming to the +// "graphql.document" semantic conventions. It represents the GraphQL document +// being executed. +func GraphQLDocument(val string) attribute.KeyValue { + return GraphQLDocumentKey.String(val) +} + +// GraphQLOperationName returns an attribute KeyValue conforming to the +// "graphql.operation.name" semantic conventions. It represents the name of the +// operation being executed. +func GraphQLOperationName(val string) attribute.KeyValue { + return GraphQLOperationNameKey.String(val) +} + +// Enum values for graphql.operation.type +var ( + // GraphQL query + // Stability: development + GraphQLOperationTypeQuery = GraphQLOperationTypeKey.String("query") + // GraphQL mutation + // Stability: development + GraphQLOperationTypeMutation = GraphQLOperationTypeKey.String("mutation") + // GraphQL subscription + // Stability: development + GraphQLOperationTypeSubscription = GraphQLOperationTypeKey.String("subscription") +) + +// Namespace: heroku +const ( + // HerokuAppIDKey is the attribute Key conforming to the "heroku.app.id" + // semantic conventions. It represents the unique identifier for the + // application. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2daa2797-e42b-4624-9322-ec3f968df4da" + HerokuAppIDKey = attribute.Key("heroku.app.id") + + // HerokuReleaseCommitKey is the attribute Key conforming to the + // "heroku.release.commit" semantic conventions. It represents the commit hash + // for the current release. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "e6134959463efd8966b20e75b913cafe3f5ec" + HerokuReleaseCommitKey = attribute.Key("heroku.release.commit") + + // HerokuReleaseCreationTimestampKey is the attribute Key conforming to the + // "heroku.release.creation_timestamp" semantic conventions. It represents the + // time and date the release was created. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2022-10-23T18:00:42Z" + HerokuReleaseCreationTimestampKey = attribute.Key("heroku.release.creation_timestamp") +) + +// HerokuAppID returns an attribute KeyValue conforming to the "heroku.app.id" +// semantic conventions. It represents the unique identifier for the application. +func HerokuAppID(val string) attribute.KeyValue { + return HerokuAppIDKey.String(val) +} + +// HerokuReleaseCommit returns an attribute KeyValue conforming to the +// "heroku.release.commit" semantic conventions. It represents the commit hash +// for the current release. +func HerokuReleaseCommit(val string) attribute.KeyValue { + return HerokuReleaseCommitKey.String(val) +} + +// HerokuReleaseCreationTimestamp returns an attribute KeyValue conforming to the +// "heroku.release.creation_timestamp" semantic conventions. It represents the +// time and date the release was created. +func HerokuReleaseCreationTimestamp(val string) attribute.KeyValue { + return HerokuReleaseCreationTimestampKey.String(val) +} + +// Namespace: host +const ( + // HostArchKey is the attribute Key conforming to the "host.arch" semantic + // conventions. It represents the CPU architecture the host system is running + // on. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + HostArchKey = attribute.Key("host.arch") + + // HostCPUCacheL2SizeKey is the attribute Key conforming to the + // "host.cpu.cache.l2.size" semantic conventions. It represents the amount of + // level 2 memory cache available to the processor (in Bytes). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12288000 + HostCPUCacheL2SizeKey = attribute.Key("host.cpu.cache.l2.size") + + // HostCPUFamilyKey is the attribute Key conforming to the "host.cpu.family" + // semantic conventions. It represents the family or generation of the CPU. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "6", "PA-RISC 1.1e" + HostCPUFamilyKey = attribute.Key("host.cpu.family") + + // HostCPUModelIDKey is the attribute Key conforming to the "host.cpu.model.id" + // semantic conventions. It represents the model identifier. It provides more + // granular information about the CPU, distinguishing it from other CPUs within + // the same family. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "6", "9000/778/B180L" + HostCPUModelIDKey = attribute.Key("host.cpu.model.id") + + // HostCPUModelNameKey is the attribute Key conforming to the + // "host.cpu.model.name" semantic conventions. It represents the model + // designation of the processor. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "11th Gen Intel(R) Core(TM) i7-1185G7 @ 3.00GHz" + HostCPUModelNameKey = attribute.Key("host.cpu.model.name") + + // HostCPUSteppingKey is the attribute Key conforming to the "host.cpu.stepping" + // semantic conventions. It represents the stepping or core revisions. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1", "r1p1" + HostCPUSteppingKey = attribute.Key("host.cpu.stepping") + + // HostCPUVendorIDKey is the attribute Key conforming to the + // "host.cpu.vendor.id" semantic conventions. It represents the processor + // manufacturer identifier. A maximum 12-character string. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "GenuineIntel" + // Note: [CPUID] command returns the vendor ID string in EBX, EDX and ECX + // registers. Writing these to memory in this order results in a 12-character + // string. + // + // [CPUID]: https://wiki.osdev.org/CPUID + HostCPUVendorIDKey = attribute.Key("host.cpu.vendor.id") + + // HostIDKey is the attribute Key conforming to the "host.id" semantic + // conventions. It represents the unique host ID. For Cloud, this must be the + // instance_id assigned by the cloud provider. For non-containerized systems, + // this should be the `machine-id`. See the table below for the sources to use + // to determine the `machine-id` based on operating system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "fdbf79e8af94cb7f9e8df36789187052" + HostIDKey = attribute.Key("host.id") + + // HostImageIDKey is the attribute Key conforming to the "host.image.id" + // semantic conventions. It represents the VM image ID or host OS image ID. For + // Cloud, this value is from the provider. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ami-07b06b442921831e5" + HostImageIDKey = attribute.Key("host.image.id") + + // HostImageNameKey is the attribute Key conforming to the "host.image.name" + // semantic conventions. It represents the name of the VM image or OS install + // the host was instantiated from. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "infra-ami-eks-worker-node-7d4ec78312", "CentOS-8-x86_64-1905" + HostImageNameKey = attribute.Key("host.image.name") + + // HostImageVersionKey is the attribute Key conforming to the + // "host.image.version" semantic conventions. It represents the version string + // of the VM image or host OS as defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0.1" + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + HostImageVersionKey = attribute.Key("host.image.version") + + // HostIPKey is the attribute Key conforming to the "host.ip" semantic + // conventions. It represents the available IP addresses of the host, excluding + // loopback interfaces. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "192.168.1.140", "fe80::abc2:4a28:737a:609e" + // Note: IPv4 Addresses MUST be specified in dotted-quad notation. IPv6 + // addresses MUST be specified in the [RFC 5952] format. + // + // [RFC 5952]: https://www.rfc-editor.org/rfc/rfc5952.html + HostIPKey = attribute.Key("host.ip") + + // HostMacKey is the attribute Key conforming to the "host.mac" semantic + // conventions. It represents the available MAC addresses of the host, excluding + // loopback interfaces. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "AC-DE-48-23-45-67", "AC-DE-48-23-45-67-01-9F" + // Note: MAC Addresses MUST be represented in [IEEE RA hexadecimal form]: as + // hyphen-separated octets in uppercase hexadecimal form from most to least + // significant. + // + // [IEEE RA hexadecimal form]: https://standards.ieee.org/wp-content/uploads/import/documents/tutorials/eui.pdf + HostMacKey = attribute.Key("host.mac") + + // HostNameKey is the attribute Key conforming to the "host.name" semantic + // conventions. It represents the name of the host. On Unix systems, it may + // contain what the hostname command returns, or the fully qualified hostname, + // or another name specified by the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-test" + HostNameKey = attribute.Key("host.name") + + // HostTypeKey is the attribute Key conforming to the "host.type" semantic + // conventions. It represents the type of host. For Cloud, this must be the + // machine type. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "n1-standard-1" + HostTypeKey = attribute.Key("host.type") +) + +// HostCPUCacheL2Size returns an attribute KeyValue conforming to the +// "host.cpu.cache.l2.size" semantic conventions. It represents the amount of +// level 2 memory cache available to the processor (in Bytes). +func HostCPUCacheL2Size(val int) attribute.KeyValue { + return HostCPUCacheL2SizeKey.Int(val) +} + +// HostCPUFamily returns an attribute KeyValue conforming to the +// "host.cpu.family" semantic conventions. It represents the family or generation +// of the CPU. +func HostCPUFamily(val string) attribute.KeyValue { + return HostCPUFamilyKey.String(val) +} + +// HostCPUModelID returns an attribute KeyValue conforming to the +// "host.cpu.model.id" semantic conventions. It represents the model identifier. +// It provides more granular information about the CPU, distinguishing it from +// other CPUs within the same family. +func HostCPUModelID(val string) attribute.KeyValue { + return HostCPUModelIDKey.String(val) +} + +// HostCPUModelName returns an attribute KeyValue conforming to the +// "host.cpu.model.name" semantic conventions. It represents the model +// designation of the processor. +func HostCPUModelName(val string) attribute.KeyValue { + return HostCPUModelNameKey.String(val) +} + +// HostCPUStepping returns an attribute KeyValue conforming to the +// "host.cpu.stepping" semantic conventions. It represents the stepping or core +// revisions. +func HostCPUStepping(val string) attribute.KeyValue { + return HostCPUSteppingKey.String(val) +} + +// HostCPUVendorID returns an attribute KeyValue conforming to the +// "host.cpu.vendor.id" semantic conventions. It represents the processor +// manufacturer identifier. A maximum 12-character string. +func HostCPUVendorID(val string) attribute.KeyValue { + return HostCPUVendorIDKey.String(val) +} + +// HostID returns an attribute KeyValue conforming to the "host.id" semantic +// conventions. It represents the unique host ID. For Cloud, this must be the +// instance_id assigned by the cloud provider. For non-containerized systems, +// this should be the `machine-id`. See the table below for the sources to use to +// determine the `machine-id` based on operating system. +func HostID(val string) attribute.KeyValue { + return HostIDKey.String(val) +} + +// HostImageID returns an attribute KeyValue conforming to the "host.image.id" +// semantic conventions. It represents the VM image ID or host OS image ID. For +// Cloud, this value is from the provider. +func HostImageID(val string) attribute.KeyValue { + return HostImageIDKey.String(val) +} + +// HostImageName returns an attribute KeyValue conforming to the +// "host.image.name" semantic conventions. It represents the name of the VM image +// or OS install the host was instantiated from. +func HostImageName(val string) attribute.KeyValue { + return HostImageNameKey.String(val) +} + +// HostImageVersion returns an attribute KeyValue conforming to the +// "host.image.version" semantic conventions. It represents the version string of +// the VM image or host OS as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func HostImageVersion(val string) attribute.KeyValue { + return HostImageVersionKey.String(val) +} + +// HostIP returns an attribute KeyValue conforming to the "host.ip" semantic +// conventions. It represents the available IP addresses of the host, excluding +// loopback interfaces. +func HostIP(val ...string) attribute.KeyValue { + return HostIPKey.StringSlice(val) +} + +// HostMac returns an attribute KeyValue conforming to the "host.mac" semantic +// conventions. It represents the available MAC addresses of the host, excluding +// loopback interfaces. +func HostMac(val ...string) attribute.KeyValue { + return HostMacKey.StringSlice(val) +} + +// HostName returns an attribute KeyValue conforming to the "host.name" semantic +// conventions. It represents the name of the host. On Unix systems, it may +// contain what the hostname command returns, or the fully qualified hostname, or +// another name specified by the user. +func HostName(val string) attribute.KeyValue { + return HostNameKey.String(val) +} + +// HostType returns an attribute KeyValue conforming to the "host.type" semantic +// conventions. It represents the type of host. For Cloud, this must be the +// machine type. +func HostType(val string) attribute.KeyValue { + return HostTypeKey.String(val) +} + +// Enum values for host.arch +var ( + // AMD64 + // Stability: development + HostArchAMD64 = HostArchKey.String("amd64") + // ARM32 + // Stability: development + HostArchARM32 = HostArchKey.String("arm32") + // ARM64 + // Stability: development + HostArchARM64 = HostArchKey.String("arm64") + // Itanium + // Stability: development + HostArchIA64 = HostArchKey.String("ia64") + // 32-bit PowerPC + // Stability: development + HostArchPPC32 = HostArchKey.String("ppc32") + // 64-bit PowerPC + // Stability: development + HostArchPPC64 = HostArchKey.String("ppc64") + // IBM z/Architecture + // Stability: development + HostArchS390x = HostArchKey.String("s390x") + // 32-bit x86 + // Stability: development + HostArchX86 = HostArchKey.String("x86") +) + +// Namespace: http +const ( + // HTTPConnectionStateKey is the attribute Key conforming to the + // "http.connection.state" semantic conventions. It represents the state of the + // HTTP connection in the HTTP connection pool. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "active", "idle" + HTTPConnectionStateKey = attribute.Key("http.connection.state") + + // HTTPRequestBodySizeKey is the attribute Key conforming to the + // "http.request.body.size" semantic conventions. It represents the size of the + // request payload body in bytes. This is the number of bytes transferred + // excluding headers and is often, but not always, present as the + // [Content-Length] header. For requests using transport encoding, this should + // be the compressed size. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length + HTTPRequestBodySizeKey = attribute.Key("http.request.body.size") + + // HTTPRequestMethodKey is the attribute Key conforming to the + // "http.request.method" semantic conventions. It represents the HTTP request + // method. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GET", "POST", "HEAD" + // Note: HTTP request method value SHOULD be "known" to the instrumentation. + // By default, this convention defines "known" methods as the ones listed in + // [RFC9110] + // and the PATCH method defined in [RFC5789]. + // + // If the HTTP request method is not known to instrumentation, it MUST set the + // `http.request.method` attribute to `_OTHER`. + // + // If the HTTP instrumentation could end up converting valid HTTP request + // methods to `_OTHER`, then it MUST provide a way to override + // the list of known HTTP methods. If this override is done via environment + // variable, then the environment variable MUST be named + // OTEL_INSTRUMENTATION_HTTP_KNOWN_METHODS and support a comma-separated list of + // case-sensitive known HTTP methods + // (this list MUST be a full override of the default known method, it is not a + // list of known methods in addition to the defaults). + // + // HTTP method names are case-sensitive and `http.request.method` attribute + // value MUST match a known HTTP method name exactly. + // Instrumentations for specific web frameworks that consider HTTP methods to be + // case insensitive, SHOULD populate a canonical equivalent. + // Tracing instrumentations that do so, MUST also set + // `http.request.method_original` to the original value. + // + // [RFC9110]: https://www.rfc-editor.org/rfc/rfc9110.html#name-methods + // [RFC5789]: https://www.rfc-editor.org/rfc/rfc5789.html + HTTPRequestMethodKey = attribute.Key("http.request.method") + + // HTTPRequestMethodOriginalKey is the attribute Key conforming to the + // "http.request.method_original" semantic conventions. It represents the + // original HTTP method sent by the client in the request line. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "GeT", "ACL", "foo" + HTTPRequestMethodOriginalKey = attribute.Key("http.request.method_original") + + // HTTPRequestResendCountKey is the attribute Key conforming to the + // "http.request.resend_count" semantic conventions. It represents the ordinal + // number of request resending attempt (for any reason, including redirects). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Note: The resend count SHOULD be updated each time an HTTP request gets + // resent by the client, regardless of what was the cause of the resending (e.g. + // redirection, authorization failure, 503 Server Unavailable, network issues, + // or any other). + HTTPRequestResendCountKey = attribute.Key("http.request.resend_count") + + // HTTPRequestSizeKey is the attribute Key conforming to the "http.request.size" + // semantic conventions. It represents the total size of the request in bytes. + // This should be the total number of bytes sent over the wire, including the + // request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, and request + // body if any. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + HTTPRequestSizeKey = attribute.Key("http.request.size") + + // HTTPResponseBodySizeKey is the attribute Key conforming to the + // "http.response.body.size" semantic conventions. It represents the size of the + // response payload body in bytes. This is the number of bytes transferred + // excluding headers and is often, but not always, present as the + // [Content-Length] header. For requests using transport encoding, this should + // be the compressed size. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length + HTTPResponseBodySizeKey = attribute.Key("http.response.body.size") + + // HTTPResponseSizeKey is the attribute Key conforming to the + // "http.response.size" semantic conventions. It represents the total size of + // the response in bytes. This should be the total number of bytes sent over the + // wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3), + // headers, and response body and trailers if any. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + HTTPResponseSizeKey = attribute.Key("http.response.size") + + // HTTPResponseStatusCodeKey is the attribute Key conforming to the + // "http.response.status_code" semantic conventions. It represents the + // [HTTP response status code]. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 200 + // + // [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6 + HTTPResponseStatusCodeKey = attribute.Key("http.response.status_code") + + // HTTPRouteKey is the attribute Key conforming to the "http.route" semantic + // conventions. It represents the matched route, that is, the path template in + // the format used by the respective server framework. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "/users/:userID?", "{controller}/{action}/{id?}" + // Note: MUST NOT be populated when this is not supported by the HTTP server + // framework as the route attribute should have low-cardinality and the URI path + // can NOT substitute it. + // SHOULD include the [application root] if there is one. + // + // [application root]: /docs/http/http-spans.md#http-server-definitions + HTTPRouteKey = attribute.Key("http.route") +) + +// HTTPRequestBodySize returns an attribute KeyValue conforming to the +// "http.request.body.size" semantic conventions. It represents the size of the +// request payload body in bytes. This is the number of bytes transferred +// excluding headers and is often, but not always, present as the +// [Content-Length] header. For requests using transport encoding, this should be +// the compressed size. +// +// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length +func HTTPRequestBodySize(val int) attribute.KeyValue { + return HTTPRequestBodySizeKey.Int(val) +} + +// HTTPRequestMethodOriginal returns an attribute KeyValue conforming to the +// "http.request.method_original" semantic conventions. It represents the +// original HTTP method sent by the client in the request line. +func HTTPRequestMethodOriginal(val string) attribute.KeyValue { + return HTTPRequestMethodOriginalKey.String(val) +} + +// HTTPRequestResendCount returns an attribute KeyValue conforming to the +// "http.request.resend_count" semantic conventions. It represents the ordinal +// number of request resending attempt (for any reason, including redirects). +func HTTPRequestResendCount(val int) attribute.KeyValue { + return HTTPRequestResendCountKey.Int(val) +} + +// HTTPRequestSize returns an attribute KeyValue conforming to the +// "http.request.size" semantic conventions. It represents the total size of the +// request in bytes. This should be the total number of bytes sent over the wire, +// including the request line (HTTP/1.1), framing (HTTP/2 and HTTP/3), headers, +// and request body if any. +func HTTPRequestSize(val int) attribute.KeyValue { + return HTTPRequestSizeKey.Int(val) +} + +// HTTPResponseBodySize returns an attribute KeyValue conforming to the +// "http.response.body.size" semantic conventions. It represents the size of the +// response payload body in bytes. This is the number of bytes transferred +// excluding headers and is often, but not always, present as the +// [Content-Length] header. For requests using transport encoding, this should be +// the compressed size. +// +// [Content-Length]: https://www.rfc-editor.org/rfc/rfc9110.html#field.content-length +func HTTPResponseBodySize(val int) attribute.KeyValue { + return HTTPResponseBodySizeKey.Int(val) +} + +// HTTPResponseSize returns an attribute KeyValue conforming to the +// "http.response.size" semantic conventions. It represents the total size of the +// response in bytes. This should be the total number of bytes sent over the +// wire, including the status line (HTTP/1.1), framing (HTTP/2 and HTTP/3), +// headers, and response body and trailers if any. +func HTTPResponseSize(val int) attribute.KeyValue { + return HTTPResponseSizeKey.Int(val) +} + +// HTTPResponseStatusCode returns an attribute KeyValue conforming to the +// "http.response.status_code" semantic conventions. It represents the +// [HTTP response status code]. +// +// [HTTP response status code]: https://tools.ietf.org/html/rfc7231#section-6 +func HTTPResponseStatusCode(val int) attribute.KeyValue { + return HTTPResponseStatusCodeKey.Int(val) +} + +// HTTPRoute returns an attribute KeyValue conforming to the "http.route" +// semantic conventions. It represents the matched route, that is, the path +// template in the format used by the respective server framework. +func HTTPRoute(val string) attribute.KeyValue { + return HTTPRouteKey.String(val) +} + +// Enum values for http.connection.state +var ( + // active state. + // Stability: development + HTTPConnectionStateActive = HTTPConnectionStateKey.String("active") + // idle state. + // Stability: development + HTTPConnectionStateIdle = HTTPConnectionStateKey.String("idle") +) + +// Enum values for http.request.method +var ( + // CONNECT method. + // Stability: stable + HTTPRequestMethodConnect = HTTPRequestMethodKey.String("CONNECT") + // DELETE method. + // Stability: stable + HTTPRequestMethodDelete = HTTPRequestMethodKey.String("DELETE") + // GET method. + // Stability: stable + HTTPRequestMethodGet = HTTPRequestMethodKey.String("GET") + // HEAD method. + // Stability: stable + HTTPRequestMethodHead = HTTPRequestMethodKey.String("HEAD") + // OPTIONS method. + // Stability: stable + HTTPRequestMethodOptions = HTTPRequestMethodKey.String("OPTIONS") + // PATCH method. + // Stability: stable + HTTPRequestMethodPatch = HTTPRequestMethodKey.String("PATCH") + // POST method. + // Stability: stable + HTTPRequestMethodPost = HTTPRequestMethodKey.String("POST") + // PUT method. + // Stability: stable + HTTPRequestMethodPut = HTTPRequestMethodKey.String("PUT") + // TRACE method. + // Stability: stable + HTTPRequestMethodTrace = HTTPRequestMethodKey.String("TRACE") + // Any HTTP method that the instrumentation has no prior knowledge of. + // Stability: stable + HTTPRequestMethodOther = HTTPRequestMethodKey.String("_OTHER") +) + +// Namespace: hw +const ( + // HwIDKey is the attribute Key conforming to the "hw.id" semantic conventions. + // It represents an identifier for the hardware component, unique within the + // monitored host. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "win32battery_battery_testsysa33_1" + HwIDKey = attribute.Key("hw.id") + + // HwNameKey is the attribute Key conforming to the "hw.name" semantic + // conventions. It represents an easily-recognizable name for the hardware + // component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "eth0" + HwNameKey = attribute.Key("hw.name") + + // HwParentKey is the attribute Key conforming to the "hw.parent" semantic + // conventions. It represents the unique identifier of the parent component + // (typically the `hw.id` attribute of the enclosure, or disk controller). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "dellStorage_perc_0" + HwParentKey = attribute.Key("hw.parent") + + // HwStateKey is the attribute Key conforming to the "hw.state" semantic + // conventions. It represents the current state of the component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + HwStateKey = attribute.Key("hw.state") + + // HwTypeKey is the attribute Key conforming to the "hw.type" semantic + // conventions. It represents the type of the component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: Describes the category of the hardware component for which `hw.state` + // is being reported. For example, `hw.type=temperature` along with + // `hw.state=degraded` would indicate that the temperature of the hardware + // component has been reported as `degraded`. + HwTypeKey = attribute.Key("hw.type") +) + +// HwID returns an attribute KeyValue conforming to the "hw.id" semantic +// conventions. It represents an identifier for the hardware component, unique +// within the monitored host. +func HwID(val string) attribute.KeyValue { + return HwIDKey.String(val) +} + +// HwName returns an attribute KeyValue conforming to the "hw.name" semantic +// conventions. It represents an easily-recognizable name for the hardware +// component. +func HwName(val string) attribute.KeyValue { + return HwNameKey.String(val) +} + +// HwParent returns an attribute KeyValue conforming to the "hw.parent" semantic +// conventions. It represents the unique identifier of the parent component +// (typically the `hw.id` attribute of the enclosure, or disk controller). +func HwParent(val string) attribute.KeyValue { + return HwParentKey.String(val) +} + +// Enum values for hw.state +var ( + // Ok + // Stability: development + HwStateOk = HwStateKey.String("ok") + // Degraded + // Stability: development + HwStateDegraded = HwStateKey.String("degraded") + // Failed + // Stability: development + HwStateFailed = HwStateKey.String("failed") +) + +// Enum values for hw.type +var ( + // Battery + // Stability: development + HwTypeBattery = HwTypeKey.String("battery") + // CPU + // Stability: development + HwTypeCPU = HwTypeKey.String("cpu") + // Disk controller + // Stability: development + HwTypeDiskController = HwTypeKey.String("disk_controller") + // Enclosure + // Stability: development + HwTypeEnclosure = HwTypeKey.String("enclosure") + // Fan + // Stability: development + HwTypeFan = HwTypeKey.String("fan") + // GPU + // Stability: development + HwTypeGpu = HwTypeKey.String("gpu") + // Logical disk + // Stability: development + HwTypeLogicalDisk = HwTypeKey.String("logical_disk") + // Memory + // Stability: development + HwTypeMemory = HwTypeKey.String("memory") + // Network + // Stability: development + HwTypeNetwork = HwTypeKey.String("network") + // Physical disk + // Stability: development + HwTypePhysicalDisk = HwTypeKey.String("physical_disk") + // Power supply + // Stability: development + HwTypePowerSupply = HwTypeKey.String("power_supply") + // Tape drive + // Stability: development + HwTypeTapeDrive = HwTypeKey.String("tape_drive") + // Temperature + // Stability: development + HwTypeTemperature = HwTypeKey.String("temperature") + // Voltage + // Stability: development + HwTypeVoltage = HwTypeKey.String("voltage") +) + +// Namespace: ios +const ( + // IOSAppStateKey is the attribute Key conforming to the "ios.app.state" + // semantic conventions. It represents the this attribute represents the state + // of the application. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The iOS lifecycle states are defined in the + // [UIApplicationDelegate documentation], and from which the `OS terminology` + // column values are derived. + // + // [UIApplicationDelegate documentation]: https://developer.apple.com/documentation/uikit/uiapplicationdelegate + IOSAppStateKey = attribute.Key("ios.app.state") +) + +// Enum values for ios.app.state +var ( + // The app has become `active`. Associated with UIKit notification + // `applicationDidBecomeActive`. + // + // Stability: development + IOSAppStateActive = IOSAppStateKey.String("active") + // The app is now `inactive`. Associated with UIKit notification + // `applicationWillResignActive`. + // + // Stability: development + IOSAppStateInactive = IOSAppStateKey.String("inactive") + // The app is now in the background. This value is associated with UIKit + // notification `applicationDidEnterBackground`. + // + // Stability: development + IOSAppStateBackground = IOSAppStateKey.String("background") + // The app is now in the foreground. This value is associated with UIKit + // notification `applicationWillEnterForeground`. + // + // Stability: development + IOSAppStateForeground = IOSAppStateKey.String("foreground") + // The app is about to terminate. Associated with UIKit notification + // `applicationWillTerminate`. + // + // Stability: development + IOSAppStateTerminate = IOSAppStateKey.String("terminate") +) + +// Namespace: k8s +const ( + // K8SClusterNameKey is the attribute Key conforming to the "k8s.cluster.name" + // semantic conventions. It represents the name of the cluster. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-cluster" + K8SClusterNameKey = attribute.Key("k8s.cluster.name") + + // K8SClusterUIDKey is the attribute Key conforming to the "k8s.cluster.uid" + // semantic conventions. It represents a pseudo-ID for the cluster, set to the + // UID of the `kube-system` namespace. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "218fc5a9-a5f1-4b54-aa05-46717d0ab26d" + // Note: K8s doesn't have support for obtaining a cluster ID. If this is ever + // added, we will recommend collecting the `k8s.cluster.uid` through the + // official APIs. In the meantime, we are able to use the `uid` of the + // `kube-system` namespace as a proxy for cluster ID. Read on for the + // rationale. + // + // Every object created in a K8s cluster is assigned a distinct UID. The + // `kube-system` namespace is used by Kubernetes itself and will exist + // for the lifetime of the cluster. Using the `uid` of the `kube-system` + // namespace is a reasonable proxy for the K8s ClusterID as it will only + // change if the cluster is rebuilt. Furthermore, Kubernetes UIDs are + // UUIDs as standardized by + // [ISO/IEC 9834-8 and ITU-T X.667]. + // Which states: + // + // > If generated according to one of the mechanisms defined in Rec. + // > ITU-T X.667 | ISO/IEC 9834-8, a UUID is either guaranteed to be + // > different from all other UUIDs generated before 3603 A.D., or is + // > extremely likely to be different (depending on the mechanism chosen). + // + // Therefore, UIDs between clusters should be extremely unlikely to + // conflict. + // + // [ISO/IEC 9834-8 and ITU-T X.667]: https://www.itu.int/ITU-T/studygroups/com17/oid.html + K8SClusterUIDKey = attribute.Key("k8s.cluster.uid") + + // K8SContainerNameKey is the attribute Key conforming to the + // "k8s.container.name" semantic conventions. It represents the name of the + // Container from Pod specification, must be unique within a Pod. Container + // runtime usually uses different globally unique name (`container.name`). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "redis" + K8SContainerNameKey = attribute.Key("k8s.container.name") + + // K8SContainerRestartCountKey is the attribute Key conforming to the + // "k8s.container.restart_count" semantic conventions. It represents the number + // of times the container was restarted. This attribute can be used to identify + // a particular container (running or stopped) within a container spec. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + K8SContainerRestartCountKey = attribute.Key("k8s.container.restart_count") + + // K8SContainerStatusLastTerminatedReasonKey is the attribute Key conforming to + // the "k8s.container.status.last_terminated_reason" semantic conventions. It + // represents the last terminated reason of the Container. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Evicted", "Error" + K8SContainerStatusLastTerminatedReasonKey = attribute.Key("k8s.container.status.last_terminated_reason") + + // K8SCronJobNameKey is the attribute Key conforming to the "k8s.cronjob.name" + // semantic conventions. It represents the name of the CronJob. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SCronJobNameKey = attribute.Key("k8s.cronjob.name") + + // K8SCronJobUIDKey is the attribute Key conforming to the "k8s.cronjob.uid" + // semantic conventions. It represents the UID of the CronJob. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SCronJobUIDKey = attribute.Key("k8s.cronjob.uid") + + // K8SDaemonSetNameKey is the attribute Key conforming to the + // "k8s.daemonset.name" semantic conventions. It represents the name of the + // DaemonSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SDaemonSetNameKey = attribute.Key("k8s.daemonset.name") + + // K8SDaemonSetUIDKey is the attribute Key conforming to the "k8s.daemonset.uid" + // semantic conventions. It represents the UID of the DaemonSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SDaemonSetUIDKey = attribute.Key("k8s.daemonset.uid") + + // K8SDeploymentNameKey is the attribute Key conforming to the + // "k8s.deployment.name" semantic conventions. It represents the name of the + // Deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SDeploymentNameKey = attribute.Key("k8s.deployment.name") + + // K8SDeploymentUIDKey is the attribute Key conforming to the + // "k8s.deployment.uid" semantic conventions. It represents the UID of the + // Deployment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SDeploymentUIDKey = attribute.Key("k8s.deployment.uid") + + // K8SHPANameKey is the attribute Key conforming to the "k8s.hpa.name" semantic + // conventions. It represents the name of the horizontal pod autoscaler. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SHPANameKey = attribute.Key("k8s.hpa.name") + + // K8SHPAUIDKey is the attribute Key conforming to the "k8s.hpa.uid" semantic + // conventions. It represents the UID of the horizontal pod autoscaler. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SHPAUIDKey = attribute.Key("k8s.hpa.uid") + + // K8SJobNameKey is the attribute Key conforming to the "k8s.job.name" semantic + // conventions. It represents the name of the Job. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SJobNameKey = attribute.Key("k8s.job.name") + + // K8SJobUIDKey is the attribute Key conforming to the "k8s.job.uid" semantic + // conventions. It represents the UID of the Job. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SJobUIDKey = attribute.Key("k8s.job.uid") + + // K8SNamespaceNameKey is the attribute Key conforming to the + // "k8s.namespace.name" semantic conventions. It represents the name of the + // namespace that the pod is running in. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "default" + K8SNamespaceNameKey = attribute.Key("k8s.namespace.name") + + // K8SNamespacePhaseKey is the attribute Key conforming to the + // "k8s.namespace.phase" semantic conventions. It represents the phase of the + // K8s namespace. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "active", "terminating" + // Note: This attribute aligns with the `phase` field of the + // [K8s NamespaceStatus] + // + // [K8s NamespaceStatus]: https://kubernetes.io/docs/reference/generated/kubernetes-api/v1.30/#namespacestatus-v1-core + K8SNamespacePhaseKey = attribute.Key("k8s.namespace.phase") + + // K8SNodeNameKey is the attribute Key conforming to the "k8s.node.name" + // semantic conventions. It represents the name of the Node. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "node-1" + K8SNodeNameKey = attribute.Key("k8s.node.name") + + // K8SNodeUIDKey is the attribute Key conforming to the "k8s.node.uid" semantic + // conventions. It represents the UID of the Node. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1eb3a0c6-0477-4080-a9cb-0cb7db65c6a2" + K8SNodeUIDKey = attribute.Key("k8s.node.uid") + + // K8SPodNameKey is the attribute Key conforming to the "k8s.pod.name" semantic + // conventions. It represents the name of the Pod. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry-pod-autoconf" + K8SPodNameKey = attribute.Key("k8s.pod.name") + + // K8SPodUIDKey is the attribute Key conforming to the "k8s.pod.uid" semantic + // conventions. It represents the UID of the Pod. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SPodUIDKey = attribute.Key("k8s.pod.uid") + + // K8SReplicaSetNameKey is the attribute Key conforming to the + // "k8s.replicaset.name" semantic conventions. It represents the name of the + // ReplicaSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SReplicaSetNameKey = attribute.Key("k8s.replicaset.name") + + // K8SReplicaSetUIDKey is the attribute Key conforming to the + // "k8s.replicaset.uid" semantic conventions. It represents the UID of the + // ReplicaSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SReplicaSetUIDKey = attribute.Key("k8s.replicaset.uid") + + // K8SReplicationControllerNameKey is the attribute Key conforming to the + // "k8s.replicationcontroller.name" semantic conventions. It represents the name + // of the replication controller. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SReplicationControllerNameKey = attribute.Key("k8s.replicationcontroller.name") + + // K8SReplicationControllerUIDKey is the attribute Key conforming to the + // "k8s.replicationcontroller.uid" semantic conventions. It represents the UID + // of the replication controller. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SReplicationControllerUIDKey = attribute.Key("k8s.replicationcontroller.uid") + + // K8SResourceQuotaNameKey is the attribute Key conforming to the + // "k8s.resourcequota.name" semantic conventions. It represents the name of the + // resource quota. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SResourceQuotaNameKey = attribute.Key("k8s.resourcequota.name") + + // K8SResourceQuotaUIDKey is the attribute Key conforming to the + // "k8s.resourcequota.uid" semantic conventions. It represents the UID of the + // resource quota. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SResourceQuotaUIDKey = attribute.Key("k8s.resourcequota.uid") + + // K8SStatefulSetNameKey is the attribute Key conforming to the + // "k8s.statefulset.name" semantic conventions. It represents the name of the + // StatefulSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "opentelemetry" + K8SStatefulSetNameKey = attribute.Key("k8s.statefulset.name") + + // K8SStatefulSetUIDKey is the attribute Key conforming to the + // "k8s.statefulset.uid" semantic conventions. It represents the UID of the + // StatefulSet. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "275ecb36-5aa8-4c2a-9c47-d8bb681b9aff" + K8SStatefulSetUIDKey = attribute.Key("k8s.statefulset.uid") + + // K8SVolumeNameKey is the attribute Key conforming to the "k8s.volume.name" + // semantic conventions. It represents the name of the K8s volume. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "volume0" + K8SVolumeNameKey = attribute.Key("k8s.volume.name") + + // K8SVolumeTypeKey is the attribute Key conforming to the "k8s.volume.type" + // semantic conventions. It represents the type of the K8s volume. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "emptyDir", "persistentVolumeClaim" + K8SVolumeTypeKey = attribute.Key("k8s.volume.type") +) + +// K8SClusterName returns an attribute KeyValue conforming to the +// "k8s.cluster.name" semantic conventions. It represents the name of the +// cluster. +func K8SClusterName(val string) attribute.KeyValue { + return K8SClusterNameKey.String(val) +} + +// K8SClusterUID returns an attribute KeyValue conforming to the +// "k8s.cluster.uid" semantic conventions. It represents a pseudo-ID for the +// cluster, set to the UID of the `kube-system` namespace. +func K8SClusterUID(val string) attribute.KeyValue { + return K8SClusterUIDKey.String(val) +} + +// K8SContainerName returns an attribute KeyValue conforming to the +// "k8s.container.name" semantic conventions. It represents the name of the +// Container from Pod specification, must be unique within a Pod. Container +// runtime usually uses different globally unique name (`container.name`). +func K8SContainerName(val string) attribute.KeyValue { + return K8SContainerNameKey.String(val) +} + +// K8SContainerRestartCount returns an attribute KeyValue conforming to the +// "k8s.container.restart_count" semantic conventions. It represents the number +// of times the container was restarted. This attribute can be used to identify a +// particular container (running or stopped) within a container spec. +func K8SContainerRestartCount(val int) attribute.KeyValue { + return K8SContainerRestartCountKey.Int(val) +} + +// K8SContainerStatusLastTerminatedReason returns an attribute KeyValue +// conforming to the "k8s.container.status.last_terminated_reason" semantic +// conventions. It represents the last terminated reason of the Container. +func K8SContainerStatusLastTerminatedReason(val string) attribute.KeyValue { + return K8SContainerStatusLastTerminatedReasonKey.String(val) +} + +// K8SCronJobName returns an attribute KeyValue conforming to the +// "k8s.cronjob.name" semantic conventions. It represents the name of the +// CronJob. +func K8SCronJobName(val string) attribute.KeyValue { + return K8SCronJobNameKey.String(val) +} + +// K8SCronJobUID returns an attribute KeyValue conforming to the +// "k8s.cronjob.uid" semantic conventions. It represents the UID of the CronJob. +func K8SCronJobUID(val string) attribute.KeyValue { + return K8SCronJobUIDKey.String(val) +} + +// K8SDaemonSetName returns an attribute KeyValue conforming to the +// "k8s.daemonset.name" semantic conventions. It represents the name of the +// DaemonSet. +func K8SDaemonSetName(val string) attribute.KeyValue { + return K8SDaemonSetNameKey.String(val) +} + +// K8SDaemonSetUID returns an attribute KeyValue conforming to the +// "k8s.daemonset.uid" semantic conventions. It represents the UID of the +// DaemonSet. +func K8SDaemonSetUID(val string) attribute.KeyValue { + return K8SDaemonSetUIDKey.String(val) +} + +// K8SDeploymentName returns an attribute KeyValue conforming to the +// "k8s.deployment.name" semantic conventions. It represents the name of the +// Deployment. +func K8SDeploymentName(val string) attribute.KeyValue { + return K8SDeploymentNameKey.String(val) +} + +// K8SDeploymentUID returns an attribute KeyValue conforming to the +// "k8s.deployment.uid" semantic conventions. It represents the UID of the +// Deployment. +func K8SDeploymentUID(val string) attribute.KeyValue { + return K8SDeploymentUIDKey.String(val) +} + +// K8SHPAName returns an attribute KeyValue conforming to the "k8s.hpa.name" +// semantic conventions. It represents the name of the horizontal pod autoscaler. +func K8SHPAName(val string) attribute.KeyValue { + return K8SHPANameKey.String(val) +} + +// K8SHPAUID returns an attribute KeyValue conforming to the "k8s.hpa.uid" +// semantic conventions. It represents the UID of the horizontal pod autoscaler. +func K8SHPAUID(val string) attribute.KeyValue { + return K8SHPAUIDKey.String(val) +} + +// K8SJobName returns an attribute KeyValue conforming to the "k8s.job.name" +// semantic conventions. It represents the name of the Job. +func K8SJobName(val string) attribute.KeyValue { + return K8SJobNameKey.String(val) +} + +// K8SJobUID returns an attribute KeyValue conforming to the "k8s.job.uid" +// semantic conventions. It represents the UID of the Job. +func K8SJobUID(val string) attribute.KeyValue { + return K8SJobUIDKey.String(val) +} + +// K8SNamespaceName returns an attribute KeyValue conforming to the +// "k8s.namespace.name" semantic conventions. It represents the name of the +// namespace that the pod is running in. +func K8SNamespaceName(val string) attribute.KeyValue { + return K8SNamespaceNameKey.String(val) +} + +// K8SNodeName returns an attribute KeyValue conforming to the "k8s.node.name" +// semantic conventions. It represents the name of the Node. +func K8SNodeName(val string) attribute.KeyValue { + return K8SNodeNameKey.String(val) +} + +// K8SNodeUID returns an attribute KeyValue conforming to the "k8s.node.uid" +// semantic conventions. It represents the UID of the Node. +func K8SNodeUID(val string) attribute.KeyValue { + return K8SNodeUIDKey.String(val) +} + +// K8SPodName returns an attribute KeyValue conforming to the "k8s.pod.name" +// semantic conventions. It represents the name of the Pod. +func K8SPodName(val string) attribute.KeyValue { + return K8SPodNameKey.String(val) +} + +// K8SPodUID returns an attribute KeyValue conforming to the "k8s.pod.uid" +// semantic conventions. It represents the UID of the Pod. +func K8SPodUID(val string) attribute.KeyValue { + return K8SPodUIDKey.String(val) +} + +// K8SReplicaSetName returns an attribute KeyValue conforming to the +// "k8s.replicaset.name" semantic conventions. It represents the name of the +// ReplicaSet. +func K8SReplicaSetName(val string) attribute.KeyValue { + return K8SReplicaSetNameKey.String(val) +} + +// K8SReplicaSetUID returns an attribute KeyValue conforming to the +// "k8s.replicaset.uid" semantic conventions. It represents the UID of the +// ReplicaSet. +func K8SReplicaSetUID(val string) attribute.KeyValue { + return K8SReplicaSetUIDKey.String(val) +} + +// K8SReplicationControllerName returns an attribute KeyValue conforming to the +// "k8s.replicationcontroller.name" semantic conventions. It represents the name +// of the replication controller. +func K8SReplicationControllerName(val string) attribute.KeyValue { + return K8SReplicationControllerNameKey.String(val) +} + +// K8SReplicationControllerUID returns an attribute KeyValue conforming to the +// "k8s.replicationcontroller.uid" semantic conventions. It represents the UID of +// the replication controller. +func K8SReplicationControllerUID(val string) attribute.KeyValue { + return K8SReplicationControllerUIDKey.String(val) +} + +// K8SResourceQuotaName returns an attribute KeyValue conforming to the +// "k8s.resourcequota.name" semantic conventions. It represents the name of the +// resource quota. +func K8SResourceQuotaName(val string) attribute.KeyValue { + return K8SResourceQuotaNameKey.String(val) +} + +// K8SResourceQuotaUID returns an attribute KeyValue conforming to the +// "k8s.resourcequota.uid" semantic conventions. It represents the UID of the +// resource quota. +func K8SResourceQuotaUID(val string) attribute.KeyValue { + return K8SResourceQuotaUIDKey.String(val) +} + +// K8SStatefulSetName returns an attribute KeyValue conforming to the +// "k8s.statefulset.name" semantic conventions. It represents the name of the +// StatefulSet. +func K8SStatefulSetName(val string) attribute.KeyValue { + return K8SStatefulSetNameKey.String(val) +} + +// K8SStatefulSetUID returns an attribute KeyValue conforming to the +// "k8s.statefulset.uid" semantic conventions. It represents the UID of the +// StatefulSet. +func K8SStatefulSetUID(val string) attribute.KeyValue { + return K8SStatefulSetUIDKey.String(val) +} + +// K8SVolumeName returns an attribute KeyValue conforming to the +// "k8s.volume.name" semantic conventions. It represents the name of the K8s +// volume. +func K8SVolumeName(val string) attribute.KeyValue { + return K8SVolumeNameKey.String(val) +} + +// Enum values for k8s.namespace.phase +var ( + // Active namespace phase as described by [K8s API] + // Stability: development + // + // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase + K8SNamespacePhaseActive = K8SNamespacePhaseKey.String("active") + // Terminating namespace phase as described by [K8s API] + // Stability: development + // + // [K8s API]: https://pkg.go.dev/k8s.io/api@v0.31.3/core/v1#NamespacePhase + K8SNamespacePhaseTerminating = K8SNamespacePhaseKey.String("terminating") +) + +// Enum values for k8s.volume.type +var ( + // A [persistentVolumeClaim] volume + // Stability: development + // + // [persistentVolumeClaim]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#persistentvolumeclaim + K8SVolumeTypePersistentVolumeClaim = K8SVolumeTypeKey.String("persistentVolumeClaim") + // A [configMap] volume + // Stability: development + // + // [configMap]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#configmap + K8SVolumeTypeConfigMap = K8SVolumeTypeKey.String("configMap") + // A [downwardAPI] volume + // Stability: development + // + // [downwardAPI]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#downwardapi + K8SVolumeTypeDownwardAPI = K8SVolumeTypeKey.String("downwardAPI") + // An [emptyDir] volume + // Stability: development + // + // [emptyDir]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#emptydir + K8SVolumeTypeEmptyDir = K8SVolumeTypeKey.String("emptyDir") + // A [secret] volume + // Stability: development + // + // [secret]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#secret + K8SVolumeTypeSecret = K8SVolumeTypeKey.String("secret") + // A [local] volume + // Stability: development + // + // [local]: https://v1-30.docs.kubernetes.io/docs/concepts/storage/volumes/#local + K8SVolumeTypeLocal = K8SVolumeTypeKey.String("local") +) + +// Namespace: linux +const ( + // LinuxMemorySlabStateKey is the attribute Key conforming to the + // "linux.memory.slab.state" semantic conventions. It represents the Linux Slab + // memory state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "reclaimable", "unreclaimable" + LinuxMemorySlabStateKey = attribute.Key("linux.memory.slab.state") +) + +// Enum values for linux.memory.slab.state +var ( + // reclaimable + // Stability: development + LinuxMemorySlabStateReclaimable = LinuxMemorySlabStateKey.String("reclaimable") + // unreclaimable + // Stability: development + LinuxMemorySlabStateUnreclaimable = LinuxMemorySlabStateKey.String("unreclaimable") +) + +// Namespace: log +const ( + // LogFileNameKey is the attribute Key conforming to the "log.file.name" + // semantic conventions. It represents the basename of the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "audit.log" + LogFileNameKey = attribute.Key("log.file.name") + + // LogFileNameResolvedKey is the attribute Key conforming to the + // "log.file.name_resolved" semantic conventions. It represents the basename of + // the file, with symlinks resolved. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "uuid.log" + LogFileNameResolvedKey = attribute.Key("log.file.name_resolved") + + // LogFilePathKey is the attribute Key conforming to the "log.file.path" + // semantic conventions. It represents the full path to the file. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/var/log/mysql/audit.log" + LogFilePathKey = attribute.Key("log.file.path") + + // LogFilePathResolvedKey is the attribute Key conforming to the + // "log.file.path_resolved" semantic conventions. It represents the full path to + // the file, with symlinks resolved. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/var/lib/docker/uuid.log" + LogFilePathResolvedKey = attribute.Key("log.file.path_resolved") + + // LogIostreamKey is the attribute Key conforming to the "log.iostream" semantic + // conventions. It represents the stream associated with the log. See below for + // a list of well-known values. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + LogIostreamKey = attribute.Key("log.iostream") + + // LogRecordOriginalKey is the attribute Key conforming to the + // "log.record.original" semantic conventions. It represents the complete + // original Log Record. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "77 <86>1 2015-08-06T21:58:59.694Z 192.168.2.133 inactive - - - + // Something happened", "[INFO] 8/3/24 12:34:56 Something happened" + // Note: This value MAY be added when processing a Log Record which was + // originally transmitted as a string or equivalent data type AND the Body field + // of the Log Record does not contain the same value. (e.g. a syslog or a log + // record read from a file.) + LogRecordOriginalKey = attribute.Key("log.record.original") + + // LogRecordUIDKey is the attribute Key conforming to the "log.record.uid" + // semantic conventions. It represents a unique identifier for the Log Record. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "01ARZ3NDEKTSV4RRFFQ69G5FAV" + // Note: If an id is provided, other log records with the same id will be + // considered duplicates and can be removed safely. This means, that two + // distinguishable log records MUST have different values. + // The id MAY be an + // [Universally Unique Lexicographically Sortable Identifier (ULID)], but other + // identifiers (e.g. UUID) may be used as needed. + // + // [Universally Unique Lexicographically Sortable Identifier (ULID)]: https://github.com/ulid/spec + LogRecordUIDKey = attribute.Key("log.record.uid") +) + +// LogFileName returns an attribute KeyValue conforming to the "log.file.name" +// semantic conventions. It represents the basename of the file. +func LogFileName(val string) attribute.KeyValue { + return LogFileNameKey.String(val) +} + +// LogFileNameResolved returns an attribute KeyValue conforming to the +// "log.file.name_resolved" semantic conventions. It represents the basename of +// the file, with symlinks resolved. +func LogFileNameResolved(val string) attribute.KeyValue { + return LogFileNameResolvedKey.String(val) +} + +// LogFilePath returns an attribute KeyValue conforming to the "log.file.path" +// semantic conventions. It represents the full path to the file. +func LogFilePath(val string) attribute.KeyValue { + return LogFilePathKey.String(val) +} + +// LogFilePathResolved returns an attribute KeyValue conforming to the +// "log.file.path_resolved" semantic conventions. It represents the full path to +// the file, with symlinks resolved. +func LogFilePathResolved(val string) attribute.KeyValue { + return LogFilePathResolvedKey.String(val) +} + +// LogRecordOriginal returns an attribute KeyValue conforming to the +// "log.record.original" semantic conventions. It represents the complete +// original Log Record. +func LogRecordOriginal(val string) attribute.KeyValue { + return LogRecordOriginalKey.String(val) +} + +// LogRecordUID returns an attribute KeyValue conforming to the "log.record.uid" +// semantic conventions. It represents a unique identifier for the Log Record. +func LogRecordUID(val string) attribute.KeyValue { + return LogRecordUIDKey.String(val) +} + +// Enum values for log.iostream +var ( + // Logs from stdout stream + // Stability: development + LogIostreamStdout = LogIostreamKey.String("stdout") + // Events from stderr stream + // Stability: development + LogIostreamStderr = LogIostreamKey.String("stderr") +) + +// Namespace: messaging +const ( + // MessagingBatchMessageCountKey is the attribute Key conforming to the + // "messaging.batch.message_count" semantic conventions. It represents the + // number of messages sent, received, or processed in the scope of the batching + // operation. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 0, 1, 2 + // Note: Instrumentations SHOULD NOT set `messaging.batch.message_count` on + // spans that operate with a single message. When a messaging client library + // supports both batch and single-message API for the same operation, + // instrumentations SHOULD use `messaging.batch.message_count` for batching APIs + // and SHOULD NOT use it for single-message APIs. + MessagingBatchMessageCountKey = attribute.Key("messaging.batch.message_count") + + // MessagingClientIDKey is the attribute Key conforming to the + // "messaging.client.id" semantic conventions. It represents a unique identifier + // for the client that consumes or produces a message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "client-5", "myhost@8742@s8083jm" + MessagingClientIDKey = attribute.Key("messaging.client.id") + + // MessagingConsumerGroupNameKey is the attribute Key conforming to the + // "messaging.consumer.group.name" semantic conventions. It represents the name + // of the consumer group with which a consumer is associated. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-group", "indexer" + // Note: Semantic conventions for individual messaging systems SHOULD document + // whether `messaging.consumer.group.name` is applicable and what it means in + // the context of that system. + MessagingConsumerGroupNameKey = attribute.Key("messaging.consumer.group.name") + + // MessagingDestinationAnonymousKey is the attribute Key conforming to the + // "messaging.destination.anonymous" semantic conventions. It represents a + // boolean that is true if the message destination is anonymous (could be + // unnamed or have auto-generated name). + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingDestinationAnonymousKey = attribute.Key("messaging.destination.anonymous") + + // MessagingDestinationNameKey is the attribute Key conforming to the + // "messaging.destination.name" semantic conventions. It represents the message + // destination name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MyQueue", "MyTopic" + // Note: Destination name SHOULD uniquely identify a specific queue, topic or + // other entity within the broker. If + // the broker doesn't have such notion, the destination name SHOULD uniquely + // identify the broker. + MessagingDestinationNameKey = attribute.Key("messaging.destination.name") + + // MessagingDestinationPartitionIDKey is the attribute Key conforming to the + // "messaging.destination.partition.id" semantic conventions. It represents the + // identifier of the partition messages are sent to or received from, unique + // within the `messaging.destination.name`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + MessagingDestinationPartitionIDKey = attribute.Key("messaging.destination.partition.id") + + // MessagingDestinationSubscriptionNameKey is the attribute Key conforming to + // the "messaging.destination.subscription.name" semantic conventions. It + // represents the name of the destination subscription from which a message is + // consumed. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "subscription-a" + // Note: Semantic conventions for individual messaging systems SHOULD document + // whether `messaging.destination.subscription.name` is applicable and what it + // means in the context of that system. + MessagingDestinationSubscriptionNameKey = attribute.Key("messaging.destination.subscription.name") + + // MessagingDestinationTemplateKey is the attribute Key conforming to the + // "messaging.destination.template" semantic conventions. It represents the low + // cardinality representation of the messaging destination name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/customers/{customerId}" + // Note: Destination names could be constructed from templates. An example would + // be a destination name involving a user name or product id. Although the + // destination name in this case is of high cardinality, the underlying template + // is of low cardinality and can be effectively used for grouping and + // aggregation. + MessagingDestinationTemplateKey = attribute.Key("messaging.destination.template") + + // MessagingDestinationTemporaryKey is the attribute Key conforming to the + // "messaging.destination.temporary" semantic conventions. It represents a + // boolean that is true if the message destination is temporary and might not + // exist anymore after messages are processed. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingDestinationTemporaryKey = attribute.Key("messaging.destination.temporary") + + // MessagingEventHubsMessageEnqueuedTimeKey is the attribute Key conforming to + // the "messaging.eventhubs.message.enqueued_time" semantic conventions. It + // represents the UTC epoch seconds at which the message has been accepted and + // stored in the entity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingEventHubsMessageEnqueuedTimeKey = attribute.Key("messaging.eventhubs.message.enqueued_time") + + // MessagingGCPPubSubMessageAckDeadlineKey is the attribute Key conforming to + // the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It + // represents the ack deadline in seconds set for the modify ack deadline + // request. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingGCPPubSubMessageAckDeadlineKey = attribute.Key("messaging.gcp_pubsub.message.ack_deadline") + + // MessagingGCPPubSubMessageAckIDKey is the attribute Key conforming to the + // "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the + // ack id for a given message. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: ack_id + MessagingGCPPubSubMessageAckIDKey = attribute.Key("messaging.gcp_pubsub.message.ack_id") + + // MessagingGCPPubSubMessageDeliveryAttemptKey is the attribute Key conforming + // to the "messaging.gcp_pubsub.message.delivery_attempt" semantic conventions. + // It represents the delivery attempt for a given message. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingGCPPubSubMessageDeliveryAttemptKey = attribute.Key("messaging.gcp_pubsub.message.delivery_attempt") + + // MessagingGCPPubSubMessageOrderingKeyKey is the attribute Key conforming to + // the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It + // represents the ordering key for a given message. If the attribute is not + // present, the message does not have an ordering key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: ordering_key + MessagingGCPPubSubMessageOrderingKeyKey = attribute.Key("messaging.gcp_pubsub.message.ordering_key") + + // MessagingKafkaMessageKeyKey is the attribute Key conforming to the + // "messaging.kafka.message.key" semantic conventions. It represents the message + // keys in Kafka are used for grouping alike messages to ensure they're + // processed on the same partition. They differ from `messaging.message.id` in + // that they're not unique. If the key is `null`, the attribute MUST NOT be set. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myKey + // Note: If the key type is not string, it's string representation has to be + // supplied for the attribute. If the key has no unambiguous, canonical string + // form, don't include its value. + MessagingKafkaMessageKeyKey = attribute.Key("messaging.kafka.message.key") + + // MessagingKafkaMessageTombstoneKey is the attribute Key conforming to the + // "messaging.kafka.message.tombstone" semantic conventions. It represents a + // boolean that is true if the message is a tombstone. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingKafkaMessageTombstoneKey = attribute.Key("messaging.kafka.message.tombstone") + + // MessagingKafkaOffsetKey is the attribute Key conforming to the + // "messaging.kafka.offset" semantic conventions. It represents the offset of a + // record in the corresponding Kafka partition. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingKafkaOffsetKey = attribute.Key("messaging.kafka.offset") + + // MessagingMessageBodySizeKey is the attribute Key conforming to the + // "messaging.message.body.size" semantic conventions. It represents the size of + // the message body in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: This can refer to both the compressed or uncompressed body size. If + // both sizes are known, the uncompressed + // body size should be used. + MessagingMessageBodySizeKey = attribute.Key("messaging.message.body.size") + + // MessagingMessageConversationIDKey is the attribute Key conforming to the + // "messaging.message.conversation_id" semantic conventions. It represents the + // conversation ID identifying the conversation to which the message belongs, + // represented as a string. Sometimes called "Correlation ID". + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: MyConversationId + MessagingMessageConversationIDKey = attribute.Key("messaging.message.conversation_id") + + // MessagingMessageEnvelopeSizeKey is the attribute Key conforming to the + // "messaging.message.envelope.size" semantic conventions. It represents the + // size of the message body and metadata in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Note: This can refer to both the compressed or uncompressed size. If both + // sizes are known, the uncompressed + // size should be used. + MessagingMessageEnvelopeSizeKey = attribute.Key("messaging.message.envelope.size") + + // MessagingMessageIDKey is the attribute Key conforming to the + // "messaging.message.id" semantic conventions. It represents a value used by + // the messaging system as an identifier for the message, represented as a + // string. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 452a7c7c7c7048c2f887f61572b18fc2 + MessagingMessageIDKey = attribute.Key("messaging.message.id") + + // MessagingOperationNameKey is the attribute Key conforming to the + // "messaging.operation.name" semantic conventions. It represents the + // system-specific name of the messaging operation. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ack", "nack", "send" + MessagingOperationNameKey = attribute.Key("messaging.operation.name") + + // MessagingOperationTypeKey is the attribute Key conforming to the + // "messaging.operation.type" semantic conventions. It represents a string + // identifying the type of the messaging operation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: If a custom value is used, it MUST be of low cardinality. + MessagingOperationTypeKey = attribute.Key("messaging.operation.type") + + // MessagingRabbitMQDestinationRoutingKeyKey is the attribute Key conforming to + // the "messaging.rabbitmq.destination.routing_key" semantic conventions. It + // represents the rabbitMQ message routing key. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myKey + MessagingRabbitMQDestinationRoutingKeyKey = attribute.Key("messaging.rabbitmq.destination.routing_key") + + // MessagingRabbitMQMessageDeliveryTagKey is the attribute Key conforming to the + // "messaging.rabbitmq.message.delivery_tag" semantic conventions. It represents + // the rabbitMQ message delivery tag. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRabbitMQMessageDeliveryTagKey = attribute.Key("messaging.rabbitmq.message.delivery_tag") + + // MessagingRocketMQConsumptionModelKey is the attribute Key conforming to the + // "messaging.rocketmq.consumption_model" semantic conventions. It represents + // the model of message consumption. This only applies to consumer spans. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingRocketMQConsumptionModelKey = attribute.Key("messaging.rocketmq.consumption_model") + + // MessagingRocketMQMessageDelayTimeLevelKey is the attribute Key conforming to + // the "messaging.rocketmq.message.delay_time_level" semantic conventions. It + // represents the delay time level for delay message, which determines the + // message delay time. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRocketMQMessageDelayTimeLevelKey = attribute.Key("messaging.rocketmq.message.delay_time_level") + + // MessagingRocketMQMessageDeliveryTimestampKey is the attribute Key conforming + // to the "messaging.rocketmq.message.delivery_timestamp" semantic conventions. + // It represents the timestamp in milliseconds that the delay message is + // expected to be delivered to consumer. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingRocketMQMessageDeliveryTimestampKey = attribute.Key("messaging.rocketmq.message.delivery_timestamp") + + // MessagingRocketMQMessageGroupKey is the attribute Key conforming to the + // "messaging.rocketmq.message.group" semantic conventions. It represents the it + // is essential for FIFO message. Messages that belong to the same message group + // are always processed one by one within the same consumer group. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myMessageGroup + MessagingRocketMQMessageGroupKey = attribute.Key("messaging.rocketmq.message.group") + + // MessagingRocketMQMessageKeysKey is the attribute Key conforming to the + // "messaging.rocketmq.message.keys" semantic conventions. It represents the + // key(s) of message, another way to mark message besides message id. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "keyA", "keyB" + MessagingRocketMQMessageKeysKey = attribute.Key("messaging.rocketmq.message.keys") + + // MessagingRocketMQMessageTagKey is the attribute Key conforming to the + // "messaging.rocketmq.message.tag" semantic conventions. It represents the + // secondary classifier of message besides topic. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: tagA + MessagingRocketMQMessageTagKey = attribute.Key("messaging.rocketmq.message.tag") + + // MessagingRocketMQMessageTypeKey is the attribute Key conforming to the + // "messaging.rocketmq.message.type" semantic conventions. It represents the + // type of message. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + MessagingRocketMQMessageTypeKey = attribute.Key("messaging.rocketmq.message.type") + + // MessagingRocketMQNamespaceKey is the attribute Key conforming to the + // "messaging.rocketmq.namespace" semantic conventions. It represents the + // namespace of RocketMQ resources, resources in different namespaces are + // individual. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myNamespace + MessagingRocketMQNamespaceKey = attribute.Key("messaging.rocketmq.namespace") + + // MessagingServiceBusDispositionStatusKey is the attribute Key conforming to + // the "messaging.servicebus.disposition_status" semantic conventions. It + // represents the describes the [settlement type]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [settlement type]: https://learn.microsoft.com/azure/service-bus-messaging/message-transfers-locks-settlement#peeklock + MessagingServiceBusDispositionStatusKey = attribute.Key("messaging.servicebus.disposition_status") + + // MessagingServiceBusMessageDeliveryCountKey is the attribute Key conforming to + // the "messaging.servicebus.message.delivery_count" semantic conventions. It + // represents the number of deliveries that have been attempted for this + // message. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingServiceBusMessageDeliveryCountKey = attribute.Key("messaging.servicebus.message.delivery_count") + + // MessagingServiceBusMessageEnqueuedTimeKey is the attribute Key conforming to + // the "messaging.servicebus.message.enqueued_time" semantic conventions. It + // represents the UTC epoch seconds at which the message has been accepted and + // stored in the entity. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + MessagingServiceBusMessageEnqueuedTimeKey = attribute.Key("messaging.servicebus.message.enqueued_time") + + // MessagingSystemKey is the attribute Key conforming to the "messaging.system" + // semantic conventions. It represents the messaging system as identified by the + // client instrumentation. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The actual messaging system may differ from the one known by the + // client. For example, when using Kafka client libraries to communicate with + // Azure Event Hubs, the `messaging.system` is set to `kafka` based on the + // instrumentation's best knowledge. + MessagingSystemKey = attribute.Key("messaging.system") +) + +// MessagingBatchMessageCount returns an attribute KeyValue conforming to the +// "messaging.batch.message_count" semantic conventions. It represents the number +// of messages sent, received, or processed in the scope of the batching +// operation. +func MessagingBatchMessageCount(val int) attribute.KeyValue { + return MessagingBatchMessageCountKey.Int(val) +} + +// MessagingClientID returns an attribute KeyValue conforming to the +// "messaging.client.id" semantic conventions. It represents a unique identifier +// for the client that consumes or produces a message. +func MessagingClientID(val string) attribute.KeyValue { + return MessagingClientIDKey.String(val) +} + +// MessagingConsumerGroupName returns an attribute KeyValue conforming to the +// "messaging.consumer.group.name" semantic conventions. It represents the name +// of the consumer group with which a consumer is associated. +func MessagingConsumerGroupName(val string) attribute.KeyValue { + return MessagingConsumerGroupNameKey.String(val) +} + +// MessagingDestinationAnonymous returns an attribute KeyValue conforming to the +// "messaging.destination.anonymous" semantic conventions. It represents a +// boolean that is true if the message destination is anonymous (could be unnamed +// or have auto-generated name). +func MessagingDestinationAnonymous(val bool) attribute.KeyValue { + return MessagingDestinationAnonymousKey.Bool(val) +} + +// MessagingDestinationName returns an attribute KeyValue conforming to the +// "messaging.destination.name" semantic conventions. It represents the message +// destination name. +func MessagingDestinationName(val string) attribute.KeyValue { + return MessagingDestinationNameKey.String(val) +} + +// MessagingDestinationPartitionID returns an attribute KeyValue conforming to +// the "messaging.destination.partition.id" semantic conventions. It represents +// the identifier of the partition messages are sent to or received from, unique +// within the `messaging.destination.name`. +func MessagingDestinationPartitionID(val string) attribute.KeyValue { + return MessagingDestinationPartitionIDKey.String(val) +} + +// MessagingDestinationSubscriptionName returns an attribute KeyValue conforming +// to the "messaging.destination.subscription.name" semantic conventions. It +// represents the name of the destination subscription from which a message is +// consumed. +func MessagingDestinationSubscriptionName(val string) attribute.KeyValue { + return MessagingDestinationSubscriptionNameKey.String(val) +} + +// MessagingDestinationTemplate returns an attribute KeyValue conforming to the +// "messaging.destination.template" semantic conventions. It represents the low +// cardinality representation of the messaging destination name. +func MessagingDestinationTemplate(val string) attribute.KeyValue { + return MessagingDestinationTemplateKey.String(val) +} + +// MessagingDestinationTemporary returns an attribute KeyValue conforming to the +// "messaging.destination.temporary" semantic conventions. It represents a +// boolean that is true if the message destination is temporary and might not +// exist anymore after messages are processed. +func MessagingDestinationTemporary(val bool) attribute.KeyValue { + return MessagingDestinationTemporaryKey.Bool(val) +} + +// MessagingEventHubsMessageEnqueuedTime returns an attribute KeyValue conforming +// to the "messaging.eventhubs.message.enqueued_time" semantic conventions. It +// represents the UTC epoch seconds at which the message has been accepted and +// stored in the entity. +func MessagingEventHubsMessageEnqueuedTime(val int) attribute.KeyValue { + return MessagingEventHubsMessageEnqueuedTimeKey.Int(val) +} + +// MessagingGCPPubSubMessageAckDeadline returns an attribute KeyValue conforming +// to the "messaging.gcp_pubsub.message.ack_deadline" semantic conventions. It +// represents the ack deadline in seconds set for the modify ack deadline +// request. +func MessagingGCPPubSubMessageAckDeadline(val int) attribute.KeyValue { + return MessagingGCPPubSubMessageAckDeadlineKey.Int(val) +} + +// MessagingGCPPubSubMessageAckID returns an attribute KeyValue conforming to the +// "messaging.gcp_pubsub.message.ack_id" semantic conventions. It represents the +// ack id for a given message. +func MessagingGCPPubSubMessageAckID(val string) attribute.KeyValue { + return MessagingGCPPubSubMessageAckIDKey.String(val) +} + +// MessagingGCPPubSubMessageDeliveryAttempt returns an attribute KeyValue +// conforming to the "messaging.gcp_pubsub.message.delivery_attempt" semantic +// conventions. It represents the delivery attempt for a given message. +func MessagingGCPPubSubMessageDeliveryAttempt(val int) attribute.KeyValue { + return MessagingGCPPubSubMessageDeliveryAttemptKey.Int(val) +} + +// MessagingGCPPubSubMessageOrderingKey returns an attribute KeyValue conforming +// to the "messaging.gcp_pubsub.message.ordering_key" semantic conventions. It +// represents the ordering key for a given message. If the attribute is not +// present, the message does not have an ordering key. +func MessagingGCPPubSubMessageOrderingKey(val string) attribute.KeyValue { + return MessagingGCPPubSubMessageOrderingKeyKey.String(val) +} + +// MessagingKafkaMessageKey returns an attribute KeyValue conforming to the +// "messaging.kafka.message.key" semantic conventions. It represents the message +// keys in Kafka are used for grouping alike messages to ensure they're processed +// on the same partition. They differ from `messaging.message.id` in that they're +// not unique. If the key is `null`, the attribute MUST NOT be set. +func MessagingKafkaMessageKey(val string) attribute.KeyValue { + return MessagingKafkaMessageKeyKey.String(val) +} + +// MessagingKafkaMessageTombstone returns an attribute KeyValue conforming to the +// "messaging.kafka.message.tombstone" semantic conventions. It represents a +// boolean that is true if the message is a tombstone. +func MessagingKafkaMessageTombstone(val bool) attribute.KeyValue { + return MessagingKafkaMessageTombstoneKey.Bool(val) +} + +// MessagingKafkaOffset returns an attribute KeyValue conforming to the +// "messaging.kafka.offset" semantic conventions. It represents the offset of a +// record in the corresponding Kafka partition. +func MessagingKafkaOffset(val int) attribute.KeyValue { + return MessagingKafkaOffsetKey.Int(val) +} + +// MessagingMessageBodySize returns an attribute KeyValue conforming to the +// "messaging.message.body.size" semantic conventions. It represents the size of +// the message body in bytes. +func MessagingMessageBodySize(val int) attribute.KeyValue { + return MessagingMessageBodySizeKey.Int(val) +} + +// MessagingMessageConversationID returns an attribute KeyValue conforming to the +// "messaging.message.conversation_id" semantic conventions. It represents the +// conversation ID identifying the conversation to which the message belongs, +// represented as a string. Sometimes called "Correlation ID". +func MessagingMessageConversationID(val string) attribute.KeyValue { + return MessagingMessageConversationIDKey.String(val) +} + +// MessagingMessageEnvelopeSize returns an attribute KeyValue conforming to the +// "messaging.message.envelope.size" semantic conventions. It represents the size +// of the message body and metadata in bytes. +func MessagingMessageEnvelopeSize(val int) attribute.KeyValue { + return MessagingMessageEnvelopeSizeKey.Int(val) +} + +// MessagingMessageID returns an attribute KeyValue conforming to the +// "messaging.message.id" semantic conventions. It represents a value used by the +// messaging system as an identifier for the message, represented as a string. +func MessagingMessageID(val string) attribute.KeyValue { + return MessagingMessageIDKey.String(val) +} + +// MessagingOperationName returns an attribute KeyValue conforming to the +// "messaging.operation.name" semantic conventions. It represents the +// system-specific name of the messaging operation. +func MessagingOperationName(val string) attribute.KeyValue { + return MessagingOperationNameKey.String(val) +} + +// MessagingRabbitMQDestinationRoutingKey returns an attribute KeyValue +// conforming to the "messaging.rabbitmq.destination.routing_key" semantic +// conventions. It represents the rabbitMQ message routing key. +func MessagingRabbitMQDestinationRoutingKey(val string) attribute.KeyValue { + return MessagingRabbitMQDestinationRoutingKeyKey.String(val) +} + +// MessagingRabbitMQMessageDeliveryTag returns an attribute KeyValue conforming +// to the "messaging.rabbitmq.message.delivery_tag" semantic conventions. It +// represents the rabbitMQ message delivery tag. +func MessagingRabbitMQMessageDeliveryTag(val int) attribute.KeyValue { + return MessagingRabbitMQMessageDeliveryTagKey.Int(val) +} + +// MessagingRocketMQMessageDelayTimeLevel returns an attribute KeyValue +// conforming to the "messaging.rocketmq.message.delay_time_level" semantic +// conventions. It represents the delay time level for delay message, which +// determines the message delay time. +func MessagingRocketMQMessageDelayTimeLevel(val int) attribute.KeyValue { + return MessagingRocketMQMessageDelayTimeLevelKey.Int(val) +} + +// MessagingRocketMQMessageDeliveryTimestamp returns an attribute KeyValue +// conforming to the "messaging.rocketmq.message.delivery_timestamp" semantic +// conventions. It represents the timestamp in milliseconds that the delay +// message is expected to be delivered to consumer. +func MessagingRocketMQMessageDeliveryTimestamp(val int) attribute.KeyValue { + return MessagingRocketMQMessageDeliveryTimestampKey.Int(val) +} + +// MessagingRocketMQMessageGroup returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.group" semantic conventions. It represents the it +// is essential for FIFO message. Messages that belong to the same message group +// are always processed one by one within the same consumer group. +func MessagingRocketMQMessageGroup(val string) attribute.KeyValue { + return MessagingRocketMQMessageGroupKey.String(val) +} + +// MessagingRocketMQMessageKeys returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.keys" semantic conventions. It represents the +// key(s) of message, another way to mark message besides message id. +func MessagingRocketMQMessageKeys(val ...string) attribute.KeyValue { + return MessagingRocketMQMessageKeysKey.StringSlice(val) +} + +// MessagingRocketMQMessageTag returns an attribute KeyValue conforming to the +// "messaging.rocketmq.message.tag" semantic conventions. It represents the +// secondary classifier of message besides topic. +func MessagingRocketMQMessageTag(val string) attribute.KeyValue { + return MessagingRocketMQMessageTagKey.String(val) +} + +// MessagingRocketMQNamespace returns an attribute KeyValue conforming to the +// "messaging.rocketmq.namespace" semantic conventions. It represents the +// namespace of RocketMQ resources, resources in different namespaces are +// individual. +func MessagingRocketMQNamespace(val string) attribute.KeyValue { + return MessagingRocketMQNamespaceKey.String(val) +} + +// MessagingServiceBusMessageDeliveryCount returns an attribute KeyValue +// conforming to the "messaging.servicebus.message.delivery_count" semantic +// conventions. It represents the number of deliveries that have been attempted +// for this message. +func MessagingServiceBusMessageDeliveryCount(val int) attribute.KeyValue { + return MessagingServiceBusMessageDeliveryCountKey.Int(val) +} + +// MessagingServiceBusMessageEnqueuedTime returns an attribute KeyValue +// conforming to the "messaging.servicebus.message.enqueued_time" semantic +// conventions. It represents the UTC epoch seconds at which the message has been +// accepted and stored in the entity. +func MessagingServiceBusMessageEnqueuedTime(val int) attribute.KeyValue { + return MessagingServiceBusMessageEnqueuedTimeKey.Int(val) +} + +// Enum values for messaging.operation.type +var ( + // A message is created. "Create" spans always refer to a single message and are + // used to provide a unique creation context for messages in batch sending + // scenarios. + // + // Stability: development + MessagingOperationTypeCreate = MessagingOperationTypeKey.String("create") + // One or more messages are provided for sending to an intermediary. If a single + // message is sent, the context of the "Send" span can be used as the creation + // context and no "Create" span needs to be created. + // + // Stability: development + MessagingOperationTypeSend = MessagingOperationTypeKey.String("send") + // One or more messages are requested by a consumer. This operation refers to + // pull-based scenarios, where consumers explicitly call methods of messaging + // SDKs to receive messages. + // + // Stability: development + MessagingOperationTypeReceive = MessagingOperationTypeKey.String("receive") + // One or more messages are processed by a consumer. + // + // Stability: development + MessagingOperationTypeProcess = MessagingOperationTypeKey.String("process") + // One or more messages are settled. + // + // Stability: development + MessagingOperationTypeSettle = MessagingOperationTypeKey.String("settle") + // Deprecated: Replaced by `process`. + MessagingOperationTypeDeliver = MessagingOperationTypeKey.String("deliver") + // Deprecated: Replaced by `send`. + MessagingOperationTypePublish = MessagingOperationTypeKey.String("publish") +) + +// Enum values for messaging.rocketmq.consumption_model +var ( + // Clustering consumption model + // Stability: development + MessagingRocketMQConsumptionModelClustering = MessagingRocketMQConsumptionModelKey.String("clustering") + // Broadcasting consumption model + // Stability: development + MessagingRocketMQConsumptionModelBroadcasting = MessagingRocketMQConsumptionModelKey.String("broadcasting") +) + +// Enum values for messaging.rocketmq.message.type +var ( + // Normal message + // Stability: development + MessagingRocketMQMessageTypeNormal = MessagingRocketMQMessageTypeKey.String("normal") + // FIFO message + // Stability: development + MessagingRocketMQMessageTypeFifo = MessagingRocketMQMessageTypeKey.String("fifo") + // Delay message + // Stability: development + MessagingRocketMQMessageTypeDelay = MessagingRocketMQMessageTypeKey.String("delay") + // Transaction message + // Stability: development + MessagingRocketMQMessageTypeTransaction = MessagingRocketMQMessageTypeKey.String("transaction") +) + +// Enum values for messaging.servicebus.disposition_status +var ( + // Message is completed + // Stability: development + MessagingServiceBusDispositionStatusComplete = MessagingServiceBusDispositionStatusKey.String("complete") + // Message is abandoned + // Stability: development + MessagingServiceBusDispositionStatusAbandon = MessagingServiceBusDispositionStatusKey.String("abandon") + // Message is sent to dead letter queue + // Stability: development + MessagingServiceBusDispositionStatusDeadLetter = MessagingServiceBusDispositionStatusKey.String("dead_letter") + // Message is deferred + // Stability: development + MessagingServiceBusDispositionStatusDefer = MessagingServiceBusDispositionStatusKey.String("defer") +) + +// Enum values for messaging.system +var ( + // Apache ActiveMQ + // Stability: development + MessagingSystemActiveMQ = MessagingSystemKey.String("activemq") + // Amazon Simple Queue Service (SQS) + // Stability: development + MessagingSystemAWSSQS = MessagingSystemKey.String("aws_sqs") + // Azure Event Grid + // Stability: development + MessagingSystemEventGrid = MessagingSystemKey.String("eventgrid") + // Azure Event Hubs + // Stability: development + MessagingSystemEventHubs = MessagingSystemKey.String("eventhubs") + // Azure Service Bus + // Stability: development + MessagingSystemServiceBus = MessagingSystemKey.String("servicebus") + // Google Cloud Pub/Sub + // Stability: development + MessagingSystemGCPPubSub = MessagingSystemKey.String("gcp_pubsub") + // Java Message Service + // Stability: development + MessagingSystemJMS = MessagingSystemKey.String("jms") + // Apache Kafka + // Stability: development + MessagingSystemKafka = MessagingSystemKey.String("kafka") + // RabbitMQ + // Stability: development + MessagingSystemRabbitMQ = MessagingSystemKey.String("rabbitmq") + // Apache RocketMQ + // Stability: development + MessagingSystemRocketMQ = MessagingSystemKey.String("rocketmq") + // Apache Pulsar + // Stability: development + MessagingSystemPulsar = MessagingSystemKey.String("pulsar") +) + +// Namespace: network +const ( + // NetworkCarrierICCKey is the attribute Key conforming to the + // "network.carrier.icc" semantic conventions. It represents the ISO 3166-1 + // alpha-2 2-character country code associated with the mobile carrier network. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: DE + NetworkCarrierICCKey = attribute.Key("network.carrier.icc") + + // NetworkCarrierMCCKey is the attribute Key conforming to the + // "network.carrier.mcc" semantic conventions. It represents the mobile carrier + // country code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 310 + NetworkCarrierMCCKey = attribute.Key("network.carrier.mcc") + + // NetworkCarrierMNCKey is the attribute Key conforming to the + // "network.carrier.mnc" semantic conventions. It represents the mobile carrier + // network code. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 001 + NetworkCarrierMNCKey = attribute.Key("network.carrier.mnc") + + // NetworkCarrierNameKey is the attribute Key conforming to the + // "network.carrier.name" semantic conventions. It represents the name of the + // mobile carrier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: sprint + NetworkCarrierNameKey = attribute.Key("network.carrier.name") + + // NetworkConnectionStateKey is the attribute Key conforming to the + // "network.connection.state" semantic conventions. It represents the state of + // network connection. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "close_wait" + // Note: Connection states are defined as part of the [rfc9293] + // + // [rfc9293]: https://datatracker.ietf.org/doc/html/rfc9293#section-3.3.2 + NetworkConnectionStateKey = attribute.Key("network.connection.state") + + // NetworkConnectionSubtypeKey is the attribute Key conforming to the + // "network.connection.subtype" semantic conventions. It represents the this + // describes more details regarding the connection.type. It may be the type of + // cell technology connection, but it could be used for describing details about + // a wifi connection. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: LTE + NetworkConnectionSubtypeKey = attribute.Key("network.connection.subtype") + + // NetworkConnectionTypeKey is the attribute Key conforming to the + // "network.connection.type" semantic conventions. It represents the internet + // connection type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: wifi + NetworkConnectionTypeKey = attribute.Key("network.connection.type") + + // NetworkInterfaceNameKey is the attribute Key conforming to the + // "network.interface.name" semantic conventions. It represents the network + // interface name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "lo", "eth0" + NetworkInterfaceNameKey = attribute.Key("network.interface.name") + + // NetworkIODirectionKey is the attribute Key conforming to the + // "network.io.direction" semantic conventions. It represents the network IO + // operation direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "transmit" + NetworkIODirectionKey = attribute.Key("network.io.direction") + + // NetworkLocalAddressKey is the attribute Key conforming to the + // "network.local.address" semantic conventions. It represents the local address + // of the network connection - IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "10.1.2.80", "/tmp/my.sock" + NetworkLocalAddressKey = attribute.Key("network.local.address") + + // NetworkLocalPortKey is the attribute Key conforming to the + // "network.local.port" semantic conventions. It represents the local port + // number of the network connection. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + NetworkLocalPortKey = attribute.Key("network.local.port") + + // NetworkPeerAddressKey is the attribute Key conforming to the + // "network.peer.address" semantic conventions. It represents the peer address + // of the network connection - IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "10.1.2.80", "/tmp/my.sock" + NetworkPeerAddressKey = attribute.Key("network.peer.address") + + // NetworkPeerPortKey is the attribute Key conforming to the "network.peer.port" + // semantic conventions. It represents the peer port number of the network + // connection. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 65123 + NetworkPeerPortKey = attribute.Key("network.peer.port") + + // NetworkProtocolNameKey is the attribute Key conforming to the + // "network.protocol.name" semantic conventions. It represents the + // [OSI application layer] or non-OSI equivalent. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "amqp", "http", "mqtt" + // Note: The value SHOULD be normalized to lowercase. + // + // [OSI application layer]: https://wikipedia.org/wiki/Application_layer + NetworkProtocolNameKey = attribute.Key("network.protocol.name") + + // NetworkProtocolVersionKey is the attribute Key conforming to the + // "network.protocol.version" semantic conventions. It represents the actual + // version of the protocol used for network communication. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.1", "2" + // Note: If protocol version is subject to negotiation (for example using [ALPN] + // ), this attribute SHOULD be set to the negotiated version. If the actual + // protocol version is not known, this attribute SHOULD NOT be set. + // + // [ALPN]: https://www.rfc-editor.org/rfc/rfc7301.html + NetworkProtocolVersionKey = attribute.Key("network.protocol.version") + + // NetworkTransportKey is the attribute Key conforming to the + // "network.transport" semantic conventions. It represents the + // [OSI transport layer] or [inter-process communication method]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "tcp", "udp" + // Note: The value SHOULD be normalized to lowercase. + // + // Consider always setting the transport when setting a port number, since + // a port number is ambiguous without knowing the transport. For example + // different processes could be listening on TCP port 12345 and UDP port 12345. + // + // [OSI transport layer]: https://wikipedia.org/wiki/Transport_layer + // [inter-process communication method]: https://wikipedia.org/wiki/Inter-process_communication + NetworkTransportKey = attribute.Key("network.transport") + + // NetworkTypeKey is the attribute Key conforming to the "network.type" semantic + // conventions. It represents the [OSI network layer] or non-OSI equivalent. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "ipv4", "ipv6" + // Note: The value SHOULD be normalized to lowercase. + // + // [OSI network layer]: https://wikipedia.org/wiki/Network_layer + NetworkTypeKey = attribute.Key("network.type") +) + +// NetworkCarrierICC returns an attribute KeyValue conforming to the +// "network.carrier.icc" semantic conventions. It represents the ISO 3166-1 +// alpha-2 2-character country code associated with the mobile carrier network. +func NetworkCarrierICC(val string) attribute.KeyValue { + return NetworkCarrierICCKey.String(val) +} + +// NetworkCarrierMCC returns an attribute KeyValue conforming to the +// "network.carrier.mcc" semantic conventions. It represents the mobile carrier +// country code. +func NetworkCarrierMCC(val string) attribute.KeyValue { + return NetworkCarrierMCCKey.String(val) +} + +// NetworkCarrierMNC returns an attribute KeyValue conforming to the +// "network.carrier.mnc" semantic conventions. It represents the mobile carrier +// network code. +func NetworkCarrierMNC(val string) attribute.KeyValue { + return NetworkCarrierMNCKey.String(val) +} + +// NetworkCarrierName returns an attribute KeyValue conforming to the +// "network.carrier.name" semantic conventions. It represents the name of the +// mobile carrier. +func NetworkCarrierName(val string) attribute.KeyValue { + return NetworkCarrierNameKey.String(val) +} + +// NetworkInterfaceName returns an attribute KeyValue conforming to the +// "network.interface.name" semantic conventions. It represents the network +// interface name. +func NetworkInterfaceName(val string) attribute.KeyValue { + return NetworkInterfaceNameKey.String(val) +} + +// NetworkLocalAddress returns an attribute KeyValue conforming to the +// "network.local.address" semantic conventions. It represents the local address +// of the network connection - IP address or Unix domain socket name. +func NetworkLocalAddress(val string) attribute.KeyValue { + return NetworkLocalAddressKey.String(val) +} + +// NetworkLocalPort returns an attribute KeyValue conforming to the +// "network.local.port" semantic conventions. It represents the local port number +// of the network connection. +func NetworkLocalPort(val int) attribute.KeyValue { + return NetworkLocalPortKey.Int(val) +} + +// NetworkPeerAddress returns an attribute KeyValue conforming to the +// "network.peer.address" semantic conventions. It represents the peer address of +// the network connection - IP address or Unix domain socket name. +func NetworkPeerAddress(val string) attribute.KeyValue { + return NetworkPeerAddressKey.String(val) +} + +// NetworkPeerPort returns an attribute KeyValue conforming to the +// "network.peer.port" semantic conventions. It represents the peer port number +// of the network connection. +func NetworkPeerPort(val int) attribute.KeyValue { + return NetworkPeerPortKey.Int(val) +} + +// NetworkProtocolName returns an attribute KeyValue conforming to the +// "network.protocol.name" semantic conventions. It represents the +// [OSI application layer] or non-OSI equivalent. +// +// [OSI application layer]: https://wikipedia.org/wiki/Application_layer +func NetworkProtocolName(val string) attribute.KeyValue { + return NetworkProtocolNameKey.String(val) +} + +// NetworkProtocolVersion returns an attribute KeyValue conforming to the +// "network.protocol.version" semantic conventions. It represents the actual +// version of the protocol used for network communication. +func NetworkProtocolVersion(val string) attribute.KeyValue { + return NetworkProtocolVersionKey.String(val) +} + +// Enum values for network.connection.state +var ( + // closed + // Stability: development + NetworkConnectionStateClosed = NetworkConnectionStateKey.String("closed") + // close_wait + // Stability: development + NetworkConnectionStateCloseWait = NetworkConnectionStateKey.String("close_wait") + // closing + // Stability: development + NetworkConnectionStateClosing = NetworkConnectionStateKey.String("closing") + // established + // Stability: development + NetworkConnectionStateEstablished = NetworkConnectionStateKey.String("established") + // fin_wait_1 + // Stability: development + NetworkConnectionStateFinWait1 = NetworkConnectionStateKey.String("fin_wait_1") + // fin_wait_2 + // Stability: development + NetworkConnectionStateFinWait2 = NetworkConnectionStateKey.String("fin_wait_2") + // last_ack + // Stability: development + NetworkConnectionStateLastAck = NetworkConnectionStateKey.String("last_ack") + // listen + // Stability: development + NetworkConnectionStateListen = NetworkConnectionStateKey.String("listen") + // syn_received + // Stability: development + NetworkConnectionStateSynReceived = NetworkConnectionStateKey.String("syn_received") + // syn_sent + // Stability: development + NetworkConnectionStateSynSent = NetworkConnectionStateKey.String("syn_sent") + // time_wait + // Stability: development + NetworkConnectionStateTimeWait = NetworkConnectionStateKey.String("time_wait") +) + +// Enum values for network.connection.subtype +var ( + // GPRS + // Stability: development + NetworkConnectionSubtypeGprs = NetworkConnectionSubtypeKey.String("gprs") + // EDGE + // Stability: development + NetworkConnectionSubtypeEdge = NetworkConnectionSubtypeKey.String("edge") + // UMTS + // Stability: development + NetworkConnectionSubtypeUmts = NetworkConnectionSubtypeKey.String("umts") + // CDMA + // Stability: development + NetworkConnectionSubtypeCdma = NetworkConnectionSubtypeKey.String("cdma") + // EVDO Rel. 0 + // Stability: development + NetworkConnectionSubtypeEvdo0 = NetworkConnectionSubtypeKey.String("evdo_0") + // EVDO Rev. A + // Stability: development + NetworkConnectionSubtypeEvdoA = NetworkConnectionSubtypeKey.String("evdo_a") + // CDMA2000 1XRTT + // Stability: development + NetworkConnectionSubtypeCdma20001xrtt = NetworkConnectionSubtypeKey.String("cdma2000_1xrtt") + // HSDPA + // Stability: development + NetworkConnectionSubtypeHsdpa = NetworkConnectionSubtypeKey.String("hsdpa") + // HSUPA + // Stability: development + NetworkConnectionSubtypeHsupa = NetworkConnectionSubtypeKey.String("hsupa") + // HSPA + // Stability: development + NetworkConnectionSubtypeHspa = NetworkConnectionSubtypeKey.String("hspa") + // IDEN + // Stability: development + NetworkConnectionSubtypeIden = NetworkConnectionSubtypeKey.String("iden") + // EVDO Rev. B + // Stability: development + NetworkConnectionSubtypeEvdoB = NetworkConnectionSubtypeKey.String("evdo_b") + // LTE + // Stability: development + NetworkConnectionSubtypeLte = NetworkConnectionSubtypeKey.String("lte") + // EHRPD + // Stability: development + NetworkConnectionSubtypeEhrpd = NetworkConnectionSubtypeKey.String("ehrpd") + // HSPAP + // Stability: development + NetworkConnectionSubtypeHspap = NetworkConnectionSubtypeKey.String("hspap") + // GSM + // Stability: development + NetworkConnectionSubtypeGsm = NetworkConnectionSubtypeKey.String("gsm") + // TD-SCDMA + // Stability: development + NetworkConnectionSubtypeTdScdma = NetworkConnectionSubtypeKey.String("td_scdma") + // IWLAN + // Stability: development + NetworkConnectionSubtypeIwlan = NetworkConnectionSubtypeKey.String("iwlan") + // 5G NR (New Radio) + // Stability: development + NetworkConnectionSubtypeNr = NetworkConnectionSubtypeKey.String("nr") + // 5G NRNSA (New Radio Non-Standalone) + // Stability: development + NetworkConnectionSubtypeNrnsa = NetworkConnectionSubtypeKey.String("nrnsa") + // LTE CA + // Stability: development + NetworkConnectionSubtypeLteCa = NetworkConnectionSubtypeKey.String("lte_ca") +) + +// Enum values for network.connection.type +var ( + // wifi + // Stability: development + NetworkConnectionTypeWifi = NetworkConnectionTypeKey.String("wifi") + // wired + // Stability: development + NetworkConnectionTypeWired = NetworkConnectionTypeKey.String("wired") + // cell + // Stability: development + NetworkConnectionTypeCell = NetworkConnectionTypeKey.String("cell") + // unavailable + // Stability: development + NetworkConnectionTypeUnavailable = NetworkConnectionTypeKey.String("unavailable") + // unknown + // Stability: development + NetworkConnectionTypeUnknown = NetworkConnectionTypeKey.String("unknown") +) + +// Enum values for network.io.direction +var ( + // transmit + // Stability: development + NetworkIODirectionTransmit = NetworkIODirectionKey.String("transmit") + // receive + // Stability: development + NetworkIODirectionReceive = NetworkIODirectionKey.String("receive") +) + +// Enum values for network.transport +var ( + // TCP + // Stability: stable + NetworkTransportTCP = NetworkTransportKey.String("tcp") + // UDP + // Stability: stable + NetworkTransportUDP = NetworkTransportKey.String("udp") + // Named or anonymous pipe. + // Stability: stable + NetworkTransportPipe = NetworkTransportKey.String("pipe") + // Unix domain socket + // Stability: stable + NetworkTransportUnix = NetworkTransportKey.String("unix") + // QUIC + // Stability: stable + NetworkTransportQUIC = NetworkTransportKey.String("quic") +) + +// Enum values for network.type +var ( + // IPv4 + // Stability: stable + NetworkTypeIPv4 = NetworkTypeKey.String("ipv4") + // IPv6 + // Stability: stable + NetworkTypeIPv6 = NetworkTypeKey.String("ipv6") +) + +// Namespace: oci +const ( + // OCIManifestDigestKey is the attribute Key conforming to the + // "oci.manifest.digest" semantic conventions. It represents the digest of the + // OCI image manifest. For container images specifically is the digest by which + // the container image is known. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "sha256:e4ca62c0d62f3e886e684806dfe9d4e0cda60d54986898173c1083856cfda0f4" + // Note: Follows [OCI Image Manifest Specification], and specifically the + // [Digest property]. + // An example can be found in [Example Image Manifest]. + // + // [OCI Image Manifest Specification]: https://github.com/opencontainers/image-spec/blob/main/manifest.md + // [Digest property]: https://github.com/opencontainers/image-spec/blob/main/descriptor.md#digests + // [Example Image Manifest]: https://github.com/opencontainers/image-spec/blob/main/manifest.md#example-image-manifest + OCIManifestDigestKey = attribute.Key("oci.manifest.digest") +) + +// OCIManifestDigest returns an attribute KeyValue conforming to the +// "oci.manifest.digest" semantic conventions. It represents the digest of the +// OCI image manifest. For container images specifically is the digest by which +// the container image is known. +func OCIManifestDigest(val string) attribute.KeyValue { + return OCIManifestDigestKey.String(val) +} + +// Namespace: opentracing +const ( + // OpenTracingRefTypeKey is the attribute Key conforming to the + // "opentracing.ref_type" semantic conventions. It represents the parent-child + // Reference type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: The causal relationship between a child Span and a parent Span. + OpenTracingRefTypeKey = attribute.Key("opentracing.ref_type") +) + +// Enum values for opentracing.ref_type +var ( + // The parent Span depends on the child Span in some capacity + // Stability: development + OpenTracingRefTypeChildOf = OpenTracingRefTypeKey.String("child_of") + // The parent Span doesn't depend in any way on the result of the child Span + // Stability: development + OpenTracingRefTypeFollowsFrom = OpenTracingRefTypeKey.String("follows_from") +) + +// Namespace: os +const ( + // OSBuildIDKey is the attribute Key conforming to the "os.build_id" semantic + // conventions. It represents the unique identifier for a particular build or + // compilation of the operating system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TQ3C.230805.001.B2", "20E247", "22621" + OSBuildIDKey = attribute.Key("os.build_id") + + // OSDescriptionKey is the attribute Key conforming to the "os.description" + // semantic conventions. It represents the human readable (not intended to be + // parsed) OS version information, like e.g. reported by `ver` or + // `lsb_release -a` commands. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Microsoft Windows [Version 10.0.18363.778]", "Ubuntu 18.04.1 LTS" + OSDescriptionKey = attribute.Key("os.description") + + // OSNameKey is the attribute Key conforming to the "os.name" semantic + // conventions. It represents the human readable operating system name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iOS", "Android", "Ubuntu" + OSNameKey = attribute.Key("os.name") + + // OSTypeKey is the attribute Key conforming to the "os.type" semantic + // conventions. It represents the operating system type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + OSTypeKey = attribute.Key("os.type") + + // OSVersionKey is the attribute Key conforming to the "os.version" semantic + // conventions. It represents the version string of the operating system as + // defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.2.1", "18.04.1" + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + OSVersionKey = attribute.Key("os.version") +) + +// OSBuildID returns an attribute KeyValue conforming to the "os.build_id" +// semantic conventions. It represents the unique identifier for a particular +// build or compilation of the operating system. +func OSBuildID(val string) attribute.KeyValue { + return OSBuildIDKey.String(val) +} + +// OSDescription returns an attribute KeyValue conforming to the "os.description" +// semantic conventions. It represents the human readable (not intended to be +// parsed) OS version information, like e.g. reported by `ver` or +// `lsb_release -a` commands. +func OSDescription(val string) attribute.KeyValue { + return OSDescriptionKey.String(val) +} + +// OSName returns an attribute KeyValue conforming to the "os.name" semantic +// conventions. It represents the human readable operating system name. +func OSName(val string) attribute.KeyValue { + return OSNameKey.String(val) +} + +// OSVersion returns an attribute KeyValue conforming to the "os.version" +// semantic conventions. It represents the version string of the operating system +// as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func OSVersion(val string) attribute.KeyValue { + return OSVersionKey.String(val) +} + +// Enum values for os.type +var ( + // Microsoft Windows + // Stability: development + OSTypeWindows = OSTypeKey.String("windows") + // Linux + // Stability: development + OSTypeLinux = OSTypeKey.String("linux") + // Apple Darwin + // Stability: development + OSTypeDarwin = OSTypeKey.String("darwin") + // FreeBSD + // Stability: development + OSTypeFreeBSD = OSTypeKey.String("freebsd") + // NetBSD + // Stability: development + OSTypeNetBSD = OSTypeKey.String("netbsd") + // OpenBSD + // Stability: development + OSTypeOpenBSD = OSTypeKey.String("openbsd") + // DragonFly BSD + // Stability: development + OSTypeDragonflyBSD = OSTypeKey.String("dragonflybsd") + // HP-UX (Hewlett Packard Unix) + // Stability: development + OSTypeHPUX = OSTypeKey.String("hpux") + // AIX (Advanced Interactive eXecutive) + // Stability: development + OSTypeAIX = OSTypeKey.String("aix") + // SunOS, Oracle Solaris + // Stability: development + OSTypeSolaris = OSTypeKey.String("solaris") + // IBM z/OS + // Stability: development + OSTypeZOS = OSTypeKey.String("z_os") +) + +// Namespace: otel +const ( + // OTelComponentNameKey is the attribute Key conforming to the + // "otel.component.name" semantic conventions. It represents a name uniquely + // identifying the instance of the OpenTelemetry component within its containing + // SDK instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otlp_grpc_span_exporter/0", "custom-name" + // Note: Implementations SHOULD ensure a low cardinality for this attribute, + // even across application or SDK restarts. + // E.g. implementations MUST NOT use UUIDs as values for this attribute. + // + // Implementations MAY achieve these goals by following a + // `/` pattern, e.g. + // `batching_span_processor/0`. + // Hereby `otel.component.type` refers to the corresponding attribute value of + // the component. + // + // The value of `instance-counter` MAY be automatically assigned by the + // component and uniqueness within the enclosing SDK instance MUST be + // guaranteed. + // For example, `` MAY be implemented by using a monotonically + // increasing counter (starting with `0`), which is incremented every time an + // instance of the given component type is started. + // + // With this implementation, for example the first Batching Span Processor would + // have `batching_span_processor/0` + // as `otel.component.name`, the second one `batching_span_processor/1` and so + // on. + // These values will therefore be reused in the case of an application restart. + OTelComponentNameKey = attribute.Key("otel.component.name") + + // OTelComponentTypeKey is the attribute Key conforming to the + // "otel.component.type" semantic conventions. It represents a name identifying + // the type of the OpenTelemetry component. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "batching_span_processor", "com.example.MySpanExporter" + // Note: If none of the standardized values apply, implementations SHOULD use + // the language-defined name of the type. + // E.g. for Java the fully qualified classname SHOULD be used in this case. + OTelComponentTypeKey = attribute.Key("otel.component.type") + + // OTelScopeNameKey is the attribute Key conforming to the "otel.scope.name" + // semantic conventions. It represents the name of the instrumentation scope - ( + // `InstrumentationScope.Name` in OTLP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "io.opentelemetry.contrib.mongodb" + OTelScopeNameKey = attribute.Key("otel.scope.name") + + // OTelScopeVersionKey is the attribute Key conforming to the + // "otel.scope.version" semantic conventions. It represents the version of the + // instrumentation scope - (`InstrumentationScope.Version` in OTLP). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.0.0" + OTelScopeVersionKey = attribute.Key("otel.scope.version") + + // OTelSpanSamplingResultKey is the attribute Key conforming to the + // "otel.span.sampling_result" semantic conventions. It represents the result + // value of the sampler for this span. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + OTelSpanSamplingResultKey = attribute.Key("otel.span.sampling_result") + + // OTelStatusCodeKey is the attribute Key conforming to the "otel.status_code" + // semantic conventions. It represents the name of the code, either "OK" or + // "ERROR". MUST NOT be set if the status code is UNSET. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + OTelStatusCodeKey = attribute.Key("otel.status_code") + + // OTelStatusDescriptionKey is the attribute Key conforming to the + // "otel.status_description" semantic conventions. It represents the description + // of the Status if it has a value, otherwise not set. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "resource not found" + OTelStatusDescriptionKey = attribute.Key("otel.status_description") +) + +// OTelComponentName returns an attribute KeyValue conforming to the +// "otel.component.name" semantic conventions. It represents a name uniquely +// identifying the instance of the OpenTelemetry component within its containing +// SDK instance. +func OTelComponentName(val string) attribute.KeyValue { + return OTelComponentNameKey.String(val) +} + +// OTelScopeName returns an attribute KeyValue conforming to the +// "otel.scope.name" semantic conventions. It represents the name of the +// instrumentation scope - (`InstrumentationScope.Name` in OTLP). +func OTelScopeName(val string) attribute.KeyValue { + return OTelScopeNameKey.String(val) +} + +// OTelScopeVersion returns an attribute KeyValue conforming to the +// "otel.scope.version" semantic conventions. It represents the version of the +// instrumentation scope - (`InstrumentationScope.Version` in OTLP). +func OTelScopeVersion(val string) attribute.KeyValue { + return OTelScopeVersionKey.String(val) +} + +// OTelStatusDescription returns an attribute KeyValue conforming to the +// "otel.status_description" semantic conventions. It represents the description +// of the Status if it has a value, otherwise not set. +func OTelStatusDescription(val string) attribute.KeyValue { + return OTelStatusDescriptionKey.String(val) +} + +// Enum values for otel.component.type +var ( + // The builtin SDK batching span processor + // + // Stability: development + OTelComponentTypeBatchingSpanProcessor = OTelComponentTypeKey.String("batching_span_processor") + // The builtin SDK simple span processor + // + // Stability: development + OTelComponentTypeSimpleSpanProcessor = OTelComponentTypeKey.String("simple_span_processor") + // The builtin SDK batching log record processor + // + // Stability: development + OTelComponentTypeBatchingLogProcessor = OTelComponentTypeKey.String("batching_log_processor") + // The builtin SDK simple log record processor + // + // Stability: development + OTelComponentTypeSimpleLogProcessor = OTelComponentTypeKey.String("simple_log_processor") + // OTLP span exporter over gRPC with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpGRPCSpanExporter = OTelComponentTypeKey.String("otlp_grpc_span_exporter") + // OTLP span exporter over HTTP with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPSpanExporter = OTelComponentTypeKey.String("otlp_http_span_exporter") + // OTLP span exporter over HTTP with JSON serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPJSONSpanExporter = OTelComponentTypeKey.String("otlp_http_json_span_exporter") + // OTLP log record exporter over gRPC with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpGRPCLogExporter = OTelComponentTypeKey.String("otlp_grpc_log_exporter") + // OTLP log record exporter over HTTP with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPLogExporter = OTelComponentTypeKey.String("otlp_http_log_exporter") + // OTLP log record exporter over HTTP with JSON serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPJSONLogExporter = OTelComponentTypeKey.String("otlp_http_json_log_exporter") + // The builtin SDK periodically exporting metric reader + // + // Stability: development + OTelComponentTypePeriodicMetricReader = OTelComponentTypeKey.String("periodic_metric_reader") + // OTLP metric exporter over gRPC with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpGRPCMetricExporter = OTelComponentTypeKey.String("otlp_grpc_metric_exporter") + // OTLP metric exporter over HTTP with protobuf serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPMetricExporter = OTelComponentTypeKey.String("otlp_http_metric_exporter") + // OTLP metric exporter over HTTP with JSON serialization + // + // Stability: development + OTelComponentTypeOtlpHTTPJSONMetricExporter = OTelComponentTypeKey.String("otlp_http_json_metric_exporter") +) + +// Enum values for otel.span.sampling_result +var ( + // The span is not sampled and not recording + // Stability: development + OTelSpanSamplingResultDrop = OTelSpanSamplingResultKey.String("DROP") + // The span is not sampled, but recording + // Stability: development + OTelSpanSamplingResultRecordOnly = OTelSpanSamplingResultKey.String("RECORD_ONLY") + // The span is sampled and recording + // Stability: development + OTelSpanSamplingResultRecordAndSample = OTelSpanSamplingResultKey.String("RECORD_AND_SAMPLE") +) + +// Enum values for otel.status_code +var ( + // The operation has been validated by an Application developer or Operator to + // have completed successfully. + // Stability: stable + OTelStatusCodeOk = OTelStatusCodeKey.String("OK") + // The operation contains an error. + // Stability: stable + OTelStatusCodeError = OTelStatusCodeKey.String("ERROR") +) + +// Namespace: peer +const ( + // PeerServiceKey is the attribute Key conforming to the "peer.service" semantic + // conventions. It represents the [`service.name`] of the remote service. SHOULD + // be equal to the actual `service.name` resource attribute of the remote + // service if any. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: AuthTokenCache + // + // [`service.name`]: /docs/resource/README.md#service + PeerServiceKey = attribute.Key("peer.service") +) + +// PeerService returns an attribute KeyValue conforming to the "peer.service" +// semantic conventions. It represents the [`service.name`] of the remote +// service. SHOULD be equal to the actual `service.name` resource attribute of +// the remote service if any. +// +// [`service.name`]: /docs/resource/README.md#service +func PeerService(val string) attribute.KeyValue { + return PeerServiceKey.String(val) +} + +// Namespace: process +const ( + // ProcessArgsCountKey is the attribute Key conforming to the + // "process.args_count" semantic conventions. It represents the length of the + // process.command_args array. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 4 + // Note: This field can be useful for querying or performing bucket analysis on + // how many arguments were provided to start a process. More arguments may be an + // indication of suspicious activity. + ProcessArgsCountKey = attribute.Key("process.args_count") + + // ProcessCommandKey is the attribute Key conforming to the "process.command" + // semantic conventions. It represents the command used to launch the process + // (i.e. the command name). On Linux based systems, can be set to the zeroth + // string in `proc/[pid]/cmdline`. On Windows, can be set to the first parameter + // extracted from `GetCommandLineW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cmd/otelcol" + ProcessCommandKey = attribute.Key("process.command") + + // ProcessCommandArgsKey is the attribute Key conforming to the + // "process.command_args" semantic conventions. It represents the all the + // command arguments (including the command/executable itself) as received by + // the process. On Linux-based systems (and some other Unixoid systems + // supporting procfs), can be set according to the list of null-delimited + // strings extracted from `proc/[pid]/cmdline`. For libc-based executables, this + // would be the full argv vector passed to `main`. SHOULD NOT be collected by + // default unless there is sanitization that excludes sensitive data. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cmd/otecol", "--config=config.yaml" + ProcessCommandArgsKey = attribute.Key("process.command_args") + + // ProcessCommandLineKey is the attribute Key conforming to the + // "process.command_line" semantic conventions. It represents the full command + // used to launch the process as a single string representing the full command. + // On Windows, can be set to the result of `GetCommandLineW`. Do not set this if + // you have to assemble it just for monitoring; use `process.command_args` + // instead. SHOULD NOT be collected by default unless there is sanitization that + // excludes sensitive data. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "C:\cmd\otecol --config="my directory\config.yaml"" + ProcessCommandLineKey = attribute.Key("process.command_line") + + // ProcessContextSwitchTypeKey is the attribute Key conforming to the + // "process.context_switch_type" semantic conventions. It represents the + // specifies whether the context switches for this data point were voluntary or + // involuntary. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessContextSwitchTypeKey = attribute.Key("process.context_switch_type") + + // ProcessCreationTimeKey is the attribute Key conforming to the + // "process.creation.time" semantic conventions. It represents the date and time + // the process was created, in ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2023-11-21T09:25:34.853Z" + ProcessCreationTimeKey = attribute.Key("process.creation.time") + + // ProcessExecutableBuildIDGNUKey is the attribute Key conforming to the + // "process.executable.build_id.gnu" semantic conventions. It represents the GNU + // build ID as found in the `.note.gnu.build-id` ELF section (hex string). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "c89b11207f6479603b0d49bf291c092c2b719293" + ProcessExecutableBuildIDGNUKey = attribute.Key("process.executable.build_id.gnu") + + // ProcessExecutableBuildIDGoKey is the attribute Key conforming to the + // "process.executable.build_id.go" semantic conventions. It represents the Go + // build ID as retrieved by `go tool buildid `. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "foh3mEXu7BLZjsN9pOwG/kATcXlYVCDEFouRMQed_/WwRFB1hPo9LBkekthSPG/x8hMC8emW2cCjXD0_1aY" + ProcessExecutableBuildIDGoKey = attribute.Key("process.executable.build_id.go") + + // ProcessExecutableBuildIDHtlhashKey is the attribute Key conforming to the + // "process.executable.build_id.htlhash" semantic conventions. It represents the + // profiling specific build ID for executables. See the OTel specification for + // Profiles for more information. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "600DCAFE4A110000F2BF38C493F5FB92" + ProcessExecutableBuildIDHtlhashKey = attribute.Key("process.executable.build_id.htlhash") + + // ProcessExecutableNameKey is the attribute Key conforming to the + // "process.executable.name" semantic conventions. It represents the name of the + // process executable. On Linux based systems, this SHOULD be set to the base + // name of the target of `/proc/[pid]/exe`. On Windows, this SHOULD be set to + // the base name of `GetProcessImageFileNameW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "otelcol" + ProcessExecutableNameKey = attribute.Key("process.executable.name") + + // ProcessExecutablePathKey is the attribute Key conforming to the + // "process.executable.path" semantic conventions. It represents the full path + // to the process executable. On Linux based systems, can be set to the target + // of `proc/[pid]/exe`. On Windows, can be set to the result of + // `GetProcessImageFileNameW`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/usr/bin/cmd/otelcol" + ProcessExecutablePathKey = attribute.Key("process.executable.path") + + // ProcessExitCodeKey is the attribute Key conforming to the "process.exit.code" + // semantic conventions. It represents the exit code of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 127 + ProcessExitCodeKey = attribute.Key("process.exit.code") + + // ProcessExitTimeKey is the attribute Key conforming to the "process.exit.time" + // semantic conventions. It represents the date and time the process exited, in + // ISO 8601 format. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2023-11-21T09:26:12.315Z" + ProcessExitTimeKey = attribute.Key("process.exit.time") + + // ProcessGroupLeaderPIDKey is the attribute Key conforming to the + // "process.group_leader.pid" semantic conventions. It represents the PID of the + // process's group leader. This is also the process group ID (PGID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 23 + ProcessGroupLeaderPIDKey = attribute.Key("process.group_leader.pid") + + // ProcessInteractiveKey is the attribute Key conforming to the + // "process.interactive" semantic conventions. It represents the whether the + // process is connected to an interactive shell. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessInteractiveKey = attribute.Key("process.interactive") + + // ProcessLinuxCgroupKey is the attribute Key conforming to the + // "process.linux.cgroup" semantic conventions. It represents the control group + // associated with the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1:name=systemd:/user.slice/user-1000.slice/session-3.scope", + // "0::/user.slice/user-1000.slice/user@1000.service/tmux-spawn-0267755b-4639-4a27-90ed-f19f88e53748.scope" + // Note: Control groups (cgroups) are a kernel feature used to organize and + // manage process resources. This attribute provides the path(s) to the + // cgroup(s) associated with the process, which should match the contents of the + // [/proc/[PID]/cgroup] file. + // + // [/proc/[PID]/cgroup]: https://man7.org/linux/man-pages/man7/cgroups.7.html + ProcessLinuxCgroupKey = attribute.Key("process.linux.cgroup") + + // ProcessOwnerKey is the attribute Key conforming to the "process.owner" + // semantic conventions. It represents the username of the user that owns the + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + ProcessOwnerKey = attribute.Key("process.owner") + + // ProcessPagingFaultTypeKey is the attribute Key conforming to the + // "process.paging.fault_type" semantic conventions. It represents the type of + // page fault for this data point. Type `major` is for major/hard page faults, + // and `minor` is for minor/soft page faults. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + ProcessPagingFaultTypeKey = attribute.Key("process.paging.fault_type") + + // ProcessParentPIDKey is the attribute Key conforming to the + // "process.parent_pid" semantic conventions. It represents the parent Process + // identifier (PPID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 111 + ProcessParentPIDKey = attribute.Key("process.parent_pid") + + // ProcessPIDKey is the attribute Key conforming to the "process.pid" semantic + // conventions. It represents the process identifier (PID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1234 + ProcessPIDKey = attribute.Key("process.pid") + + // ProcessRealUserIDKey is the attribute Key conforming to the + // "process.real_user.id" semantic conventions. It represents the real user ID + // (RUID) of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1000 + ProcessRealUserIDKey = attribute.Key("process.real_user.id") + + // ProcessRealUserNameKey is the attribute Key conforming to the + // "process.real_user.name" semantic conventions. It represents the username of + // the real user of the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "operator" + ProcessRealUserNameKey = attribute.Key("process.real_user.name") + + // ProcessRuntimeDescriptionKey is the attribute Key conforming to the + // "process.runtime.description" semantic conventions. It represents an + // additional description about the runtime of the process, for example a + // specific vendor customization of the runtime environment. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: Eclipse OpenJ9 Eclipse OpenJ9 VM openj9-0.21.0 + ProcessRuntimeDescriptionKey = attribute.Key("process.runtime.description") + + // ProcessRuntimeNameKey is the attribute Key conforming to the + // "process.runtime.name" semantic conventions. It represents the name of the + // runtime of this process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "OpenJDK Runtime Environment" + ProcessRuntimeNameKey = attribute.Key("process.runtime.name") + + // ProcessRuntimeVersionKey is the attribute Key conforming to the + // "process.runtime.version" semantic conventions. It represents the version of + // the runtime of this process, as returned by the runtime without modification. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 14.0.2 + ProcessRuntimeVersionKey = attribute.Key("process.runtime.version") + + // ProcessSavedUserIDKey is the attribute Key conforming to the + // "process.saved_user.id" semantic conventions. It represents the saved user ID + // (SUID) of the process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1002 + ProcessSavedUserIDKey = attribute.Key("process.saved_user.id") + + // ProcessSavedUserNameKey is the attribute Key conforming to the + // "process.saved_user.name" semantic conventions. It represents the username of + // the saved user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "operator" + ProcessSavedUserNameKey = attribute.Key("process.saved_user.name") + + // ProcessSessionLeaderPIDKey is the attribute Key conforming to the + // "process.session_leader.pid" semantic conventions. It represents the PID of + // the process's session leader. This is also the session ID (SID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 14 + ProcessSessionLeaderPIDKey = attribute.Key("process.session_leader.pid") + + // ProcessTitleKey is the attribute Key conforming to the "process.title" + // semantic conventions. It represents the process title (proctitle). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cat /etc/hostname", "xfce4-session", "bash" + // Note: In many Unix-like systems, process title (proctitle), is the string + // that represents the name or command line of a running process, displayed by + // system monitoring tools like ps, top, and htop. + ProcessTitleKey = attribute.Key("process.title") + + // ProcessUserIDKey is the attribute Key conforming to the "process.user.id" + // semantic conventions. It represents the effective user ID (EUID) of the + // process. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1001 + ProcessUserIDKey = attribute.Key("process.user.id") + + // ProcessUserNameKey is the attribute Key conforming to the "process.user.name" + // semantic conventions. It represents the username of the effective user of the + // process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "root" + ProcessUserNameKey = attribute.Key("process.user.name") + + // ProcessVpidKey is the attribute Key conforming to the "process.vpid" semantic + // conventions. It represents the virtual process identifier. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 12 + // Note: The process ID within a PID namespace. This is not necessarily unique + // across all processes on the host but it is unique within the process + // namespace that the process exists within. + ProcessVpidKey = attribute.Key("process.vpid") + + // ProcessWorkingDirectoryKey is the attribute Key conforming to the + // "process.working_directory" semantic conventions. It represents the working + // directory of the process. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/root" + ProcessWorkingDirectoryKey = attribute.Key("process.working_directory") +) + +// ProcessArgsCount returns an attribute KeyValue conforming to the +// "process.args_count" semantic conventions. It represents the length of the +// process.command_args array. +func ProcessArgsCount(val int) attribute.KeyValue { + return ProcessArgsCountKey.Int(val) +} + +// ProcessCommand returns an attribute KeyValue conforming to the +// "process.command" semantic conventions. It represents the command used to +// launch the process (i.e. the command name). On Linux based systems, can be set +// to the zeroth string in `proc/[pid]/cmdline`. On Windows, can be set to the +// first parameter extracted from `GetCommandLineW`. +func ProcessCommand(val string) attribute.KeyValue { + return ProcessCommandKey.String(val) +} + +// ProcessCommandArgs returns an attribute KeyValue conforming to the +// "process.command_args" semantic conventions. It represents the all the command +// arguments (including the command/executable itself) as received by the +// process. On Linux-based systems (and some other Unixoid systems supporting +// procfs), can be set according to the list of null-delimited strings extracted +// from `proc/[pid]/cmdline`. For libc-based executables, this would be the full +// argv vector passed to `main`. SHOULD NOT be collected by default unless there +// is sanitization that excludes sensitive data. +func ProcessCommandArgs(val ...string) attribute.KeyValue { + return ProcessCommandArgsKey.StringSlice(val) +} + +// ProcessCommandLine returns an attribute KeyValue conforming to the +// "process.command_line" semantic conventions. It represents the full command +// used to launch the process as a single string representing the full command. +// On Windows, can be set to the result of `GetCommandLineW`. Do not set this if +// you have to assemble it just for monitoring; use `process.command_args` +// instead. SHOULD NOT be collected by default unless there is sanitization that +// excludes sensitive data. +func ProcessCommandLine(val string) attribute.KeyValue { + return ProcessCommandLineKey.String(val) +} + +// ProcessCreationTime returns an attribute KeyValue conforming to the +// "process.creation.time" semantic conventions. It represents the date and time +// the process was created, in ISO 8601 format. +func ProcessCreationTime(val string) attribute.KeyValue { + return ProcessCreationTimeKey.String(val) +} + +// ProcessExecutableBuildIDGNU returns an attribute KeyValue conforming to the +// "process.executable.build_id.gnu" semantic conventions. It represents the GNU +// build ID as found in the `.note.gnu.build-id` ELF section (hex string). +func ProcessExecutableBuildIDGNU(val string) attribute.KeyValue { + return ProcessExecutableBuildIDGNUKey.String(val) +} + +// ProcessExecutableBuildIDGo returns an attribute KeyValue conforming to the +// "process.executable.build_id.go" semantic conventions. It represents the Go +// build ID as retrieved by `go tool buildid `. +func ProcessExecutableBuildIDGo(val string) attribute.KeyValue { + return ProcessExecutableBuildIDGoKey.String(val) +} + +// ProcessExecutableBuildIDHtlhash returns an attribute KeyValue conforming to +// the "process.executable.build_id.htlhash" semantic conventions. It represents +// the profiling specific build ID for executables. See the OTel specification +// for Profiles for more information. +func ProcessExecutableBuildIDHtlhash(val string) attribute.KeyValue { + return ProcessExecutableBuildIDHtlhashKey.String(val) +} + +// ProcessExecutableName returns an attribute KeyValue conforming to the +// "process.executable.name" semantic conventions. It represents the name of the +// process executable. On Linux based systems, this SHOULD be set to the base +// name of the target of `/proc/[pid]/exe`. On Windows, this SHOULD be set to the +// base name of `GetProcessImageFileNameW`. +func ProcessExecutableName(val string) attribute.KeyValue { + return ProcessExecutableNameKey.String(val) +} + +// ProcessExecutablePath returns an attribute KeyValue conforming to the +// "process.executable.path" semantic conventions. It represents the full path to +// the process executable. On Linux based systems, can be set to the target of +// `proc/[pid]/exe`. On Windows, can be set to the result of +// `GetProcessImageFileNameW`. +func ProcessExecutablePath(val string) attribute.KeyValue { + return ProcessExecutablePathKey.String(val) +} + +// ProcessExitCode returns an attribute KeyValue conforming to the +// "process.exit.code" semantic conventions. It represents the exit code of the +// process. +func ProcessExitCode(val int) attribute.KeyValue { + return ProcessExitCodeKey.Int(val) +} + +// ProcessExitTime returns an attribute KeyValue conforming to the +// "process.exit.time" semantic conventions. It represents the date and time the +// process exited, in ISO 8601 format. +func ProcessExitTime(val string) attribute.KeyValue { + return ProcessExitTimeKey.String(val) +} + +// ProcessGroupLeaderPID returns an attribute KeyValue conforming to the +// "process.group_leader.pid" semantic conventions. It represents the PID of the +// process's group leader. This is also the process group ID (PGID) of the +// process. +func ProcessGroupLeaderPID(val int) attribute.KeyValue { + return ProcessGroupLeaderPIDKey.Int(val) +} + +// ProcessInteractive returns an attribute KeyValue conforming to the +// "process.interactive" semantic conventions. It represents the whether the +// process is connected to an interactive shell. +func ProcessInteractive(val bool) attribute.KeyValue { + return ProcessInteractiveKey.Bool(val) +} + +// ProcessLinuxCgroup returns an attribute KeyValue conforming to the +// "process.linux.cgroup" semantic conventions. It represents the control group +// associated with the process. +func ProcessLinuxCgroup(val string) attribute.KeyValue { + return ProcessLinuxCgroupKey.String(val) +} + +// ProcessOwner returns an attribute KeyValue conforming to the "process.owner" +// semantic conventions. It represents the username of the user that owns the +// process. +func ProcessOwner(val string) attribute.KeyValue { + return ProcessOwnerKey.String(val) +} + +// ProcessParentPID returns an attribute KeyValue conforming to the +// "process.parent_pid" semantic conventions. It represents the parent Process +// identifier (PPID). +func ProcessParentPID(val int) attribute.KeyValue { + return ProcessParentPIDKey.Int(val) +} + +// ProcessPID returns an attribute KeyValue conforming to the "process.pid" +// semantic conventions. It represents the process identifier (PID). +func ProcessPID(val int) attribute.KeyValue { + return ProcessPIDKey.Int(val) +} + +// ProcessRealUserID returns an attribute KeyValue conforming to the +// "process.real_user.id" semantic conventions. It represents the real user ID +// (RUID) of the process. +func ProcessRealUserID(val int) attribute.KeyValue { + return ProcessRealUserIDKey.Int(val) +} + +// ProcessRealUserName returns an attribute KeyValue conforming to the +// "process.real_user.name" semantic conventions. It represents the username of +// the real user of the process. +func ProcessRealUserName(val string) attribute.KeyValue { + return ProcessRealUserNameKey.String(val) +} + +// ProcessRuntimeDescription returns an attribute KeyValue conforming to the +// "process.runtime.description" semantic conventions. It represents an +// additional description about the runtime of the process, for example a +// specific vendor customization of the runtime environment. +func ProcessRuntimeDescription(val string) attribute.KeyValue { + return ProcessRuntimeDescriptionKey.String(val) +} + +// ProcessRuntimeName returns an attribute KeyValue conforming to the +// "process.runtime.name" semantic conventions. It represents the name of the +// runtime of this process. +func ProcessRuntimeName(val string) attribute.KeyValue { + return ProcessRuntimeNameKey.String(val) +} + +// ProcessRuntimeVersion returns an attribute KeyValue conforming to the +// "process.runtime.version" semantic conventions. It represents the version of +// the runtime of this process, as returned by the runtime without modification. +func ProcessRuntimeVersion(val string) attribute.KeyValue { + return ProcessRuntimeVersionKey.String(val) +} + +// ProcessSavedUserID returns an attribute KeyValue conforming to the +// "process.saved_user.id" semantic conventions. It represents the saved user ID +// (SUID) of the process. +func ProcessSavedUserID(val int) attribute.KeyValue { + return ProcessSavedUserIDKey.Int(val) +} + +// ProcessSavedUserName returns an attribute KeyValue conforming to the +// "process.saved_user.name" semantic conventions. It represents the username of +// the saved user. +func ProcessSavedUserName(val string) attribute.KeyValue { + return ProcessSavedUserNameKey.String(val) +} + +// ProcessSessionLeaderPID returns an attribute KeyValue conforming to the +// "process.session_leader.pid" semantic conventions. It represents the PID of +// the process's session leader. This is also the session ID (SID) of the +// process. +func ProcessSessionLeaderPID(val int) attribute.KeyValue { + return ProcessSessionLeaderPIDKey.Int(val) +} + +// ProcessTitle returns an attribute KeyValue conforming to the "process.title" +// semantic conventions. It represents the process title (proctitle). +func ProcessTitle(val string) attribute.KeyValue { + return ProcessTitleKey.String(val) +} + +// ProcessUserID returns an attribute KeyValue conforming to the +// "process.user.id" semantic conventions. It represents the effective user ID +// (EUID) of the process. +func ProcessUserID(val int) attribute.KeyValue { + return ProcessUserIDKey.Int(val) +} + +// ProcessUserName returns an attribute KeyValue conforming to the +// "process.user.name" semantic conventions. It represents the username of the +// effective user of the process. +func ProcessUserName(val string) attribute.KeyValue { + return ProcessUserNameKey.String(val) +} + +// ProcessVpid returns an attribute KeyValue conforming to the "process.vpid" +// semantic conventions. It represents the virtual process identifier. +func ProcessVpid(val int) attribute.KeyValue { + return ProcessVpidKey.Int(val) +} + +// ProcessWorkingDirectory returns an attribute KeyValue conforming to the +// "process.working_directory" semantic conventions. It represents the working +// directory of the process. +func ProcessWorkingDirectory(val string) attribute.KeyValue { + return ProcessWorkingDirectoryKey.String(val) +} + +// Enum values for process.context_switch_type +var ( + // voluntary + // Stability: development + ProcessContextSwitchTypeVoluntary = ProcessContextSwitchTypeKey.String("voluntary") + // involuntary + // Stability: development + ProcessContextSwitchTypeInvoluntary = ProcessContextSwitchTypeKey.String("involuntary") +) + +// Enum values for process.paging.fault_type +var ( + // major + // Stability: development + ProcessPagingFaultTypeMajor = ProcessPagingFaultTypeKey.String("major") + // minor + // Stability: development + ProcessPagingFaultTypeMinor = ProcessPagingFaultTypeKey.String("minor") +) + +// Namespace: profile +const ( + // ProfileFrameTypeKey is the attribute Key conforming to the + // "profile.frame.type" semantic conventions. It represents the describes the + // interpreter or compiler of a single frame. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "cpython" + ProfileFrameTypeKey = attribute.Key("profile.frame.type") +) + +// Enum values for profile.frame.type +var ( + // [.NET] + // + // Stability: development + // + // [.NET]: https://wikipedia.org/wiki/.NET + ProfileFrameTypeDotnet = ProfileFrameTypeKey.String("dotnet") + // [JVM] + // + // Stability: development + // + // [JVM]: https://wikipedia.org/wiki/Java_virtual_machine + ProfileFrameTypeJVM = ProfileFrameTypeKey.String("jvm") + // [Kernel] + // + // Stability: development + // + // [Kernel]: https://wikipedia.org/wiki/Kernel_(operating_system) + ProfileFrameTypeKernel = ProfileFrameTypeKey.String("kernel") + // Can be one of but not limited to [C], [C++], [Go] or [Rust]. If possible, a + // more precise value MUST be used. + // + // Stability: development + // + // [C]: https://wikipedia.org/wiki/C_(programming_language) + // [C++]: https://wikipedia.org/wiki/C%2B%2B + // [Go]: https://wikipedia.org/wiki/Go_(programming_language) + // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language) + ProfileFrameTypeNative = ProfileFrameTypeKey.String("native") + // [Perl] + // + // Stability: development + // + // [Perl]: https://wikipedia.org/wiki/Perl + ProfileFrameTypePerl = ProfileFrameTypeKey.String("perl") + // [PHP] + // + // Stability: development + // + // [PHP]: https://wikipedia.org/wiki/PHP + ProfileFrameTypePHP = ProfileFrameTypeKey.String("php") + // [Python] + // + // Stability: development + // + // [Python]: https://wikipedia.org/wiki/Python_(programming_language) + ProfileFrameTypeCpython = ProfileFrameTypeKey.String("cpython") + // [Ruby] + // + // Stability: development + // + // [Ruby]: https://wikipedia.org/wiki/Ruby_(programming_language) + ProfileFrameTypeRuby = ProfileFrameTypeKey.String("ruby") + // [V8JS] + // + // Stability: development + // + // [V8JS]: https://wikipedia.org/wiki/V8_(JavaScript_engine) + ProfileFrameTypeV8JS = ProfileFrameTypeKey.String("v8js") + // [Erlang] + // + // Stability: development + // + // [Erlang]: https://en.wikipedia.org/wiki/BEAM_(Erlang_virtual_machine) + ProfileFrameTypeBeam = ProfileFrameTypeKey.String("beam") + // [Go], + // + // Stability: development + // + // [Go]: https://wikipedia.org/wiki/Go_(programming_language) + ProfileFrameTypeGo = ProfileFrameTypeKey.String("go") + // [Rust] + // + // Stability: development + // + // [Rust]: https://wikipedia.org/wiki/Rust_(programming_language) + ProfileFrameTypeRust = ProfileFrameTypeKey.String("rust") +) + +// Namespace: rpc +const ( + // RPCConnectRPCErrorCodeKey is the attribute Key conforming to the + // "rpc.connect_rpc.error_code" semantic conventions. It represents the + // [error codes] of the Connect request. Error codes are always string values. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [error codes]: https://connectrpc.com//docs/protocol/#error-codes + RPCConnectRPCErrorCodeKey = attribute.Key("rpc.connect_rpc.error_code") + + // RPCGRPCStatusCodeKey is the attribute Key conforming to the + // "rpc.grpc.status_code" semantic conventions. It represents the + // [numeric status code] of the gRPC request. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [numeric status code]: https://github.com/grpc/grpc/blob/v1.33.2/doc/statuscodes.md + RPCGRPCStatusCodeKey = attribute.Key("rpc.grpc.status_code") + + // RPCJSONRPCErrorCodeKey is the attribute Key conforming to the + // "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code` + // property of response if it is an error response. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: -32700, 100 + RPCJSONRPCErrorCodeKey = attribute.Key("rpc.jsonrpc.error_code") + + // RPCJSONRPCErrorMessageKey is the attribute Key conforming to the + // "rpc.jsonrpc.error_message" semantic conventions. It represents the + // `error.message` property of response if it is an error response. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Parse error", "User already exists" + RPCJSONRPCErrorMessageKey = attribute.Key("rpc.jsonrpc.error_message") + + // RPCJSONRPCRequestIDKey is the attribute Key conforming to the + // "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` + // property of request or response. Since protocol allows id to be int, string, + // `null` or missing (for notifications), value is expected to be cast to string + // for simplicity. Use empty string in case of `null` value. Omit entirely if + // this is a notification. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "10", "request-7", "" + RPCJSONRPCRequestIDKey = attribute.Key("rpc.jsonrpc.request_id") + + // RPCJSONRPCVersionKey is the attribute Key conforming to the + // "rpc.jsonrpc.version" semantic conventions. It represents the protocol + // version as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 + // doesn't specify this, the value can be omitted. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2.0", "1.0" + RPCJSONRPCVersionKey = attribute.Key("rpc.jsonrpc.version") + + // RPCMessageCompressedSizeKey is the attribute Key conforming to the + // "rpc.message.compressed_size" semantic conventions. It represents the + // compressed size of the message in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageCompressedSizeKey = attribute.Key("rpc.message.compressed_size") + + // RPCMessageIDKey is the attribute Key conforming to the "rpc.message.id" + // semantic conventions. It MUST be calculated as two different counters + // starting from `1` one for sent messages and one for received message.. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This way we guarantee that the values will be consistent between + // different implementations. + RPCMessageIDKey = attribute.Key("rpc.message.id") + + // RPCMessageTypeKey is the attribute Key conforming to the "rpc.message.type" + // semantic conventions. It represents the whether this is a received or sent + // message. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageTypeKey = attribute.Key("rpc.message.type") + + // RPCMessageUncompressedSizeKey is the attribute Key conforming to the + // "rpc.message.uncompressed_size" semantic conventions. It represents the + // uncompressed size of the message in bytes. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCMessageUncompressedSizeKey = attribute.Key("rpc.message.uncompressed_size") + + // RPCMethodKey is the attribute Key conforming to the "rpc.method" semantic + // conventions. It represents the name of the (logical) method being called, + // must be equal to the $method part in the span name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: exampleMethod + // Note: This is the logical name of the method from the RPC interface + // perspective, which can be different from the name of any implementing + // method/function. The `code.function.name` attribute may be used to store the + // latter (e.g., method actually executing the call on the server side, RPC + // client stub method on the client side). + RPCMethodKey = attribute.Key("rpc.method") + + // RPCServiceKey is the attribute Key conforming to the "rpc.service" semantic + // conventions. It represents the full (logical) name of the service being + // called, including its package name, if applicable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: myservice.EchoService + // Note: This is the logical name of the service from the RPC interface + // perspective, which can be different from the name of any implementing class. + // The `code.namespace` attribute may be used to store the latter (despite the + // attribute name, it may include a class name; e.g., class with method actually + // executing the call on the server side, RPC client stub class on the client + // side). + RPCServiceKey = attribute.Key("rpc.service") + + // RPCSystemKey is the attribute Key conforming to the "rpc.system" semantic + // conventions. It represents a string identifying the remoting system. See + // below for a list of well-known identifiers. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + RPCSystemKey = attribute.Key("rpc.system") +) + +// RPCJSONRPCErrorCode returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.error_code" semantic conventions. It represents the `error.code` +// property of response if it is an error response. +func RPCJSONRPCErrorCode(val int) attribute.KeyValue { + return RPCJSONRPCErrorCodeKey.Int(val) +} + +// RPCJSONRPCErrorMessage returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.error_message" semantic conventions. It represents the +// `error.message` property of response if it is an error response. +func RPCJSONRPCErrorMessage(val string) attribute.KeyValue { + return RPCJSONRPCErrorMessageKey.String(val) +} + +// RPCJSONRPCRequestID returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.request_id" semantic conventions. It represents the `id` property +// of request or response. Since protocol allows id to be int, string, `null` or +// missing (for notifications), value is expected to be cast to string for +// simplicity. Use empty string in case of `null` value. Omit entirely if this is +// a notification. +func RPCJSONRPCRequestID(val string) attribute.KeyValue { + return RPCJSONRPCRequestIDKey.String(val) +} + +// RPCJSONRPCVersion returns an attribute KeyValue conforming to the +// "rpc.jsonrpc.version" semantic conventions. It represents the protocol version +// as in `jsonrpc` property of request/response. Since JSON-RPC 1.0 doesn't +// specify this, the value can be omitted. +func RPCJSONRPCVersion(val string) attribute.KeyValue { + return RPCJSONRPCVersionKey.String(val) +} + +// RPCMessageCompressedSize returns an attribute KeyValue conforming to the +// "rpc.message.compressed_size" semantic conventions. It represents the +// compressed size of the message in bytes. +func RPCMessageCompressedSize(val int) attribute.KeyValue { + return RPCMessageCompressedSizeKey.Int(val) +} + +// RPCMessageID returns an attribute KeyValue conforming to the "rpc.message.id" +// semantic conventions. It MUST be calculated as two different counters starting +// from `1` one for sent messages and one for received message.. +func RPCMessageID(val int) attribute.KeyValue { + return RPCMessageIDKey.Int(val) +} + +// RPCMessageUncompressedSize returns an attribute KeyValue conforming to the +// "rpc.message.uncompressed_size" semantic conventions. It represents the +// uncompressed size of the message in bytes. +func RPCMessageUncompressedSize(val int) attribute.KeyValue { + return RPCMessageUncompressedSizeKey.Int(val) +} + +// RPCMethod returns an attribute KeyValue conforming to the "rpc.method" +// semantic conventions. It represents the name of the (logical) method being +// called, must be equal to the $method part in the span name. +func RPCMethod(val string) attribute.KeyValue { + return RPCMethodKey.String(val) +} + +// RPCService returns an attribute KeyValue conforming to the "rpc.service" +// semantic conventions. It represents the full (logical) name of the service +// being called, including its package name, if applicable. +func RPCService(val string) attribute.KeyValue { + return RPCServiceKey.String(val) +} + +// Enum values for rpc.connect_rpc.error_code +var ( + // cancelled + // Stability: development + RPCConnectRPCErrorCodeCancelled = RPCConnectRPCErrorCodeKey.String("cancelled") + // unknown + // Stability: development + RPCConnectRPCErrorCodeUnknown = RPCConnectRPCErrorCodeKey.String("unknown") + // invalid_argument + // Stability: development + RPCConnectRPCErrorCodeInvalidArgument = RPCConnectRPCErrorCodeKey.String("invalid_argument") + // deadline_exceeded + // Stability: development + RPCConnectRPCErrorCodeDeadlineExceeded = RPCConnectRPCErrorCodeKey.String("deadline_exceeded") + // not_found + // Stability: development + RPCConnectRPCErrorCodeNotFound = RPCConnectRPCErrorCodeKey.String("not_found") + // already_exists + // Stability: development + RPCConnectRPCErrorCodeAlreadyExists = RPCConnectRPCErrorCodeKey.String("already_exists") + // permission_denied + // Stability: development + RPCConnectRPCErrorCodePermissionDenied = RPCConnectRPCErrorCodeKey.String("permission_denied") + // resource_exhausted + // Stability: development + RPCConnectRPCErrorCodeResourceExhausted = RPCConnectRPCErrorCodeKey.String("resource_exhausted") + // failed_precondition + // Stability: development + RPCConnectRPCErrorCodeFailedPrecondition = RPCConnectRPCErrorCodeKey.String("failed_precondition") + // aborted + // Stability: development + RPCConnectRPCErrorCodeAborted = RPCConnectRPCErrorCodeKey.String("aborted") + // out_of_range + // Stability: development + RPCConnectRPCErrorCodeOutOfRange = RPCConnectRPCErrorCodeKey.String("out_of_range") + // unimplemented + // Stability: development + RPCConnectRPCErrorCodeUnimplemented = RPCConnectRPCErrorCodeKey.String("unimplemented") + // internal + // Stability: development + RPCConnectRPCErrorCodeInternal = RPCConnectRPCErrorCodeKey.String("internal") + // unavailable + // Stability: development + RPCConnectRPCErrorCodeUnavailable = RPCConnectRPCErrorCodeKey.String("unavailable") + // data_loss + // Stability: development + RPCConnectRPCErrorCodeDataLoss = RPCConnectRPCErrorCodeKey.String("data_loss") + // unauthenticated + // Stability: development + RPCConnectRPCErrorCodeUnauthenticated = RPCConnectRPCErrorCodeKey.String("unauthenticated") +) + +// Enum values for rpc.grpc.status_code +var ( + // OK + // Stability: development + RPCGRPCStatusCodeOk = RPCGRPCStatusCodeKey.Int(0) + // CANCELLED + // Stability: development + RPCGRPCStatusCodeCancelled = RPCGRPCStatusCodeKey.Int(1) + // UNKNOWN + // Stability: development + RPCGRPCStatusCodeUnknown = RPCGRPCStatusCodeKey.Int(2) + // INVALID_ARGUMENT + // Stability: development + RPCGRPCStatusCodeInvalidArgument = RPCGRPCStatusCodeKey.Int(3) + // DEADLINE_EXCEEDED + // Stability: development + RPCGRPCStatusCodeDeadlineExceeded = RPCGRPCStatusCodeKey.Int(4) + // NOT_FOUND + // Stability: development + RPCGRPCStatusCodeNotFound = RPCGRPCStatusCodeKey.Int(5) + // ALREADY_EXISTS + // Stability: development + RPCGRPCStatusCodeAlreadyExists = RPCGRPCStatusCodeKey.Int(6) + // PERMISSION_DENIED + // Stability: development + RPCGRPCStatusCodePermissionDenied = RPCGRPCStatusCodeKey.Int(7) + // RESOURCE_EXHAUSTED + // Stability: development + RPCGRPCStatusCodeResourceExhausted = RPCGRPCStatusCodeKey.Int(8) + // FAILED_PRECONDITION + // Stability: development + RPCGRPCStatusCodeFailedPrecondition = RPCGRPCStatusCodeKey.Int(9) + // ABORTED + // Stability: development + RPCGRPCStatusCodeAborted = RPCGRPCStatusCodeKey.Int(10) + // OUT_OF_RANGE + // Stability: development + RPCGRPCStatusCodeOutOfRange = RPCGRPCStatusCodeKey.Int(11) + // UNIMPLEMENTED + // Stability: development + RPCGRPCStatusCodeUnimplemented = RPCGRPCStatusCodeKey.Int(12) + // INTERNAL + // Stability: development + RPCGRPCStatusCodeInternal = RPCGRPCStatusCodeKey.Int(13) + // UNAVAILABLE + // Stability: development + RPCGRPCStatusCodeUnavailable = RPCGRPCStatusCodeKey.Int(14) + // DATA_LOSS + // Stability: development + RPCGRPCStatusCodeDataLoss = RPCGRPCStatusCodeKey.Int(15) + // UNAUTHENTICATED + // Stability: development + RPCGRPCStatusCodeUnauthenticated = RPCGRPCStatusCodeKey.Int(16) +) + +// Enum values for rpc.message.type +var ( + // sent + // Stability: development + RPCMessageTypeSent = RPCMessageTypeKey.String("SENT") + // received + // Stability: development + RPCMessageTypeReceived = RPCMessageTypeKey.String("RECEIVED") +) + +// Enum values for rpc.system +var ( + // gRPC + // Stability: development + RPCSystemGRPC = RPCSystemKey.String("grpc") + // Java RMI + // Stability: development + RPCSystemJavaRmi = RPCSystemKey.String("java_rmi") + // .NET WCF + // Stability: development + RPCSystemDotnetWcf = RPCSystemKey.String("dotnet_wcf") + // Apache Dubbo + // Stability: development + RPCSystemApacheDubbo = RPCSystemKey.String("apache_dubbo") + // Connect RPC + // Stability: development + RPCSystemConnectRPC = RPCSystemKey.String("connect_rpc") +) + +// Namespace: security_rule +const ( + // SecurityRuleCategoryKey is the attribute Key conforming to the + // "security_rule.category" semantic conventions. It represents a categorization + // value keyword used by the entity using the rule for detection of this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Attempted Information Leak" + SecurityRuleCategoryKey = attribute.Key("security_rule.category") + + // SecurityRuleDescriptionKey is the attribute Key conforming to the + // "security_rule.description" semantic conventions. It represents the + // description of the rule generating the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Block requests to public DNS over HTTPS / TLS protocols" + SecurityRuleDescriptionKey = attribute.Key("security_rule.description") + + // SecurityRuleLicenseKey is the attribute Key conforming to the + // "security_rule.license" semantic conventions. It represents the name of the + // license under which the rule used to generate this event is made available. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Apache 2.0" + SecurityRuleLicenseKey = attribute.Key("security_rule.license") + + // SecurityRuleNameKey is the attribute Key conforming to the + // "security_rule.name" semantic conventions. It represents the name of the rule + // or signature generating the event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "BLOCK_DNS_over_TLS" + SecurityRuleNameKey = attribute.Key("security_rule.name") + + // SecurityRuleReferenceKey is the attribute Key conforming to the + // "security_rule.reference" semantic conventions. It represents the reference + // URL to additional information about the rule used to generate this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://en.wikipedia.org/wiki/DNS_over_TLS" + // Note: The URL can point to the vendor’s documentation about the rule. If + // that’s not available, it can also be a link to a more general page + // describing this type of alert. + SecurityRuleReferenceKey = attribute.Key("security_rule.reference") + + // SecurityRuleRulesetNameKey is the attribute Key conforming to the + // "security_rule.ruleset.name" semantic conventions. It represents the name of + // the ruleset, policy, group, or parent category in which the rule used to + // generate this event is a member. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Standard_Protocol_Filters" + SecurityRuleRulesetNameKey = attribute.Key("security_rule.ruleset.name") + + // SecurityRuleUUIDKey is the attribute Key conforming to the + // "security_rule.uuid" semantic conventions. It represents a rule ID that is + // unique within the scope of a set or group of agents, observers, or other + // entities using the rule for detection of this event. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "550e8400-e29b-41d4-a716-446655440000", "1100110011" + SecurityRuleUUIDKey = attribute.Key("security_rule.uuid") + + // SecurityRuleVersionKey is the attribute Key conforming to the + // "security_rule.version" semantic conventions. It represents the version / + // revision of the rule being used for analysis. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.0.0" + SecurityRuleVersionKey = attribute.Key("security_rule.version") +) + +// SecurityRuleCategory returns an attribute KeyValue conforming to the +// "security_rule.category" semantic conventions. It represents a categorization +// value keyword used by the entity using the rule for detection of this event. +func SecurityRuleCategory(val string) attribute.KeyValue { + return SecurityRuleCategoryKey.String(val) +} + +// SecurityRuleDescription returns an attribute KeyValue conforming to the +// "security_rule.description" semantic conventions. It represents the +// description of the rule generating the event. +func SecurityRuleDescription(val string) attribute.KeyValue { + return SecurityRuleDescriptionKey.String(val) +} + +// SecurityRuleLicense returns an attribute KeyValue conforming to the +// "security_rule.license" semantic conventions. It represents the name of the +// license under which the rule used to generate this event is made available. +func SecurityRuleLicense(val string) attribute.KeyValue { + return SecurityRuleLicenseKey.String(val) +} + +// SecurityRuleName returns an attribute KeyValue conforming to the +// "security_rule.name" semantic conventions. It represents the name of the rule +// or signature generating the event. +func SecurityRuleName(val string) attribute.KeyValue { + return SecurityRuleNameKey.String(val) +} + +// SecurityRuleReference returns an attribute KeyValue conforming to the +// "security_rule.reference" semantic conventions. It represents the reference +// URL to additional information about the rule used to generate this event. +func SecurityRuleReference(val string) attribute.KeyValue { + return SecurityRuleReferenceKey.String(val) +} + +// SecurityRuleRulesetName returns an attribute KeyValue conforming to the +// "security_rule.ruleset.name" semantic conventions. It represents the name of +// the ruleset, policy, group, or parent category in which the rule used to +// generate this event is a member. +func SecurityRuleRulesetName(val string) attribute.KeyValue { + return SecurityRuleRulesetNameKey.String(val) +} + +// SecurityRuleUUID returns an attribute KeyValue conforming to the +// "security_rule.uuid" semantic conventions. It represents a rule ID that is +// unique within the scope of a set or group of agents, observers, or other +// entities using the rule for detection of this event. +func SecurityRuleUUID(val string) attribute.KeyValue { + return SecurityRuleUUIDKey.String(val) +} + +// SecurityRuleVersion returns an attribute KeyValue conforming to the +// "security_rule.version" semantic conventions. It represents the version / +// revision of the rule being used for analysis. +func SecurityRuleVersion(val string) attribute.KeyValue { + return SecurityRuleVersionKey.String(val) +} + +// Namespace: server +const ( + // ServerAddressKey is the attribute Key conforming to the "server.address" + // semantic conventions. It represents the server domain name if available + // without reverse DNS lookup; otherwise, IP address or Unix domain socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the client side, and when communicating through an + // intermediary, `server.address` SHOULD represent the server address behind any + // intermediaries, for example proxies, if it's available. + ServerAddressKey = attribute.Key("server.address") + + // ServerPortKey is the attribute Key conforming to the "server.port" semantic + // conventions. It represents the server port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: 80, 8080, 443 + // Note: When observed from the client side, and when communicating through an + // intermediary, `server.port` SHOULD represent the server port behind any + // intermediaries, for example proxies, if it's available. + ServerPortKey = attribute.Key("server.port") +) + +// ServerAddress returns an attribute KeyValue conforming to the "server.address" +// semantic conventions. It represents the server domain name if available +// without reverse DNS lookup; otherwise, IP address or Unix domain socket name. +func ServerAddress(val string) attribute.KeyValue { + return ServerAddressKey.String(val) +} + +// ServerPort returns an attribute KeyValue conforming to the "server.port" +// semantic conventions. It represents the server port number. +func ServerPort(val int) attribute.KeyValue { + return ServerPortKey.Int(val) +} + +// Namespace: service +const ( + // ServiceInstanceIDKey is the attribute Key conforming to the + // "service.instance.id" semantic conventions. It represents the string ID of + // the service instance. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "627cc493-f310-47de-96bd-71410b7dec09" + // Note: MUST be unique for each instance of the same + // `service.namespace,service.name` pair (in other words + // `service.namespace,service.name,service.instance.id` triplet MUST be globally + // unique). The ID helps to + // distinguish instances of the same service that exist at the same time (e.g. + // instances of a horizontally scaled + // service). + // + // Implementations, such as SDKs, are recommended to generate a random Version 1 + // or Version 4 [RFC + // 4122] UUID, but are free to use an inherent unique ID as + // the source of + // this value if stability is desirable. In that case, the ID SHOULD be used as + // source of a UUID Version 5 and + // SHOULD use the following UUID as the namespace: + // `4d63009a-8d0f-11ee-aad7-4c796ed8e320`. + // + // UUIDs are typically recommended, as only an opaque value for the purposes of + // identifying a service instance is + // needed. Similar to what can be seen in the man page for the + // [`/etc/machine-id`] file, the underlying + // data, such as pod name and namespace should be treated as confidential, being + // the user's choice to expose it + // or not via another resource attribute. + // + // For applications running behind an application server (like unicorn), we do + // not recommend using one identifier + // for all processes participating in the application. Instead, it's recommended + // each division (e.g. a worker + // thread in unicorn) to have its own instance.id. + // + // It's not recommended for a Collector to set `service.instance.id` if it can't + // unambiguously determine the + // service instance that is generating that telemetry. For instance, creating an + // UUID based on `pod.name` will + // likely be wrong, as the Collector might not know from which container within + // that pod the telemetry originated. + // However, Collectors can set the `service.instance.id` if they can + // unambiguously determine the service instance + // for that telemetry. This is typically the case for scraping receivers, as + // they know the target address and + // port. + // + // [RFC + // 4122]: https://www.ietf.org/rfc/rfc4122.txt + // [`/etc/machine-id`]: https://www.freedesktop.org/software/systemd/man/latest/machine-id.html + ServiceInstanceIDKey = attribute.Key("service.instance.id") + + // ServiceNameKey is the attribute Key conforming to the "service.name" semantic + // conventions. It represents the logical name of the service. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "shoppingcart" + // Note: MUST be the same for all instances of horizontally scaled services. If + // the value was not specified, SDKs MUST fallback to `unknown_service:` + // concatenated with [`process.executable.name`], e.g. `unknown_service:bash`. + // If `process.executable.name` is not available, the value MUST be set to + // `unknown_service`. + // + // [`process.executable.name`]: process.md + ServiceNameKey = attribute.Key("service.name") + + // ServiceNamespaceKey is the attribute Key conforming to the + // "service.namespace" semantic conventions. It represents a namespace for + // `service.name`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Shop" + // Note: A string value having a meaning that helps to distinguish a group of + // services, for example the team name that owns a group of services. + // `service.name` is expected to be unique within the same namespace. If + // `service.namespace` is not specified in the Resource then `service.name` is + // expected to be unique for all services that have no explicit namespace + // defined (so the empty/unspecified namespace is simply one more valid + // namespace). Zero-length namespace string is assumed equal to unspecified + // namespace. + ServiceNamespaceKey = attribute.Key("service.namespace") + + // ServiceVersionKey is the attribute Key conforming to the "service.version" + // semantic conventions. It represents the version string of the service API or + // implementation. The format is not defined by these conventions. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "2.0.0", "a01dbef8a" + ServiceVersionKey = attribute.Key("service.version") +) + +// ServiceInstanceID returns an attribute KeyValue conforming to the +// "service.instance.id" semantic conventions. It represents the string ID of the +// service instance. +func ServiceInstanceID(val string) attribute.KeyValue { + return ServiceInstanceIDKey.String(val) +} + +// ServiceName returns an attribute KeyValue conforming to the "service.name" +// semantic conventions. It represents the logical name of the service. +func ServiceName(val string) attribute.KeyValue { + return ServiceNameKey.String(val) +} + +// ServiceNamespace returns an attribute KeyValue conforming to the +// "service.namespace" semantic conventions. It represents a namespace for +// `service.name`. +func ServiceNamespace(val string) attribute.KeyValue { + return ServiceNamespaceKey.String(val) +} + +// ServiceVersion returns an attribute KeyValue conforming to the +// "service.version" semantic conventions. It represents the version string of +// the service API or implementation. The format is not defined by these +// conventions. +func ServiceVersion(val string) attribute.KeyValue { + return ServiceVersionKey.String(val) +} + +// Namespace: session +const ( + // SessionIDKey is the attribute Key conforming to the "session.id" semantic + // conventions. It represents a unique id to identify a session. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 00112233-4455-6677-8899-aabbccddeeff + SessionIDKey = attribute.Key("session.id") + + // SessionPreviousIDKey is the attribute Key conforming to the + // "session.previous_id" semantic conventions. It represents the previous + // `session.id` for this user, when known. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 00112233-4455-6677-8899-aabbccddeeff + SessionPreviousIDKey = attribute.Key("session.previous_id") +) + +// SessionID returns an attribute KeyValue conforming to the "session.id" +// semantic conventions. It represents a unique id to identify a session. +func SessionID(val string) attribute.KeyValue { + return SessionIDKey.String(val) +} + +// SessionPreviousID returns an attribute KeyValue conforming to the +// "session.previous_id" semantic conventions. It represents the previous +// `session.id` for this user, when known. +func SessionPreviousID(val string) attribute.KeyValue { + return SessionPreviousIDKey.String(val) +} + +// Namespace: signalr +const ( + // SignalRConnectionStatusKey is the attribute Key conforming to the + // "signalr.connection.status" semantic conventions. It represents the signalR + // HTTP connection closure status. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "app_shutdown", "timeout" + SignalRConnectionStatusKey = attribute.Key("signalr.connection.status") + + // SignalRTransportKey is the attribute Key conforming to the + // "signalr.transport" semantic conventions. It represents the + // [SignalR transport type]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "web_sockets", "long_polling" + // + // [SignalR transport type]: https://github.com/dotnet/aspnetcore/blob/main/src/SignalR/docs/specs/TransportProtocols.md + SignalRTransportKey = attribute.Key("signalr.transport") +) + +// Enum values for signalr.connection.status +var ( + // The connection was closed normally. + // Stability: stable + SignalRConnectionStatusNormalClosure = SignalRConnectionStatusKey.String("normal_closure") + // The connection was closed due to a timeout. + // Stability: stable + SignalRConnectionStatusTimeout = SignalRConnectionStatusKey.String("timeout") + // The connection was closed because the app is shutting down. + // Stability: stable + SignalRConnectionStatusAppShutdown = SignalRConnectionStatusKey.String("app_shutdown") +) + +// Enum values for signalr.transport +var ( + // ServerSentEvents protocol + // Stability: stable + SignalRTransportServerSentEvents = SignalRTransportKey.String("server_sent_events") + // LongPolling protocol + // Stability: stable + SignalRTransportLongPolling = SignalRTransportKey.String("long_polling") + // WebSockets protocol + // Stability: stable + SignalRTransportWebSockets = SignalRTransportKey.String("web_sockets") +) + +// Namespace: source +const ( + // SourceAddressKey is the attribute Key conforming to the "source.address" + // semantic conventions. It represents the source address - domain name if + // available without reverse DNS lookup; otherwise, IP address or Unix domain + // socket name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "source.example.com", "10.1.2.80", "/tmp/my.sock" + // Note: When observed from the destination side, and when communicating through + // an intermediary, `source.address` SHOULD represent the source address behind + // any intermediaries, for example proxies, if it's available. + SourceAddressKey = attribute.Key("source.address") + + // SourcePortKey is the attribute Key conforming to the "source.port" semantic + // conventions. It represents the source port number. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 3389, 2888 + SourcePortKey = attribute.Key("source.port") +) + +// SourceAddress returns an attribute KeyValue conforming to the "source.address" +// semantic conventions. It represents the source address - domain name if +// available without reverse DNS lookup; otherwise, IP address or Unix domain +// socket name. +func SourceAddress(val string) attribute.KeyValue { + return SourceAddressKey.String(val) +} + +// SourcePort returns an attribute KeyValue conforming to the "source.port" +// semantic conventions. It represents the source port number. +func SourcePort(val int) attribute.KeyValue { + return SourcePortKey.Int(val) +} + +// Namespace: system +const ( + // SystemCPULogicalNumberKey is the attribute Key conforming to the + // "system.cpu.logical_number" semantic conventions. It represents the + // deprecated, use `cpu.logical_number` instead. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 1 + SystemCPULogicalNumberKey = attribute.Key("system.cpu.logical_number") + + // SystemDeviceKey is the attribute Key conforming to the "system.device" + // semantic conventions. It represents the device identifier. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "(identifier)" + SystemDeviceKey = attribute.Key("system.device") + + // SystemFilesystemModeKey is the attribute Key conforming to the + // "system.filesystem.mode" semantic conventions. It represents the filesystem + // mode. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "rw, ro" + SystemFilesystemModeKey = attribute.Key("system.filesystem.mode") + + // SystemFilesystemMountpointKey is the attribute Key conforming to the + // "system.filesystem.mountpoint" semantic conventions. It represents the + // filesystem mount path. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/mnt/data" + SystemFilesystemMountpointKey = attribute.Key("system.filesystem.mountpoint") + + // SystemFilesystemStateKey is the attribute Key conforming to the + // "system.filesystem.state" semantic conventions. It represents the filesystem + // state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "used" + SystemFilesystemStateKey = attribute.Key("system.filesystem.state") + + // SystemFilesystemTypeKey is the attribute Key conforming to the + // "system.filesystem.type" semantic conventions. It represents the filesystem + // type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ext4" + SystemFilesystemTypeKey = attribute.Key("system.filesystem.type") + + // SystemMemoryStateKey is the attribute Key conforming to the + // "system.memory.state" semantic conventions. It represents the memory state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "free", "cached" + SystemMemoryStateKey = attribute.Key("system.memory.state") + + // SystemPagingDirectionKey is the attribute Key conforming to the + // "system.paging.direction" semantic conventions. It represents the paging + // access direction. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "in" + SystemPagingDirectionKey = attribute.Key("system.paging.direction") + + // SystemPagingStateKey is the attribute Key conforming to the + // "system.paging.state" semantic conventions. It represents the memory paging + // state. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "free" + SystemPagingStateKey = attribute.Key("system.paging.state") + + // SystemPagingTypeKey is the attribute Key conforming to the + // "system.paging.type" semantic conventions. It represents the memory paging + // type. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "minor" + SystemPagingTypeKey = attribute.Key("system.paging.type") + + // SystemProcessStatusKey is the attribute Key conforming to the + // "system.process.status" semantic conventions. It represents the process + // state, e.g., [Linux Process State Codes]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "running" + // + // [Linux Process State Codes]: https://man7.org/linux/man-pages/man1/ps.1.html#PROCESS_STATE_CODES + SystemProcessStatusKey = attribute.Key("system.process.status") +) + +// SystemCPULogicalNumber returns an attribute KeyValue conforming to the +// "system.cpu.logical_number" semantic conventions. It represents the +// deprecated, use `cpu.logical_number` instead. +func SystemCPULogicalNumber(val int) attribute.KeyValue { + return SystemCPULogicalNumberKey.Int(val) +} + +// SystemDevice returns an attribute KeyValue conforming to the "system.device" +// semantic conventions. It represents the device identifier. +func SystemDevice(val string) attribute.KeyValue { + return SystemDeviceKey.String(val) +} + +// SystemFilesystemMode returns an attribute KeyValue conforming to the +// "system.filesystem.mode" semantic conventions. It represents the filesystem +// mode. +func SystemFilesystemMode(val string) attribute.KeyValue { + return SystemFilesystemModeKey.String(val) +} + +// SystemFilesystemMountpoint returns an attribute KeyValue conforming to the +// "system.filesystem.mountpoint" semantic conventions. It represents the +// filesystem mount path. +func SystemFilesystemMountpoint(val string) attribute.KeyValue { + return SystemFilesystemMountpointKey.String(val) +} + +// Enum values for system.filesystem.state +var ( + // used + // Stability: development + SystemFilesystemStateUsed = SystemFilesystemStateKey.String("used") + // free + // Stability: development + SystemFilesystemStateFree = SystemFilesystemStateKey.String("free") + // reserved + // Stability: development + SystemFilesystemStateReserved = SystemFilesystemStateKey.String("reserved") +) + +// Enum values for system.filesystem.type +var ( + // fat32 + // Stability: development + SystemFilesystemTypeFat32 = SystemFilesystemTypeKey.String("fat32") + // exfat + // Stability: development + SystemFilesystemTypeExfat = SystemFilesystemTypeKey.String("exfat") + // ntfs + // Stability: development + SystemFilesystemTypeNtfs = SystemFilesystemTypeKey.String("ntfs") + // refs + // Stability: development + SystemFilesystemTypeRefs = SystemFilesystemTypeKey.String("refs") + // hfsplus + // Stability: development + SystemFilesystemTypeHfsplus = SystemFilesystemTypeKey.String("hfsplus") + // ext4 + // Stability: development + SystemFilesystemTypeExt4 = SystemFilesystemTypeKey.String("ext4") +) + +// Enum values for system.memory.state +var ( + // used + // Stability: development + SystemMemoryStateUsed = SystemMemoryStateKey.String("used") + // free + // Stability: development + SystemMemoryStateFree = SystemMemoryStateKey.String("free") + // Deprecated: Removed, report shared memory usage with + // `metric.system.memory.shared` metric. + SystemMemoryStateShared = SystemMemoryStateKey.String("shared") + // buffers + // Stability: development + SystemMemoryStateBuffers = SystemMemoryStateKey.String("buffers") + // cached + // Stability: development + SystemMemoryStateCached = SystemMemoryStateKey.String("cached") +) + +// Enum values for system.paging.direction +var ( + // in + // Stability: development + SystemPagingDirectionIn = SystemPagingDirectionKey.String("in") + // out + // Stability: development + SystemPagingDirectionOut = SystemPagingDirectionKey.String("out") +) + +// Enum values for system.paging.state +var ( + // used + // Stability: development + SystemPagingStateUsed = SystemPagingStateKey.String("used") + // free + // Stability: development + SystemPagingStateFree = SystemPagingStateKey.String("free") +) + +// Enum values for system.paging.type +var ( + // major + // Stability: development + SystemPagingTypeMajor = SystemPagingTypeKey.String("major") + // minor + // Stability: development + SystemPagingTypeMinor = SystemPagingTypeKey.String("minor") +) + +// Enum values for system.process.status +var ( + // running + // Stability: development + SystemProcessStatusRunning = SystemProcessStatusKey.String("running") + // sleeping + // Stability: development + SystemProcessStatusSleeping = SystemProcessStatusKey.String("sleeping") + // stopped + // Stability: development + SystemProcessStatusStopped = SystemProcessStatusKey.String("stopped") + // defunct + // Stability: development + SystemProcessStatusDefunct = SystemProcessStatusKey.String("defunct") +) + +// Namespace: telemetry +const ( + // TelemetryDistroNameKey is the attribute Key conforming to the + // "telemetry.distro.name" semantic conventions. It represents the name of the + // auto instrumentation agent or distribution, if used. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "parts-unlimited-java" + // Note: Official auto instrumentation agents and distributions SHOULD set the + // `telemetry.distro.name` attribute to + // a string starting with `opentelemetry-`, e.g. + // `opentelemetry-java-instrumentation`. + TelemetryDistroNameKey = attribute.Key("telemetry.distro.name") + + // TelemetryDistroVersionKey is the attribute Key conforming to the + // "telemetry.distro.version" semantic conventions. It represents the version + // string of the auto instrumentation agent or distribution, if used. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.2.3" + TelemetryDistroVersionKey = attribute.Key("telemetry.distro.version") + + // TelemetrySDKLanguageKey is the attribute Key conforming to the + // "telemetry.sdk.language" semantic conventions. It represents the language of + // the telemetry SDK. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: + TelemetrySDKLanguageKey = attribute.Key("telemetry.sdk.language") + + // TelemetrySDKNameKey is the attribute Key conforming to the + // "telemetry.sdk.name" semantic conventions. It represents the name of the + // telemetry SDK as defined above. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "opentelemetry" + // Note: The OpenTelemetry SDK MUST set the `telemetry.sdk.name` attribute to + // `opentelemetry`. + // If another SDK, like a fork or a vendor-provided implementation, is used, + // this SDK MUST set the + // `telemetry.sdk.name` attribute to the fully-qualified class or module name of + // this SDK's main entry point + // or another suitable identifier depending on the language. + // The identifier `opentelemetry` is reserved and MUST NOT be used in this case. + // All custom identifiers SHOULD be stable across different versions of an + // implementation. + TelemetrySDKNameKey = attribute.Key("telemetry.sdk.name") + + // TelemetrySDKVersionKey is the attribute Key conforming to the + // "telemetry.sdk.version" semantic conventions. It represents the version + // string of the telemetry SDK. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "1.2.3" + TelemetrySDKVersionKey = attribute.Key("telemetry.sdk.version") +) + +// TelemetryDistroName returns an attribute KeyValue conforming to the +// "telemetry.distro.name" semantic conventions. It represents the name of the +// auto instrumentation agent or distribution, if used. +func TelemetryDistroName(val string) attribute.KeyValue { + return TelemetryDistroNameKey.String(val) +} + +// TelemetryDistroVersion returns an attribute KeyValue conforming to the +// "telemetry.distro.version" semantic conventions. It represents the version +// string of the auto instrumentation agent or distribution, if used. +func TelemetryDistroVersion(val string) attribute.KeyValue { + return TelemetryDistroVersionKey.String(val) +} + +// TelemetrySDKName returns an attribute KeyValue conforming to the +// "telemetry.sdk.name" semantic conventions. It represents the name of the +// telemetry SDK as defined above. +func TelemetrySDKName(val string) attribute.KeyValue { + return TelemetrySDKNameKey.String(val) +} + +// TelemetrySDKVersion returns an attribute KeyValue conforming to the +// "telemetry.sdk.version" semantic conventions. It represents the version string +// of the telemetry SDK. +func TelemetrySDKVersion(val string) attribute.KeyValue { + return TelemetrySDKVersionKey.String(val) +} + +// Enum values for telemetry.sdk.language +var ( + // cpp + // Stability: stable + TelemetrySDKLanguageCPP = TelemetrySDKLanguageKey.String("cpp") + // dotnet + // Stability: stable + TelemetrySDKLanguageDotnet = TelemetrySDKLanguageKey.String("dotnet") + // erlang + // Stability: stable + TelemetrySDKLanguageErlang = TelemetrySDKLanguageKey.String("erlang") + // go + // Stability: stable + TelemetrySDKLanguageGo = TelemetrySDKLanguageKey.String("go") + // java + // Stability: stable + TelemetrySDKLanguageJava = TelemetrySDKLanguageKey.String("java") + // nodejs + // Stability: stable + TelemetrySDKLanguageNodejs = TelemetrySDKLanguageKey.String("nodejs") + // php + // Stability: stable + TelemetrySDKLanguagePHP = TelemetrySDKLanguageKey.String("php") + // python + // Stability: stable + TelemetrySDKLanguagePython = TelemetrySDKLanguageKey.String("python") + // ruby + // Stability: stable + TelemetrySDKLanguageRuby = TelemetrySDKLanguageKey.String("ruby") + // rust + // Stability: stable + TelemetrySDKLanguageRust = TelemetrySDKLanguageKey.String("rust") + // swift + // Stability: stable + TelemetrySDKLanguageSwift = TelemetrySDKLanguageKey.String("swift") + // webjs + // Stability: stable + TelemetrySDKLanguageWebJS = TelemetrySDKLanguageKey.String("webjs") +) + +// Namespace: test +const ( + // TestCaseNameKey is the attribute Key conforming to the "test.case.name" + // semantic conventions. It represents the fully qualified human readable name + // of the [test case]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "org.example.TestCase1.test1", "example/tests/TestCase1.test1", + // "ExampleTestCase1_test1" + // + // [test case]: https://wikipedia.org/wiki/Test_case + TestCaseNameKey = attribute.Key("test.case.name") + + // TestCaseResultStatusKey is the attribute Key conforming to the + // "test.case.result.status" semantic conventions. It represents the status of + // the actual test case result from test execution. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "pass", "fail" + TestCaseResultStatusKey = attribute.Key("test.case.result.status") + + // TestSuiteNameKey is the attribute Key conforming to the "test.suite.name" + // semantic conventions. It represents the human readable name of a [test suite] + // . + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TestSuite1" + // + // [test suite]: https://wikipedia.org/wiki/Test_suite + TestSuiteNameKey = attribute.Key("test.suite.name") + + // TestSuiteRunStatusKey is the attribute Key conforming to the + // "test.suite.run.status" semantic conventions. It represents the status of the + // test suite run. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "success", "failure", "skipped", "aborted", "timed_out", + // "in_progress" + TestSuiteRunStatusKey = attribute.Key("test.suite.run.status") +) + +// TestCaseName returns an attribute KeyValue conforming to the "test.case.name" +// semantic conventions. It represents the fully qualified human readable name of +// the [test case]. +// +// [test case]: https://wikipedia.org/wiki/Test_case +func TestCaseName(val string) attribute.KeyValue { + return TestCaseNameKey.String(val) +} + +// TestSuiteName returns an attribute KeyValue conforming to the +// "test.suite.name" semantic conventions. It represents the human readable name +// of a [test suite]. +// +// [test suite]: https://wikipedia.org/wiki/Test_suite +func TestSuiteName(val string) attribute.KeyValue { + return TestSuiteNameKey.String(val) +} + +// Enum values for test.case.result.status +var ( + // pass + // Stability: development + TestCaseResultStatusPass = TestCaseResultStatusKey.String("pass") + // fail + // Stability: development + TestCaseResultStatusFail = TestCaseResultStatusKey.String("fail") +) + +// Enum values for test.suite.run.status +var ( + // success + // Stability: development + TestSuiteRunStatusSuccess = TestSuiteRunStatusKey.String("success") + // failure + // Stability: development + TestSuiteRunStatusFailure = TestSuiteRunStatusKey.String("failure") + // skipped + // Stability: development + TestSuiteRunStatusSkipped = TestSuiteRunStatusKey.String("skipped") + // aborted + // Stability: development + TestSuiteRunStatusAborted = TestSuiteRunStatusKey.String("aborted") + // timed_out + // Stability: development + TestSuiteRunStatusTimedOut = TestSuiteRunStatusKey.String("timed_out") + // in_progress + // Stability: development + TestSuiteRunStatusInProgress = TestSuiteRunStatusKey.String("in_progress") +) + +// Namespace: thread +const ( + // ThreadIDKey is the attribute Key conforming to the "thread.id" semantic + // conventions. It represents the current "managed" thread ID (as opposed to OS + // thread ID). + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + ThreadIDKey = attribute.Key("thread.id") + + // ThreadNameKey is the attribute Key conforming to the "thread.name" semantic + // conventions. It represents the current thread name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: main + ThreadNameKey = attribute.Key("thread.name") +) + +// ThreadID returns an attribute KeyValue conforming to the "thread.id" semantic +// conventions. It represents the current "managed" thread ID (as opposed to OS +// thread ID). +func ThreadID(val int) attribute.KeyValue { + return ThreadIDKey.Int(val) +} + +// ThreadName returns an attribute KeyValue conforming to the "thread.name" +// semantic conventions. It represents the current thread name. +func ThreadName(val string) attribute.KeyValue { + return ThreadNameKey.String(val) +} + +// Namespace: tls +const ( + // TLSCipherKey is the attribute Key conforming to the "tls.cipher" semantic + // conventions. It represents the string indicating the [cipher] used during the + // current connection. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TLS_RSA_WITH_3DES_EDE_CBC_SHA", + // "TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256" + // Note: The values allowed for `tls.cipher` MUST be one of the `Descriptions` + // of the [registered TLS Cipher Suits]. + // + // [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5 + // [registered TLS Cipher Suits]: https://www.iana.org/assignments/tls-parameters/tls-parameters.xhtml#table-tls-parameters-4 + TLSCipherKey = attribute.Key("tls.cipher") + + // TLSClientCertificateKey is the attribute Key conforming to the + // "tls.client.certificate" semantic conventions. It represents the PEM-encoded + // stand-alone certificate offered by the client. This is usually + // mutually-exclusive of `client.certificate_chain` since this value also exists + // in that list. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII..." + TLSClientCertificateKey = attribute.Key("tls.client.certificate") + + // TLSClientCertificateChainKey is the attribute Key conforming to the + // "tls.client.certificate_chain" semantic conventions. It represents the array + // of PEM-encoded certificates that make up the certificate chain offered by the + // client. This is usually mutually-exclusive of `client.certificate` since that + // value should be the first certificate in the chain. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII...", "MI..." + TLSClientCertificateChainKey = attribute.Key("tls.client.certificate_chain") + + // TLSClientHashMd5Key is the attribute Key conforming to the + // "tls.client.hash.md5" semantic conventions. It represents the certificate + // fingerprint using the MD5 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC" + TLSClientHashMd5Key = attribute.Key("tls.client.hash.md5") + + // TLSClientHashSha1Key is the attribute Key conforming to the + // "tls.client.hash.sha1" semantic conventions. It represents the certificate + // fingerprint using the SHA1 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A" + TLSClientHashSha1Key = attribute.Key("tls.client.hash.sha1") + + // TLSClientHashSha256Key is the attribute Key conforming to the + // "tls.client.hash.sha256" semantic conventions. It represents the certificate + // fingerprint using the SHA256 digest of DER-encoded version of certificate + // offered by the client. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0" + TLSClientHashSha256Key = attribute.Key("tls.client.hash.sha256") + + // TLSClientIssuerKey is the attribute Key conforming to the "tls.client.issuer" + // semantic conventions. It represents the distinguished name of [subject] of + // the issuer of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com" + // + // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 + TLSClientIssuerKey = attribute.Key("tls.client.issuer") + + // TLSClientJa3Key is the attribute Key conforming to the "tls.client.ja3" + // semantic conventions. It represents a hash that identifies clients based on + // how they perform an SSL/TLS handshake. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "d4e5b18d6b55c71272893221c96ba240" + TLSClientJa3Key = attribute.Key("tls.client.ja3") + + // TLSClientNotAfterKey is the attribute Key conforming to the + // "tls.client.not_after" semantic conventions. It represents the date/Time + // indicating when client certificate is no longer considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T00:00:00.000Z" + TLSClientNotAfterKey = attribute.Key("tls.client.not_after") + + // TLSClientNotBeforeKey is the attribute Key conforming to the + // "tls.client.not_before" semantic conventions. It represents the date/Time + // indicating when client certificate is first considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1970-01-01T00:00:00.000Z" + TLSClientNotBeforeKey = attribute.Key("tls.client.not_before") + + // TLSClientSubjectKey is the attribute Key conforming to the + // "tls.client.subject" semantic conventions. It represents the distinguished + // name of subject of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=myclient, OU=Documentation Team, DC=example, DC=com" + TLSClientSubjectKey = attribute.Key("tls.client.subject") + + // TLSClientSupportedCiphersKey is the attribute Key conforming to the + // "tls.client.supported_ciphers" semantic conventions. It represents the array + // of ciphers offered by the client during the client hello. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384", + // "TLS_ECDHE_ECDSA_WITH_AES_256_GCM_SHA384" + TLSClientSupportedCiphersKey = attribute.Key("tls.client.supported_ciphers") + + // TLSCurveKey is the attribute Key conforming to the "tls.curve" semantic + // conventions. It represents the string indicating the curve used for the given + // cipher, when applicable. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "secp256r1" + TLSCurveKey = attribute.Key("tls.curve") + + // TLSEstablishedKey is the attribute Key conforming to the "tls.established" + // semantic conventions. It represents the boolean flag indicating if the TLS + // negotiation was successful and transitioned to an encrypted tunnel. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: true + TLSEstablishedKey = attribute.Key("tls.established") + + // TLSNextProtocolKey is the attribute Key conforming to the "tls.next_protocol" + // semantic conventions. It represents the string indicating the protocol being + // tunneled. Per the values in the [IANA registry], this string should be lower + // case. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "http/1.1" + // + // [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids + TLSNextProtocolKey = attribute.Key("tls.next_protocol") + + // TLSProtocolNameKey is the attribute Key conforming to the "tls.protocol.name" + // semantic conventions. It represents the normalized lowercase protocol name + // parsed from original string of the negotiated [SSL/TLS protocol version]. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // + // [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values + TLSProtocolNameKey = attribute.Key("tls.protocol.name") + + // TLSProtocolVersionKey is the attribute Key conforming to the + // "tls.protocol.version" semantic conventions. It represents the numeric part + // of the version parsed from the original string of the negotiated + // [SSL/TLS protocol version]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1.2", "3" + // + // [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values + TLSProtocolVersionKey = attribute.Key("tls.protocol.version") + + // TLSResumedKey is the attribute Key conforming to the "tls.resumed" semantic + // conventions. It represents the boolean flag indicating if this TLS connection + // was resumed from an existing TLS negotiation. + // + // Type: boolean + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: true + TLSResumedKey = attribute.Key("tls.resumed") + + // TLSServerCertificateKey is the attribute Key conforming to the + // "tls.server.certificate" semantic conventions. It represents the PEM-encoded + // stand-alone certificate offered by the server. This is usually + // mutually-exclusive of `server.certificate_chain` since this value also exists + // in that list. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII..." + TLSServerCertificateKey = attribute.Key("tls.server.certificate") + + // TLSServerCertificateChainKey is the attribute Key conforming to the + // "tls.server.certificate_chain" semantic conventions. It represents the array + // of PEM-encoded certificates that make up the certificate chain offered by the + // server. This is usually mutually-exclusive of `server.certificate` since that + // value should be the first certificate in the chain. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "MII...", "MI..." + TLSServerCertificateChainKey = attribute.Key("tls.server.certificate_chain") + + // TLSServerHashMd5Key is the attribute Key conforming to the + // "tls.server.hash.md5" semantic conventions. It represents the certificate + // fingerprint using the MD5 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0F76C7F2C55BFD7D8E8B8F4BFBF0C9EC" + TLSServerHashMd5Key = attribute.Key("tls.server.hash.md5") + + // TLSServerHashSha1Key is the attribute Key conforming to the + // "tls.server.hash.sha1" semantic conventions. It represents the certificate + // fingerprint using the SHA1 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9E393D93138888D288266C2D915214D1D1CCEB2A" + TLSServerHashSha1Key = attribute.Key("tls.server.hash.sha1") + + // TLSServerHashSha256Key is the attribute Key conforming to the + // "tls.server.hash.sha256" semantic conventions. It represents the certificate + // fingerprint using the SHA256 digest of DER-encoded version of certificate + // offered by the server. For consistency with other hash values, this value + // should be formatted as an uppercase hash. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "0687F666A054EF17A08E2F2162EAB4CBC0D265E1D7875BE74BF3C712CA92DAF0" + TLSServerHashSha256Key = attribute.Key("tls.server.hash.sha256") + + // TLSServerIssuerKey is the attribute Key conforming to the "tls.server.issuer" + // semantic conventions. It represents the distinguished name of [subject] of + // the issuer of the x.509 certificate presented by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=Example Root CA, OU=Infrastructure Team, DC=example, DC=com" + // + // [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 + TLSServerIssuerKey = attribute.Key("tls.server.issuer") + + // TLSServerJa3sKey is the attribute Key conforming to the "tls.server.ja3s" + // semantic conventions. It represents a hash that identifies servers based on + // how they perform an SSL/TLS handshake. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "d4e5b18d6b55c71272893221c96ba240" + TLSServerJa3sKey = attribute.Key("tls.server.ja3s") + + // TLSServerNotAfterKey is the attribute Key conforming to the + // "tls.server.not_after" semantic conventions. It represents the date/Time + // indicating when server certificate is no longer considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "2021-01-01T00:00:00.000Z" + TLSServerNotAfterKey = attribute.Key("tls.server.not_after") + + // TLSServerNotBeforeKey is the attribute Key conforming to the + // "tls.server.not_before" semantic conventions. It represents the date/Time + // indicating when server certificate is first considered valid. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "1970-01-01T00:00:00.000Z" + TLSServerNotBeforeKey = attribute.Key("tls.server.not_before") + + // TLSServerSubjectKey is the attribute Key conforming to the + // "tls.server.subject" semantic conventions. It represents the distinguished + // name of subject of the x.509 certificate presented by the server. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "CN=myserver, OU=Documentation Team, DC=example, DC=com" + TLSServerSubjectKey = attribute.Key("tls.server.subject") +) + +// TLSCipher returns an attribute KeyValue conforming to the "tls.cipher" +// semantic conventions. It represents the string indicating the [cipher] used +// during the current connection. +// +// [cipher]: https://datatracker.ietf.org/doc/html/rfc5246#appendix-A.5 +func TLSCipher(val string) attribute.KeyValue { + return TLSCipherKey.String(val) +} + +// TLSClientCertificate returns an attribute KeyValue conforming to the +// "tls.client.certificate" semantic conventions. It represents the PEM-encoded +// stand-alone certificate offered by the client. This is usually +// mutually-exclusive of `client.certificate_chain` since this value also exists +// in that list. +func TLSClientCertificate(val string) attribute.KeyValue { + return TLSClientCertificateKey.String(val) +} + +// TLSClientCertificateChain returns an attribute KeyValue conforming to the +// "tls.client.certificate_chain" semantic conventions. It represents the array +// of PEM-encoded certificates that make up the certificate chain offered by the +// client. This is usually mutually-exclusive of `client.certificate` since that +// value should be the first certificate in the chain. +func TLSClientCertificateChain(val ...string) attribute.KeyValue { + return TLSClientCertificateChainKey.StringSlice(val) +} + +// TLSClientHashMd5 returns an attribute KeyValue conforming to the +// "tls.client.hash.md5" semantic conventions. It represents the certificate +// fingerprint using the MD5 digest of DER-encoded version of certificate offered +// by the client. For consistency with other hash values, this value should be +// formatted as an uppercase hash. +func TLSClientHashMd5(val string) attribute.KeyValue { + return TLSClientHashMd5Key.String(val) +} + +// TLSClientHashSha1 returns an attribute KeyValue conforming to the +// "tls.client.hash.sha1" semantic conventions. It represents the certificate +// fingerprint using the SHA1 digest of DER-encoded version of certificate +// offered by the client. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSClientHashSha1(val string) attribute.KeyValue { + return TLSClientHashSha1Key.String(val) +} + +// TLSClientHashSha256 returns an attribute KeyValue conforming to the +// "tls.client.hash.sha256" semantic conventions. It represents the certificate +// fingerprint using the SHA256 digest of DER-encoded version of certificate +// offered by the client. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSClientHashSha256(val string) attribute.KeyValue { + return TLSClientHashSha256Key.String(val) +} + +// TLSClientIssuer returns an attribute KeyValue conforming to the +// "tls.client.issuer" semantic conventions. It represents the distinguished name +// of [subject] of the issuer of the x.509 certificate presented by the client. +// +// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 +func TLSClientIssuer(val string) attribute.KeyValue { + return TLSClientIssuerKey.String(val) +} + +// TLSClientJa3 returns an attribute KeyValue conforming to the "tls.client.ja3" +// semantic conventions. It represents a hash that identifies clients based on +// how they perform an SSL/TLS handshake. +func TLSClientJa3(val string) attribute.KeyValue { + return TLSClientJa3Key.String(val) +} + +// TLSClientNotAfter returns an attribute KeyValue conforming to the +// "tls.client.not_after" semantic conventions. It represents the date/Time +// indicating when client certificate is no longer considered valid. +func TLSClientNotAfter(val string) attribute.KeyValue { + return TLSClientNotAfterKey.String(val) +} + +// TLSClientNotBefore returns an attribute KeyValue conforming to the +// "tls.client.not_before" semantic conventions. It represents the date/Time +// indicating when client certificate is first considered valid. +func TLSClientNotBefore(val string) attribute.KeyValue { + return TLSClientNotBeforeKey.String(val) +} + +// TLSClientSubject returns an attribute KeyValue conforming to the +// "tls.client.subject" semantic conventions. It represents the distinguished +// name of subject of the x.509 certificate presented by the client. +func TLSClientSubject(val string) attribute.KeyValue { + return TLSClientSubjectKey.String(val) +} + +// TLSClientSupportedCiphers returns an attribute KeyValue conforming to the +// "tls.client.supported_ciphers" semantic conventions. It represents the array +// of ciphers offered by the client during the client hello. +func TLSClientSupportedCiphers(val ...string) attribute.KeyValue { + return TLSClientSupportedCiphersKey.StringSlice(val) +} + +// TLSCurve returns an attribute KeyValue conforming to the "tls.curve" semantic +// conventions. It represents the string indicating the curve used for the given +// cipher, when applicable. +func TLSCurve(val string) attribute.KeyValue { + return TLSCurveKey.String(val) +} + +// TLSEstablished returns an attribute KeyValue conforming to the +// "tls.established" semantic conventions. It represents the boolean flag +// indicating if the TLS negotiation was successful and transitioned to an +// encrypted tunnel. +func TLSEstablished(val bool) attribute.KeyValue { + return TLSEstablishedKey.Bool(val) +} + +// TLSNextProtocol returns an attribute KeyValue conforming to the +// "tls.next_protocol" semantic conventions. It represents the string indicating +// the protocol being tunneled. Per the values in the [IANA registry], this +// string should be lower case. +// +// [IANA registry]: https://www.iana.org/assignments/tls-extensiontype-values/tls-extensiontype-values.xhtml#alpn-protocol-ids +func TLSNextProtocol(val string) attribute.KeyValue { + return TLSNextProtocolKey.String(val) +} + +// TLSProtocolVersion returns an attribute KeyValue conforming to the +// "tls.protocol.version" semantic conventions. It represents the numeric part of +// the version parsed from the original string of the negotiated +// [SSL/TLS protocol version]. +// +// [SSL/TLS protocol version]: https://docs.openssl.org/1.1.1/man3/SSL_get_version/#return-values +func TLSProtocolVersion(val string) attribute.KeyValue { + return TLSProtocolVersionKey.String(val) +} + +// TLSResumed returns an attribute KeyValue conforming to the "tls.resumed" +// semantic conventions. It represents the boolean flag indicating if this TLS +// connection was resumed from an existing TLS negotiation. +func TLSResumed(val bool) attribute.KeyValue { + return TLSResumedKey.Bool(val) +} + +// TLSServerCertificate returns an attribute KeyValue conforming to the +// "tls.server.certificate" semantic conventions. It represents the PEM-encoded +// stand-alone certificate offered by the server. This is usually +// mutually-exclusive of `server.certificate_chain` since this value also exists +// in that list. +func TLSServerCertificate(val string) attribute.KeyValue { + return TLSServerCertificateKey.String(val) +} + +// TLSServerCertificateChain returns an attribute KeyValue conforming to the +// "tls.server.certificate_chain" semantic conventions. It represents the array +// of PEM-encoded certificates that make up the certificate chain offered by the +// server. This is usually mutually-exclusive of `server.certificate` since that +// value should be the first certificate in the chain. +func TLSServerCertificateChain(val ...string) attribute.KeyValue { + return TLSServerCertificateChainKey.StringSlice(val) +} + +// TLSServerHashMd5 returns an attribute KeyValue conforming to the +// "tls.server.hash.md5" semantic conventions. It represents the certificate +// fingerprint using the MD5 digest of DER-encoded version of certificate offered +// by the server. For consistency with other hash values, this value should be +// formatted as an uppercase hash. +func TLSServerHashMd5(val string) attribute.KeyValue { + return TLSServerHashMd5Key.String(val) +} + +// TLSServerHashSha1 returns an attribute KeyValue conforming to the +// "tls.server.hash.sha1" semantic conventions. It represents the certificate +// fingerprint using the SHA1 digest of DER-encoded version of certificate +// offered by the server. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSServerHashSha1(val string) attribute.KeyValue { + return TLSServerHashSha1Key.String(val) +} + +// TLSServerHashSha256 returns an attribute KeyValue conforming to the +// "tls.server.hash.sha256" semantic conventions. It represents the certificate +// fingerprint using the SHA256 digest of DER-encoded version of certificate +// offered by the server. For consistency with other hash values, this value +// should be formatted as an uppercase hash. +func TLSServerHashSha256(val string) attribute.KeyValue { + return TLSServerHashSha256Key.String(val) +} + +// TLSServerIssuer returns an attribute KeyValue conforming to the +// "tls.server.issuer" semantic conventions. It represents the distinguished name +// of [subject] of the issuer of the x.509 certificate presented by the client. +// +// [subject]: https://datatracker.ietf.org/doc/html/rfc5280#section-4.1.2.6 +func TLSServerIssuer(val string) attribute.KeyValue { + return TLSServerIssuerKey.String(val) +} + +// TLSServerJa3s returns an attribute KeyValue conforming to the +// "tls.server.ja3s" semantic conventions. It represents a hash that identifies +// servers based on how they perform an SSL/TLS handshake. +func TLSServerJa3s(val string) attribute.KeyValue { + return TLSServerJa3sKey.String(val) +} + +// TLSServerNotAfter returns an attribute KeyValue conforming to the +// "tls.server.not_after" semantic conventions. It represents the date/Time +// indicating when server certificate is no longer considered valid. +func TLSServerNotAfter(val string) attribute.KeyValue { + return TLSServerNotAfterKey.String(val) +} + +// TLSServerNotBefore returns an attribute KeyValue conforming to the +// "tls.server.not_before" semantic conventions. It represents the date/Time +// indicating when server certificate is first considered valid. +func TLSServerNotBefore(val string) attribute.KeyValue { + return TLSServerNotBeforeKey.String(val) +} + +// TLSServerSubject returns an attribute KeyValue conforming to the +// "tls.server.subject" semantic conventions. It represents the distinguished +// name of subject of the x.509 certificate presented by the server. +func TLSServerSubject(val string) attribute.KeyValue { + return TLSServerSubjectKey.String(val) +} + +// Enum values for tls.protocol.name +var ( + // ssl + // Stability: development + TLSProtocolNameSsl = TLSProtocolNameKey.String("ssl") + // tls + // Stability: development + TLSProtocolNameTLS = TLSProtocolNameKey.String("tls") +) + +// Namespace: url +const ( + // URLDomainKey is the attribute Key conforming to the "url.domain" semantic + // conventions. It represents the domain extracted from the `url.full`, such as + // "opentelemetry.io". + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "www.foo.bar", "opentelemetry.io", "3.12.167.2", + // "[1080:0:0:0:8:800:200C:417A]" + // Note: In some cases a URL may refer to an IP and/or port directly, without a + // domain name. In this case, the IP address would go to the domain field. If + // the URL contains a [literal IPv6 address] enclosed by `[` and `]`, the `[` + // and `]` characters should also be captured in the domain field. + // + // [literal IPv6 address]: https://www.rfc-editor.org/rfc/rfc2732#section-2 + URLDomainKey = attribute.Key("url.domain") + + // URLExtensionKey is the attribute Key conforming to the "url.extension" + // semantic conventions. It represents the file extension extracted from the + // `url.full`, excluding the leading dot. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "png", "gz" + // Note: The file extension is only set if it exists, as not every url has a + // file extension. When the file name has multiple extensions `example.tar.gz`, + // only the last one should be captured `gz`, not `tar.gz`. + URLExtensionKey = attribute.Key("url.extension") + + // URLFragmentKey is the attribute Key conforming to the "url.fragment" semantic + // conventions. It represents the [URI fragment] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "SemConv" + // + // [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5 + URLFragmentKey = attribute.Key("url.fragment") + + // URLFullKey is the attribute Key conforming to the "url.full" semantic + // conventions. It represents the absolute URL describing a network resource + // according to [RFC3986]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", "//localhost" + // Note: For network calls, URL usually has + // `scheme://host[:port][path][?query][#fragment]` format, where the fragment + // is not transmitted over HTTP, but if it is known, it SHOULD be included + // nevertheless. + // + // `url.full` MUST NOT contain credentials passed via URL in form of + // `https://username:password@www.example.com/`. + // In such case username and password SHOULD be redacted and attribute's value + // SHOULD be `https://REDACTED:REDACTED@www.example.com/`. + // + // `url.full` SHOULD capture the absolute URL when it is available (or can be + // reconstructed). + // + // Sensitive content provided in `url.full` SHOULD be scrubbed when + // instrumentations can identify it. + // + // + // Query string values for the following keys SHOULD be redacted by default and + // replaced by the + // value `REDACTED`: + // + // - [`AWSAccessKeyId`] + // - [`Signature`] + // - [`sig`] + // - [`X-Goog-Signature`] + // + // This list is subject to change over time. + // + // When a query string value is redacted, the query string key SHOULD still be + // preserved, e.g. + // `https://www.example.com/path?color=blue&sig=REDACTED`. + // + // [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986 + // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token + // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls + URLFullKey = attribute.Key("url.full") + + // URLOriginalKey is the attribute Key conforming to the "url.original" semantic + // conventions. It represents the unmodified original URL as seen in the event + // source. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "https://www.foo.bar/search?q=OpenTelemetry#SemConv", + // "search?q=OpenTelemetry" + // Note: In network monitoring, the observed URL may be a full URL, whereas in + // access logs, the URL is often just represented as a path. This field is meant + // to represent the URL as it was observed, complete or not. + // `url.original` might contain credentials passed via URL in form of + // `https://username:password@www.example.com/`. In such case password and + // username SHOULD NOT be redacted and attribute's value SHOULD remain the same. + URLOriginalKey = attribute.Key("url.original") + + // URLPathKey is the attribute Key conforming to the "url.path" semantic + // conventions. It represents the [URI path] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "/search" + // Note: Sensitive content provided in `url.path` SHOULD be scrubbed when + // instrumentations can identify it. + // + // [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3 + URLPathKey = attribute.Key("url.path") + + // URLPortKey is the attribute Key conforming to the "url.port" semantic + // conventions. It represents the port extracted from the `url.full`. + // + // Type: int + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: 443 + URLPortKey = attribute.Key("url.port") + + // URLQueryKey is the attribute Key conforming to the "url.query" semantic + // conventions. It represents the [URI query] component. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "q=OpenTelemetry" + // Note: Sensitive content provided in `url.query` SHOULD be scrubbed when + // instrumentations can identify it. + // + // + // Query string values for the following keys SHOULD be redacted by default and + // replaced by the value `REDACTED`: + // + // - [`AWSAccessKeyId`] + // - [`Signature`] + // - [`sig`] + // - [`X-Goog-Signature`] + // + // This list is subject to change over time. + // + // When a query string value is redacted, the query string key SHOULD still be + // preserved, e.g. + // `q=OpenTelemetry&sig=REDACTED`. + // + // [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4 + // [`AWSAccessKeyId`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`Signature`]: https://docs.aws.amazon.com/AmazonS3/latest/userguide/RESTAuthentication.html#RESTAuthenticationQueryStringAuth + // [`sig`]: https://learn.microsoft.com/azure/storage/common/storage-sas-overview#sas-token + // [`X-Goog-Signature`]: https://cloud.google.com/storage/docs/access-control/signed-urls + URLQueryKey = attribute.Key("url.query") + + // URLRegisteredDomainKey is the attribute Key conforming to the + // "url.registered_domain" semantic conventions. It represents the highest + // registered url domain, stripped of the subdomain. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "example.com", "foo.co.uk" + // Note: This value can be determined precisely with the [public suffix list]. + // For example, the registered domain for `foo.example.com` is `example.com`. + // Trying to approximate this by simply taking the last two labels will not work + // well for TLDs such as `co.uk`. + // + // [public suffix list]: https://publicsuffix.org/ + URLRegisteredDomainKey = attribute.Key("url.registered_domain") + + // URLSchemeKey is the attribute Key conforming to the "url.scheme" semantic + // conventions. It represents the [URI scheme] component identifying the used + // protocol. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "https", "ftp", "telnet" + // + // [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1 + URLSchemeKey = attribute.Key("url.scheme") + + // URLSubdomainKey is the attribute Key conforming to the "url.subdomain" + // semantic conventions. It represents the subdomain portion of a fully + // qualified domain name includes all of the names except the host name under + // the registered_domain. In a partially qualified domain, or if the + // qualification level of the full name cannot be determined, subdomain contains + // all of the names below the registered domain. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "east", "sub2.sub1" + // Note: The subdomain portion of `www.east.mydomain.co.uk` is `east`. If the + // domain has multiple levels of subdomain, such as `sub2.sub1.example.com`, the + // subdomain field should contain `sub2.sub1`, with no trailing period. + URLSubdomainKey = attribute.Key("url.subdomain") + + // URLTemplateKey is the attribute Key conforming to the "url.template" semantic + // conventions. It represents the low-cardinality template of an + // [absolute path reference]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "/users/{id}", "/users/:id", "/users?id={id}" + // + // [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2 + URLTemplateKey = attribute.Key("url.template") + + // URLTopLevelDomainKey is the attribute Key conforming to the + // "url.top_level_domain" semantic conventions. It represents the effective top + // level domain (eTLD), also known as the domain suffix, is the last part of the + // domain name. For example, the top level domain for example.com is `com`. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "com", "co.uk" + // Note: This value can be determined precisely with the [public suffix list]. + // + // [public suffix list]: https://publicsuffix.org/ + URLTopLevelDomainKey = attribute.Key("url.top_level_domain") +) + +// URLDomain returns an attribute KeyValue conforming to the "url.domain" +// semantic conventions. It represents the domain extracted from the `url.full`, +// such as "opentelemetry.io". +func URLDomain(val string) attribute.KeyValue { + return URLDomainKey.String(val) +} + +// URLExtension returns an attribute KeyValue conforming to the "url.extension" +// semantic conventions. It represents the file extension extracted from the +// `url.full`, excluding the leading dot. +func URLExtension(val string) attribute.KeyValue { + return URLExtensionKey.String(val) +} + +// URLFragment returns an attribute KeyValue conforming to the "url.fragment" +// semantic conventions. It represents the [URI fragment] component. +// +// [URI fragment]: https://www.rfc-editor.org/rfc/rfc3986#section-3.5 +func URLFragment(val string) attribute.KeyValue { + return URLFragmentKey.String(val) +} + +// URLFull returns an attribute KeyValue conforming to the "url.full" semantic +// conventions. It represents the absolute URL describing a network resource +// according to [RFC3986]. +// +// [RFC3986]: https://www.rfc-editor.org/rfc/rfc3986 +func URLFull(val string) attribute.KeyValue { + return URLFullKey.String(val) +} + +// URLOriginal returns an attribute KeyValue conforming to the "url.original" +// semantic conventions. It represents the unmodified original URL as seen in the +// event source. +func URLOriginal(val string) attribute.KeyValue { + return URLOriginalKey.String(val) +} + +// URLPath returns an attribute KeyValue conforming to the "url.path" semantic +// conventions. It represents the [URI path] component. +// +// [URI path]: https://www.rfc-editor.org/rfc/rfc3986#section-3.3 +func URLPath(val string) attribute.KeyValue { + return URLPathKey.String(val) +} + +// URLPort returns an attribute KeyValue conforming to the "url.port" semantic +// conventions. It represents the port extracted from the `url.full`. +func URLPort(val int) attribute.KeyValue { + return URLPortKey.Int(val) +} + +// URLQuery returns an attribute KeyValue conforming to the "url.query" semantic +// conventions. It represents the [URI query] component. +// +// [URI query]: https://www.rfc-editor.org/rfc/rfc3986#section-3.4 +func URLQuery(val string) attribute.KeyValue { + return URLQueryKey.String(val) +} + +// URLRegisteredDomain returns an attribute KeyValue conforming to the +// "url.registered_domain" semantic conventions. It represents the highest +// registered url domain, stripped of the subdomain. +func URLRegisteredDomain(val string) attribute.KeyValue { + return URLRegisteredDomainKey.String(val) +} + +// URLScheme returns an attribute KeyValue conforming to the "url.scheme" +// semantic conventions. It represents the [URI scheme] component identifying the +// used protocol. +// +// [URI scheme]: https://www.rfc-editor.org/rfc/rfc3986#section-3.1 +func URLScheme(val string) attribute.KeyValue { + return URLSchemeKey.String(val) +} + +// URLSubdomain returns an attribute KeyValue conforming to the "url.subdomain" +// semantic conventions. It represents the subdomain portion of a fully qualified +// domain name includes all of the names except the host name under the +// registered_domain. In a partially qualified domain, or if the qualification +// level of the full name cannot be determined, subdomain contains all of the +// names below the registered domain. +func URLSubdomain(val string) attribute.KeyValue { + return URLSubdomainKey.String(val) +} + +// URLTemplate returns an attribute KeyValue conforming to the "url.template" +// semantic conventions. It represents the low-cardinality template of an +// [absolute path reference]. +// +// [absolute path reference]: https://www.rfc-editor.org/rfc/rfc3986#section-4.2 +func URLTemplate(val string) attribute.KeyValue { + return URLTemplateKey.String(val) +} + +// URLTopLevelDomain returns an attribute KeyValue conforming to the +// "url.top_level_domain" semantic conventions. It represents the effective top +// level domain (eTLD), also known as the domain suffix, is the last part of the +// domain name. For example, the top level domain for example.com is `com`. +func URLTopLevelDomain(val string) attribute.KeyValue { + return URLTopLevelDomainKey.String(val) +} + +// Namespace: user +const ( + // UserEmailKey is the attribute Key conforming to the "user.email" semantic + // conventions. It represents the user email address. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a.einstein@example.com" + UserEmailKey = attribute.Key("user.email") + + // UserFullNameKey is the attribute Key conforming to the "user.full_name" + // semantic conventions. It represents the user's full name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Albert Einstein" + UserFullNameKey = attribute.Key("user.full_name") + + // UserHashKey is the attribute Key conforming to the "user.hash" semantic + // conventions. It represents the unique user hash to correlate information for + // a user in anonymized form. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "364fc68eaf4c8acec74a4e52d7d1feaa" + // Note: Useful if `user.id` or `user.name` contain confidential information and + // cannot be used. + UserHashKey = attribute.Key("user.hash") + + // UserIDKey is the attribute Key conforming to the "user.id" semantic + // conventions. It represents the unique identifier of the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "S-1-5-21-202424912787-2692429404-2351956786-1000" + UserIDKey = attribute.Key("user.id") + + // UserNameKey is the attribute Key conforming to the "user.name" semantic + // conventions. It represents the short name or login/username of the user. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "a.einstein" + UserNameKey = attribute.Key("user.name") + + // UserRolesKey is the attribute Key conforming to the "user.roles" semantic + // conventions. It represents the array of user roles at the time of the event. + // + // Type: string[] + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "admin", "reporting_user" + UserRolesKey = attribute.Key("user.roles") +) + +// UserEmail returns an attribute KeyValue conforming to the "user.email" +// semantic conventions. It represents the user email address. +func UserEmail(val string) attribute.KeyValue { + return UserEmailKey.String(val) +} + +// UserFullName returns an attribute KeyValue conforming to the "user.full_name" +// semantic conventions. It represents the user's full name. +func UserFullName(val string) attribute.KeyValue { + return UserFullNameKey.String(val) +} + +// UserHash returns an attribute KeyValue conforming to the "user.hash" semantic +// conventions. It represents the unique user hash to correlate information for a +// user in anonymized form. +func UserHash(val string) attribute.KeyValue { + return UserHashKey.String(val) +} + +// UserID returns an attribute KeyValue conforming to the "user.id" semantic +// conventions. It represents the unique identifier of the user. +func UserID(val string) attribute.KeyValue { + return UserIDKey.String(val) +} + +// UserName returns an attribute KeyValue conforming to the "user.name" semantic +// conventions. It represents the short name or login/username of the user. +func UserName(val string) attribute.KeyValue { + return UserNameKey.String(val) +} + +// UserRoles returns an attribute KeyValue conforming to the "user.roles" +// semantic conventions. It represents the array of user roles at the time of the +// event. +func UserRoles(val ...string) attribute.KeyValue { + return UserRolesKey.StringSlice(val) +} + +// Namespace: user_agent +const ( + // UserAgentNameKey is the attribute Key conforming to the "user_agent.name" + // semantic conventions. It represents the name of the user-agent extracted from + // original. Usually refers to the browser's name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Safari", "YourApp" + // Note: [Example] of extracting browser's name from original string. In the + // case of using a user-agent for non-browser products, such as microservices + // with multiple names/versions inside the `user_agent.original`, the most + // significant name SHOULD be selected. In such a scenario it should align with + // `user_agent.version` + // + // [Example]: https://www.whatsmyua.info + UserAgentNameKey = attribute.Key("user_agent.name") + + // UserAgentOriginalKey is the attribute Key conforming to the + // "user_agent.original" semantic conventions. It represents the value of the + // [HTTP User-Agent] header sent by the client. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Stable + // + // Examples: "CERN-LineMode/2.15 libwww/2.17b3", "Mozilla/5.0 (iPhone; CPU + // iPhone OS 14_7_1 like Mac OS X) AppleWebKit/605.1.15 (KHTML, like Gecko) + // Version/14.1.2 Mobile/15E148 Safari/604.1", "YourApp/1.0.0 + // grpc-java-okhttp/1.27.2" + // + // [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent + UserAgentOriginalKey = attribute.Key("user_agent.original") + + // UserAgentOSNameKey is the attribute Key conforming to the + // "user_agent.os.name" semantic conventions. It represents the human readable + // operating system name. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "iOS", "Android", "Ubuntu" + // Note: For mapping user agent strings to OS names, libraries such as + // [ua-parser] can be utilized. + // + // [ua-parser]: https://github.com/ua-parser + UserAgentOSNameKey = attribute.Key("user_agent.os.name") + + // UserAgentOSVersionKey is the attribute Key conforming to the + // "user_agent.os.version" semantic conventions. It represents the version + // string of the operating system as defined in [Version Attributes]. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.2.1", "18.04.1" + // Note: For mapping user agent strings to OS versions, libraries such as + // [ua-parser] can be utilized. + // + // [Version Attributes]: /docs/resource/README.md#version-attributes + // [ua-parser]: https://github.com/ua-parser + UserAgentOSVersionKey = attribute.Key("user_agent.os.version") + + // UserAgentSyntheticTypeKey is the attribute Key conforming to the + // "user_agent.synthetic.type" semantic conventions. It represents the specifies + // the category of synthetic traffic, such as tests or bots. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // Note: This attribute MAY be derived from the contents of the + // `user_agent.original` attribute. Components that populate the attribute are + // responsible for determining what they consider to be synthetic bot or test + // traffic. This attribute can either be set for self-identification purposes, + // or on telemetry detected to be generated as a result of a synthetic request. + // This attribute is useful for distinguishing between genuine client traffic + // and synthetic traffic generated by bots or tests. + UserAgentSyntheticTypeKey = attribute.Key("user_agent.synthetic.type") + + // UserAgentVersionKey is the attribute Key conforming to the + // "user_agent.version" semantic conventions. It represents the version of the + // user-agent extracted from original. Usually refers to the browser's version. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "14.1.2", "1.0.0" + // Note: [Example] of extracting browser's version from original string. In the + // case of using a user-agent for non-browser products, such as microservices + // with multiple names/versions inside the `user_agent.original`, the most + // significant version SHOULD be selected. In such a scenario it should align + // with `user_agent.name` + // + // [Example]: https://www.whatsmyua.info + UserAgentVersionKey = attribute.Key("user_agent.version") +) + +// UserAgentName returns an attribute KeyValue conforming to the +// "user_agent.name" semantic conventions. It represents the name of the +// user-agent extracted from original. Usually refers to the browser's name. +func UserAgentName(val string) attribute.KeyValue { + return UserAgentNameKey.String(val) +} + +// UserAgentOriginal returns an attribute KeyValue conforming to the +// "user_agent.original" semantic conventions. It represents the value of the +// [HTTP User-Agent] header sent by the client. +// +// [HTTP User-Agent]: https://www.rfc-editor.org/rfc/rfc9110.html#field.user-agent +func UserAgentOriginal(val string) attribute.KeyValue { + return UserAgentOriginalKey.String(val) +} + +// UserAgentOSName returns an attribute KeyValue conforming to the +// "user_agent.os.name" semantic conventions. It represents the human readable +// operating system name. +func UserAgentOSName(val string) attribute.KeyValue { + return UserAgentOSNameKey.String(val) +} + +// UserAgentOSVersion returns an attribute KeyValue conforming to the +// "user_agent.os.version" semantic conventions. It represents the version string +// of the operating system as defined in [Version Attributes]. +// +// [Version Attributes]: /docs/resource/README.md#version-attributes +func UserAgentOSVersion(val string) attribute.KeyValue { + return UserAgentOSVersionKey.String(val) +} + +// UserAgentVersion returns an attribute KeyValue conforming to the +// "user_agent.version" semantic conventions. It represents the version of the +// user-agent extracted from original. Usually refers to the browser's version. +func UserAgentVersion(val string) attribute.KeyValue { + return UserAgentVersionKey.String(val) +} + +// Enum values for user_agent.synthetic.type +var ( + // Bot source. + // Stability: development + UserAgentSyntheticTypeBot = UserAgentSyntheticTypeKey.String("bot") + // Synthetic test source. + // Stability: development + UserAgentSyntheticTypeTest = UserAgentSyntheticTypeKey.String("test") +) + +// Namespace: vcs +const ( + // VCSChangeIDKey is the attribute Key conforming to the "vcs.change.id" + // semantic conventions. It represents the ID of the change (pull request/merge + // request/changelist) if applicable. This is usually a unique (within + // repository) identifier generated by the VCS system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "123" + VCSChangeIDKey = attribute.Key("vcs.change.id") + + // VCSChangeStateKey is the attribute Key conforming to the "vcs.change.state" + // semantic conventions. It represents the state of the change (pull + // request/merge request/changelist). + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "open", "closed", "merged" + VCSChangeStateKey = attribute.Key("vcs.change.state") + + // VCSChangeTitleKey is the attribute Key conforming to the "vcs.change.title" + // semantic conventions. It represents the human readable title of the change + // (pull request/merge request/changelist). This title is often a brief summary + // of the change and may get merged in to a ref as the commit summary. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "Fixes broken thing", "feat: add my new feature", "[chore] update + // dependency" + VCSChangeTitleKey = attribute.Key("vcs.change.title") + + // VCSLineChangeTypeKey is the attribute Key conforming to the + // "vcs.line_change.type" semantic conventions. It represents the type of line + // change being measured on a branch or change. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "added", "removed" + VCSLineChangeTypeKey = attribute.Key("vcs.line_change.type") + + // VCSOwnerNameKey is the attribute Key conforming to the "vcs.owner.name" + // semantic conventions. It represents the group owner within the version + // control system. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-org", "myteam", "business-unit" + VCSOwnerNameKey = attribute.Key("vcs.owner.name") + + // VCSProviderNameKey is the attribute Key conforming to the "vcs.provider.name" + // semantic conventions. It represents the name of the version control system + // provider. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "github", "gitlab", "gitea", "bitbucket" + VCSProviderNameKey = attribute.Key("vcs.provider.name") + + // VCSRefBaseNameKey is the attribute Key conforming to the "vcs.ref.base.name" + // semantic conventions. It represents the name of the [reference] such as + // **branch** or **tag** in the repository. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-feature-branch", "tag-1-test" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefBaseNameKey = attribute.Key("vcs.ref.base.name") + + // VCSRefBaseRevisionKey is the attribute Key conforming to the + // "vcs.ref.base.revision" semantic conventions. It represents the revision, + // literally [revised version], The revision most often refers to a commit + // object in Git, or a revision number in SVN. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc", + // "main", "123", "HEAD" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. The + // revision can be a full [hash value (see + // glossary)], + // of the recorded change to a ref within a repository pointing to a + // commit [commit] object. It does + // not necessarily have to be a hash; it can simply define a [revision + // number] + // which is an integer that is monotonically increasing. In cases where + // it is identical to the `ref.base.name`, it SHOULD still be included. + // It is up to the implementer to decide which value to set as the + // revision based on the VCS system and situational context. + // + // [revised version]: https://www.merriam-webster.com/dictionary/revision + // [hash value (see + // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [commit]: https://git-scm.com/docs/git-commit + // [revision + // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html + VCSRefBaseRevisionKey = attribute.Key("vcs.ref.base.revision") + + // VCSRefBaseTypeKey is the attribute Key conforming to the "vcs.ref.base.type" + // semantic conventions. It represents the type of the [reference] in the + // repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // Note: `base` refers to the starting point of a change. For example, `main` + // would be the base reference of type branch if you've created a new + // reference of type branch from it and created new commits. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefBaseTypeKey = attribute.Key("vcs.ref.base.type") + + // VCSRefHeadNameKey is the attribute Key conforming to the "vcs.ref.head.name" + // semantic conventions. It represents the name of the [reference] such as + // **branch** or **tag** in the repository. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "my-feature-branch", "tag-1-test" + // Note: `head` refers to where you are right now; the current reference at a + // given time. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefHeadNameKey = attribute.Key("vcs.ref.head.name") + + // VCSRefHeadRevisionKey is the attribute Key conforming to the + // "vcs.ref.head.revision" semantic conventions. It represents the revision, + // literally [revised version], The revision most often refers to a commit + // object in Git, or a revision number in SVN. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "9d59409acf479dfa0df1aa568182e43e43df8bbe28d60fcf2bc52e30068802cc", + // "main", "123", "HEAD" + // Note: `head` refers to where you are right now; the current reference at a + // given time.The revision can be a full [hash value (see + // glossary)], + // of the recorded change to a ref within a repository pointing to a + // commit [commit] object. It does + // not necessarily have to be a hash; it can simply define a [revision + // number] + // which is an integer that is monotonically increasing. In cases where + // it is identical to the `ref.head.name`, it SHOULD still be included. + // It is up to the implementer to decide which value to set as the + // revision based on the VCS system and situational context. + // + // [revised version]: https://www.merriam-webster.com/dictionary/revision + // [hash value (see + // glossary)]: https://nvlpubs.nist.gov/nistpubs/FIPS/NIST.FIPS.186-5.pdf + // [commit]: https://git-scm.com/docs/git-commit + // [revision + // number]: https://svnbook.red-bean.com/en/1.7/svn.tour.revs.specifiers.html + VCSRefHeadRevisionKey = attribute.Key("vcs.ref.head.revision") + + // VCSRefHeadTypeKey is the attribute Key conforming to the "vcs.ref.head.type" + // semantic conventions. It represents the type of the [reference] in the + // repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // Note: `head` refers to where you are right now; the current reference at a + // given time. + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefHeadTypeKey = attribute.Key("vcs.ref.head.type") + + // VCSRefTypeKey is the attribute Key conforming to the "vcs.ref.type" semantic + // conventions. It represents the type of the [reference] in the repository. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "branch", "tag" + // + // [reference]: https://git-scm.com/docs/gitglossary#def_ref + VCSRefTypeKey = attribute.Key("vcs.ref.type") + + // VCSRepositoryNameKey is the attribute Key conforming to the + // "vcs.repository.name" semantic conventions. It represents the human readable + // name of the repository. It SHOULD NOT include any additional identifier like + // Group/SubGroup in GitLab or organization in GitHub. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "semantic-conventions", "my-cool-repo" + // Note: Due to it only being the name, it can clash with forks of the same + // repository if collecting telemetry across multiple orgs or groups in + // the same backends. + VCSRepositoryNameKey = attribute.Key("vcs.repository.name") + + // VCSRepositoryURLFullKey is the attribute Key conforming to the + // "vcs.repository.url.full" semantic conventions. It represents the + // [canonical URL] of the repository providing the complete HTTP(S) address in + // order to locate and identify the repository through a browser. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: + // "https://github.com/opentelemetry/open-telemetry-collector-contrib", + // "https://gitlab.com/my-org/my-project/my-projects-project/repo" + // Note: In Git Version Control Systems, the canonical URL SHOULD NOT include + // the `.git` extension. + // + // [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical. + VCSRepositoryURLFullKey = attribute.Key("vcs.repository.url.full") + + // VCSRevisionDeltaDirectionKey is the attribute Key conforming to the + // "vcs.revision_delta.direction" semantic conventions. It represents the type + // of revision comparison. + // + // Type: Enum + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "ahead", "behind" + VCSRevisionDeltaDirectionKey = attribute.Key("vcs.revision_delta.direction") +) + +// VCSChangeID returns an attribute KeyValue conforming to the "vcs.change.id" +// semantic conventions. It represents the ID of the change (pull request/merge +// request/changelist) if applicable. This is usually a unique (within +// repository) identifier generated by the VCS system. +func VCSChangeID(val string) attribute.KeyValue { + return VCSChangeIDKey.String(val) +} + +// VCSChangeTitle returns an attribute KeyValue conforming to the +// "vcs.change.title" semantic conventions. It represents the human readable +// title of the change (pull request/merge request/changelist). This title is +// often a brief summary of the change and may get merged in to a ref as the +// commit summary. +func VCSChangeTitle(val string) attribute.KeyValue { + return VCSChangeTitleKey.String(val) +} + +// VCSOwnerName returns an attribute KeyValue conforming to the "vcs.owner.name" +// semantic conventions. It represents the group owner within the version control +// system. +func VCSOwnerName(val string) attribute.KeyValue { + return VCSOwnerNameKey.String(val) +} + +// VCSRefBaseName returns an attribute KeyValue conforming to the +// "vcs.ref.base.name" semantic conventions. It represents the name of the +// [reference] such as **branch** or **tag** in the repository. +// +// [reference]: https://git-scm.com/docs/gitglossary#def_ref +func VCSRefBaseName(val string) attribute.KeyValue { + return VCSRefBaseNameKey.String(val) +} + +// VCSRefBaseRevision returns an attribute KeyValue conforming to the +// "vcs.ref.base.revision" semantic conventions. It represents the revision, +// literally [revised version], The revision most often refers to a commit object +// in Git, or a revision number in SVN. +// +// [revised version]: https://www.merriam-webster.com/dictionary/revision +func VCSRefBaseRevision(val string) attribute.KeyValue { + return VCSRefBaseRevisionKey.String(val) +} + +// VCSRefHeadName returns an attribute KeyValue conforming to the +// "vcs.ref.head.name" semantic conventions. It represents the name of the +// [reference] such as **branch** or **tag** in the repository. +// +// [reference]: https://git-scm.com/docs/gitglossary#def_ref +func VCSRefHeadName(val string) attribute.KeyValue { + return VCSRefHeadNameKey.String(val) +} + +// VCSRefHeadRevision returns an attribute KeyValue conforming to the +// "vcs.ref.head.revision" semantic conventions. It represents the revision, +// literally [revised version], The revision most often refers to a commit object +// in Git, or a revision number in SVN. +// +// [revised version]: https://www.merriam-webster.com/dictionary/revision +func VCSRefHeadRevision(val string) attribute.KeyValue { + return VCSRefHeadRevisionKey.String(val) +} + +// VCSRepositoryName returns an attribute KeyValue conforming to the +// "vcs.repository.name" semantic conventions. It represents the human readable +// name of the repository. It SHOULD NOT include any additional identifier like +// Group/SubGroup in GitLab or organization in GitHub. +func VCSRepositoryName(val string) attribute.KeyValue { + return VCSRepositoryNameKey.String(val) +} + +// VCSRepositoryURLFull returns an attribute KeyValue conforming to the +// "vcs.repository.url.full" semantic conventions. It represents the +// [canonical URL] of the repository providing the complete HTTP(S) address in +// order to locate and identify the repository through a browser. +// +// [canonical URL]: https://support.google.com/webmasters/answer/10347851?hl=en#:~:text=A%20canonical%20URL%20is%20the,Google%20chooses%20one%20as%20canonical. +func VCSRepositoryURLFull(val string) attribute.KeyValue { + return VCSRepositoryURLFullKey.String(val) +} + +// Enum values for vcs.change.state +var ( + // Open means the change is currently active and under review. It hasn't been + // merged into the target branch yet, and it's still possible to make changes or + // add comments. + // Stability: development + VCSChangeStateOpen = VCSChangeStateKey.String("open") + // WIP (work-in-progress, draft) means the change is still in progress and not + // yet ready for a full review. It might still undergo significant changes. + // Stability: development + VCSChangeStateWip = VCSChangeStateKey.String("wip") + // Closed means the merge request has been closed without merging. This can + // happen for various reasons, such as the changes being deemed unnecessary, the + // issue being resolved in another way, or the author deciding to withdraw the + // request. + // Stability: development + VCSChangeStateClosed = VCSChangeStateKey.String("closed") + // Merged indicates that the change has been successfully integrated into the + // target codebase. + // Stability: development + VCSChangeStateMerged = VCSChangeStateKey.String("merged") +) + +// Enum values for vcs.line_change.type +var ( + // How many lines were added. + // Stability: development + VCSLineChangeTypeAdded = VCSLineChangeTypeKey.String("added") + // How many lines were removed. + // Stability: development + VCSLineChangeTypeRemoved = VCSLineChangeTypeKey.String("removed") +) + +// Enum values for vcs.provider.name +var ( + // [GitHub] + // Stability: development + // + // [GitHub]: https://github.com + VCSProviderNameGithub = VCSProviderNameKey.String("github") + // [GitLab] + // Stability: development + // + // [GitLab]: https://gitlab.com + VCSProviderNameGitlab = VCSProviderNameKey.String("gitlab") + // Deprecated: Replaced by `gitea`. + VCSProviderNameGittea = VCSProviderNameKey.String("gittea") + // [Gitea] + // Stability: development + // + // [Gitea]: https://gitea.io + VCSProviderNameGitea = VCSProviderNameKey.String("gitea") + // [Bitbucket] + // Stability: development + // + // [Bitbucket]: https://bitbucket.org + VCSProviderNameBitbucket = VCSProviderNameKey.String("bitbucket") +) + +// Enum values for vcs.ref.base.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefBaseTypeBranch = VCSRefBaseTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefBaseTypeTag = VCSRefBaseTypeKey.String("tag") +) + +// Enum values for vcs.ref.head.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefHeadTypeBranch = VCSRefHeadTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefHeadTypeTag = VCSRefHeadTypeKey.String("tag") +) + +// Enum values for vcs.ref.type +var ( + // [branch] + // Stability: development + // + // [branch]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddefbranchabranch + VCSRefTypeBranch = VCSRefTypeKey.String("branch") + // [tag] + // Stability: development + // + // [tag]: https://git-scm.com/docs/gitglossary#Documentation/gitglossary.txt-aiddeftagatag + VCSRefTypeTag = VCSRefTypeKey.String("tag") +) + +// Enum values for vcs.revision_delta.direction +var ( + // How many revisions the change is behind the target ref. + // Stability: development + VCSRevisionDeltaDirectionBehind = VCSRevisionDeltaDirectionKey.String("behind") + // How many revisions the change is ahead of the target ref. + // Stability: development + VCSRevisionDeltaDirectionAhead = VCSRevisionDeltaDirectionKey.String("ahead") +) + +// Namespace: webengine +const ( + // WebEngineDescriptionKey is the attribute Key conforming to the + // "webengine.description" semantic conventions. It represents the additional + // description of the web engine (e.g. detailed version and edition + // information). + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "WildFly Full 21.0.0.Final (WildFly Core 13.0.1.Final) - + // 2.2.2.Final" + WebEngineDescriptionKey = attribute.Key("webengine.description") + + // WebEngineNameKey is the attribute Key conforming to the "webengine.name" + // semantic conventions. It represents the name of the web engine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "WildFly" + WebEngineNameKey = attribute.Key("webengine.name") + + // WebEngineVersionKey is the attribute Key conforming to the + // "webengine.version" semantic conventions. It represents the version of the + // web engine. + // + // Type: string + // RequirementLevel: Recommended + // Stability: Development + // + // Examples: "21.0.0" + WebEngineVersionKey = attribute.Key("webengine.version") +) + +// WebEngineDescription returns an attribute KeyValue conforming to the +// "webengine.description" semantic conventions. It represents the additional +// description of the web engine (e.g. detailed version and edition information). +func WebEngineDescription(val string) attribute.KeyValue { + return WebEngineDescriptionKey.String(val) +} + +// WebEngineName returns an attribute KeyValue conforming to the "webengine.name" +// semantic conventions. It represents the name of the web engine. +func WebEngineName(val string) attribute.KeyValue { + return WebEngineNameKey.String(val) +} + +// WebEngineVersion returns an attribute KeyValue conforming to the +// "webengine.version" semantic conventions. It represents the version of the web +// engine. +func WebEngineVersion(val string) attribute.KeyValue { + return WebEngineVersionKey.String(val) +} \ No newline at end of file diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go new file mode 100644 index 000000000..2c5c7ebd0 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/doc.go @@ -0,0 +1,9 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +// Package semconv implements OpenTelemetry semantic conventions. +// +// OpenTelemetry semantic conventions are agreed standardized naming +// patterns for OpenTelemetry things. This package represents the v1.34.0 +// version of the OpenTelemetry semantic conventions. +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go new file mode 100644 index 000000000..88a998f1e --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/exception.go @@ -0,0 +1,9 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" + +const ( + // ExceptionEventName is the name of the Span event representing an exception. + ExceptionEventName = "exception" +) diff --git a/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go new file mode 100644 index 000000000..3c23d4592 --- /dev/null +++ b/vendor/go.opentelemetry.io/otel/semconv/v1.34.0/schema.go @@ -0,0 +1,9 @@ +// Copyright The OpenTelemetry Authors +// SPDX-License-Identifier: Apache-2.0 + +package semconv // import "go.opentelemetry.io/otel/semconv/v1.34.0" + +// SchemaURL is the schema URL that matches the version of the semantic conventions +// that this package defines. Semconv packages starting from v1.4.0 must declare +// non-empty schema URL in the form https://opentelemetry.io/schemas/ +const SchemaURL = "https://opentelemetry.io/schemas/1.34.0" diff --git a/vendor/go.opentelemetry.io/otel/trace/auto.go b/vendor/go.opentelemetry.io/otel/trace/auto.go index d90af8f67..f3aa39813 100644 --- a/vendor/go.opentelemetry.io/otel/trace/auto.go +++ b/vendor/go.opentelemetry.io/otel/trace/auto.go @@ -20,7 +20,7 @@ import ( "go.opentelemetry.io/otel/attribute" "go.opentelemetry.io/otel/codes" - semconv "go.opentelemetry.io/otel/semconv/v1.26.0" + semconv "go.opentelemetry.io/otel/semconv/v1.34.0" "go.opentelemetry.io/otel/trace/embedded" "go.opentelemetry.io/otel/trace/internal/telemetry" ) diff --git a/vendor/go.opentelemetry.io/otel/version.go b/vendor/go.opentelemetry.io/otel/version.go index ac3c0b15d..7afe92b59 100644 --- a/vendor/go.opentelemetry.io/otel/version.go +++ b/vendor/go.opentelemetry.io/otel/version.go @@ -5,5 +5,5 @@ package otel // import "go.opentelemetry.io/otel" // Version is the current release version of OpenTelemetry in use. func Version() string { - return "1.36.0" + return "1.37.0" } diff --git a/vendor/go.opentelemetry.io/otel/versions.yaml b/vendor/go.opentelemetry.io/otel/versions.yaml index 79f82f3d0..9d4742a17 100644 --- a/vendor/go.opentelemetry.io/otel/versions.yaml +++ b/vendor/go.opentelemetry.io/otel/versions.yaml @@ -3,13 +3,12 @@ module-sets: stable-v1: - version: v1.36.0 + version: v1.37.0 modules: - go.opentelemetry.io/otel - go.opentelemetry.io/otel/bridge/opencensus - go.opentelemetry.io/otel/bridge/opencensus/test - go.opentelemetry.io/otel/bridge/opentracing - - go.opentelemetry.io/otel/bridge/opentracing/test - go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetricgrpc - go.opentelemetry.io/otel/exporters/otlp/otlpmetric/otlpmetrichttp - go.opentelemetry.io/otel/exporters/otlp/otlptrace @@ -23,14 +22,16 @@ module-sets: - go.opentelemetry.io/otel/sdk/metric - go.opentelemetry.io/otel/trace experimental-metrics: - version: v0.58.0 + version: v0.59.0 modules: - go.opentelemetry.io/otel/exporters/prometheus experimental-logs: - version: v0.12.0 + version: v0.13.0 modules: - go.opentelemetry.io/otel/log + - go.opentelemetry.io/otel/log/logtest - go.opentelemetry.io/otel/sdk/log + - go.opentelemetry.io/otel/sdk/log/logtest - go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploggrpc - go.opentelemetry.io/otel/exporters/otlp/otlplog/otlploghttp - go.opentelemetry.io/otel/exporters/stdout/stdoutlog @@ -40,6 +41,4 @@ module-sets: - go.opentelemetry.io/otel/schema excluded-modules: - go.opentelemetry.io/otel/internal/tools - - go.opentelemetry.io/otel/log/logtest - - go.opentelemetry.io/otel/sdk/log/logtest - go.opentelemetry.io/otel/trace/internal/telemetry/test diff --git a/vendor/golang.org/x/time/rate/rate.go b/vendor/golang.org/x/time/rate/rate.go index 794b2e32b..563270c15 100644 --- a/vendor/golang.org/x/time/rate/rate.go +++ b/vendor/golang.org/x/time/rate/rate.go @@ -195,7 +195,7 @@ func (r *Reservation) CancelAt(t time.Time) { // update state r.lim.last = t r.lim.tokens = tokens - if r.timeToAct == r.lim.lastEvent { + if r.timeToAct.Equal(r.lim.lastEvent) { prevEvent := r.timeToAct.Add(r.limit.durationFromTokens(float64(-r.tokens))) if !prevEvent.Before(t) { r.lim.lastEvent = prevEvent diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go index 8b462f3df..0b789e2c5 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/annotations.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go index db7806cb9..f84048172 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go index 08505ba3f..5d583b866 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_behavior.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go index a462e7d01..53e9dd1e9 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/field_info.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go index c93b4f524..d30fcee4c 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go index a1c543a94..175974a86 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go index 2b54db304..b8c4aa71f 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go b/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go index 498020e33..a69c1d473 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/launch_stage.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go index bd46edbe7..85a9387f7 100644 --- a/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/rpc/code/code.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go index 3cd9a5bb8..e017ef071 100644 --- a/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/rpc/errdetails/error_details.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. @@ -703,6 +703,65 @@ type QuotaFailure_Violation struct { // For example: "Service disabled" or "Daily Limit for read operations // exceeded". Description string `protobuf:"bytes,2,opt,name=description,proto3" json:"description,omitempty"` + // The API Service from which the `QuotaFailure.Violation` orginates. In + // some cases, Quota issues originate from an API Service other than the one + // that was called. In other words, a dependency of the called API Service + // could be the cause of the `QuotaFailure`, and this field would have the + // dependency API service name. + // + // For example, if the called API is Kubernetes Engine API + // (container.googleapis.com), and a quota violation occurs in the + // Kubernetes Engine API itself, this field would be + // "container.googleapis.com". On the other hand, if the quota violation + // occurs when the Kubernetes Engine API creates VMs in the Compute Engine + // API (compute.googleapis.com), this field would be + // "compute.googleapis.com". + ApiService string `protobuf:"bytes,3,opt,name=api_service,json=apiService,proto3" json:"api_service,omitempty"` + // The metric of the violated quota. A quota metric is a named counter to + // measure usage, such as API requests or CPUs. When an activity occurs in a + // service, such as Virtual Machine allocation, one or more quota metrics + // may be affected. + // + // For example, "compute.googleapis.com/cpus_per_vm_family", + // "storage.googleapis.com/internet_egress_bandwidth". + QuotaMetric string `protobuf:"bytes,4,opt,name=quota_metric,json=quotaMetric,proto3" json:"quota_metric,omitempty"` + // The id of the violated quota. Also know as "limit name", this is the + // unique identifier of a quota in the context of an API service. + // + // For example, "CPUS-PER-VM-FAMILY-per-project-region". + QuotaId string `protobuf:"bytes,5,opt,name=quota_id,json=quotaId,proto3" json:"quota_id,omitempty"` + // The dimensions of the violated quota. Every non-global quota is enforced + // on a set of dimensions. While quota metric defines what to count, the + // dimensions specify for what aspects the counter should be increased. + // + // For example, the quota "CPUs per region per VM family" enforces a limit + // on the metric "compute.googleapis.com/cpus_per_vm_family" on dimensions + // "region" and "vm_family". And if the violation occurred in region + // "us-central1" and for VM family "n1", the quota_dimensions would be, + // + // { + // "region": "us-central1", + // "vm_family": "n1", + // } + // + // When a quota is enforced globally, the quota_dimensions would always be + // empty. + QuotaDimensions map[string]string `protobuf:"bytes,6,rep,name=quota_dimensions,json=quotaDimensions,proto3" json:"quota_dimensions,omitempty" protobuf_key:"bytes,1,opt,name=key,proto3" protobuf_val:"bytes,2,opt,name=value,proto3"` + // The enforced quota value at the time of the `QuotaFailure`. + // + // For example, if the enforced quota value at the time of the + // `QuotaFailure` on the number of CPUs is "10", then the value of this + // field would reflect this quantity. + QuotaValue int64 `protobuf:"varint,7,opt,name=quota_value,json=quotaValue,proto3" json:"quota_value,omitempty"` + // The new quota value being rolled out at the time of the violation. At the + // completion of the rollout, this value will be enforced in place of + // quota_value. If no rollout is in progress at the time of the violation, + // this field is not set. + // + // For example, if at the time of the violation a rollout is in progress + // changing the number of CPUs quota from 10 to 20, 20 would be the value of + // this field. + FutureQuotaValue *int64 `protobuf:"varint,8,opt,name=future_quota_value,json=futureQuotaValue,proto3,oneof" json:"future_quota_value,omitempty"` } func (x *QuotaFailure_Violation) Reset() { @@ -751,6 +810,48 @@ func (x *QuotaFailure_Violation) GetDescription() string { return "" } +func (x *QuotaFailure_Violation) GetApiService() string { + if x != nil { + return x.ApiService + } + return "" +} + +func (x *QuotaFailure_Violation) GetQuotaMetric() string { + if x != nil { + return x.QuotaMetric + } + return "" +} + +func (x *QuotaFailure_Violation) GetQuotaId() string { + if x != nil { + return x.QuotaId + } + return "" +} + +func (x *QuotaFailure_Violation) GetQuotaDimensions() map[string]string { + if x != nil { + return x.QuotaDimensions + } + return nil +} + +func (x *QuotaFailure_Violation) GetQuotaValue() int64 { + if x != nil { + return x.QuotaValue + } + return 0 +} + +func (x *QuotaFailure_Violation) GetFutureQuotaValue() int64 { + if x != nil && x.FutureQuotaValue != nil { + return *x.FutureQuotaValue + } + return 0 +} + // A message type used to describe a single precondition failure. type PreconditionFailure_Violation struct { state protoimpl.MessageState @@ -775,7 +876,7 @@ type PreconditionFailure_Violation struct { func (x *PreconditionFailure_Violation) Reset() { *x = PreconditionFailure_Violation{} if protoimpl.UnsafeEnabled { - mi := &file_google_rpc_error_details_proto_msgTypes[12] + mi := &file_google_rpc_error_details_proto_msgTypes[13] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -788,7 +889,7 @@ func (x *PreconditionFailure_Violation) String() string { func (*PreconditionFailure_Violation) ProtoMessage() {} func (x *PreconditionFailure_Violation) ProtoReflect() protoreflect.Message { - mi := &file_google_rpc_error_details_proto_msgTypes[12] + mi := &file_google_rpc_error_details_proto_msgTypes[13] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -886,7 +987,7 @@ type BadRequest_FieldViolation struct { func (x *BadRequest_FieldViolation) Reset() { *x = BadRequest_FieldViolation{} if protoimpl.UnsafeEnabled { - mi := &file_google_rpc_error_details_proto_msgTypes[13] + mi := &file_google_rpc_error_details_proto_msgTypes[14] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -899,7 +1000,7 @@ func (x *BadRequest_FieldViolation) String() string { func (*BadRequest_FieldViolation) ProtoMessage() {} func (x *BadRequest_FieldViolation) ProtoReflect() protoreflect.Message { - mi := &file_google_rpc_error_details_proto_msgTypes[13] + mi := &file_google_rpc_error_details_proto_msgTypes[14] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -958,7 +1059,7 @@ type Help_Link struct { func (x *Help_Link) Reset() { *x = Help_Link{} if protoimpl.UnsafeEnabled { - mi := &file_google_rpc_error_details_proto_msgTypes[14] + mi := &file_google_rpc_error_details_proto_msgTypes[15] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -971,7 +1072,7 @@ func (x *Help_Link) String() string { func (*Help_Link) ProtoMessage() {} func (x *Help_Link) ProtoReflect() protoreflect.Message { - mi := &file_google_rpc_error_details_proto_msgTypes[14] + mi := &file_google_rpc_error_details_proto_msgTypes[15] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -1029,79 +1130,102 @@ var file_google_rpc_error_details_proto_rawDesc = []byte{ 0x0a, 0x0d, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x5f, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x73, 0x74, 0x61, 0x63, 0x6b, 0x45, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x12, 0x16, 0x0a, 0x06, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x06, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x22, 0x9b, 0x01, 0x0a, 0x0c, + 0x01, 0x28, 0x09, 0x52, 0x06, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x22, 0x8e, 0x04, 0x0a, 0x0c, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x12, 0x42, 0x0a, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x1a, 0x47, 0x0a, 0x09, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, 0x0a, - 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, - 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xbd, 0x01, 0x0a, 0x13, 0x50, 0x72, - 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, - 0x65, 0x12, 0x49, 0x0a, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, - 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, - 0x70, 0x63, 0x2e, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x46, - 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x5b, 0x0a, 0x09, - 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x18, 0x0a, - 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, - 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x02, 0x0a, 0x0a, 0x42, 0x61, - 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x10, 0x66, 0x69, 0x65, 0x6c, - 0x64, 0x5f, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, - 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x66, 0x69, 0x65, 0x6c, 0x64, - 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xab, 0x01, 0x0a, 0x0e, 0x46, - 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, - 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x66, 0x69, - 0x65, 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x12, 0x49, 0x0a, - 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, - 0x67, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, - 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, - 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0x4f, 0x0a, 0x0b, 0x52, 0x65, 0x71, 0x75, - 0x65, 0x73, 0x74, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, 0x71, 0x75, 0x65, - 0x73, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x72, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, - 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x73, 0x65, - 0x72, 0x76, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a, 0x0c, 0x52, 0x65, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, - 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, 0x70, 0x65, 0x12, - 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, - 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x6f, 0x0a, 0x04, - 0x48, 0x65, 0x6c, 0x70, 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x18, 0x01, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, - 0x2e, 0x48, 0x65, 0x6c, 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c, 0x69, 0x6e, 0x6b, - 0x73, 0x1a, 0x3a, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, - 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10, 0x0a, 0x03, 0x75, - 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, 0x22, 0x44, 0x0a, - 0x10, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, - 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, 0x73, - 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x73, 0x73, - 0x61, 0x67, 0x65, 0x42, 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x72, 0x70, 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44, 0x65, 0x74, 0x61, - 0x69, 0x6c, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, - 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, - 0x73, 0x2f, 0x72, 0x70, 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, - 0x3b, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02, 0x03, 0x52, 0x50, - 0x43, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x1a, 0xb9, 0x03, 0x0a, 0x09, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, + 0x0a, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, + 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, + 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x70, + 0x69, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0a, 0x61, 0x70, 0x69, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x71, + 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x6d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x18, 0x04, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0b, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x4d, 0x65, 0x74, 0x72, 0x69, 0x63, 0x12, 0x19, + 0x0a, 0x08, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x69, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x07, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x49, 0x64, 0x12, 0x62, 0x0a, 0x10, 0x71, 0x75, 0x6f, + 0x74, 0x61, 0x5f, 0x64, 0x69, 0x6d, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20, + 0x03, 0x28, 0x0b, 0x32, 0x37, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, + 0x2e, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69, + 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x44, 0x69, 0x6d, + 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x71, 0x75, + 0x6f, 0x74, 0x61, 0x44, 0x69, 0x6d, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, + 0x0b, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, + 0x28, 0x03, 0x52, 0x0a, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x31, + 0x0a, 0x12, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x5f, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x03, 0x48, 0x00, 0x52, 0x10, 0x66, 0x75, + 0x74, 0x75, 0x72, 0x65, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x88, 0x01, + 0x01, 0x1a, 0x42, 0x0a, 0x14, 0x51, 0x75, 0x6f, 0x74, 0x61, 0x44, 0x69, 0x6d, 0x65, 0x6e, 0x73, + 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, + 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, + 0x65, 0x3a, 0x02, 0x38, 0x01, 0x42, 0x15, 0x0a, 0x13, 0x5f, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, + 0x5f, 0x71, 0x75, 0x6f, 0x74, 0x61, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0xbd, 0x01, 0x0a, + 0x13, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x46, 0x61, 0x69, + 0x6c, 0x75, 0x72, 0x65, 0x12, 0x49, 0x0a, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, + 0x6e, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, + 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x50, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, + 0x6f, 0x6e, 0x46, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x2e, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, + 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, + 0x5b, 0x0a, 0x09, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x12, 0x0a, 0x04, + 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, + 0x12, 0x18, 0x0a, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x07, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, + 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x8c, 0x02, 0x0a, + 0x0a, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x10, 0x66, + 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, + 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, + 0x70, 0x63, 0x2e, 0x42, 0x61, 0x64, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x2e, 0x46, 0x69, + 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0f, 0x66, 0x69, + 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0xab, 0x01, + 0x0a, 0x0e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x56, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x12, 0x14, 0x0a, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x12, 0x20, 0x0a, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, + 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, + 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x06, 0x72, 0x65, 0x61, 0x73, + 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, + 0x12, 0x49, 0x0a, 0x11, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x5f, 0x6d, 0x65, + 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, + 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c, + 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x22, 0x4f, 0x0a, 0x0b, 0x52, + 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x1d, 0x0a, 0x0a, 0x72, 0x65, + 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x69, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, + 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x49, 0x64, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x65, 0x72, + 0x76, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0b, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, 0x67, 0x44, 0x61, 0x74, 0x61, 0x22, 0x90, 0x01, 0x0a, + 0x0c, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x23, 0x0a, + 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x54, 0x79, + 0x70, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x6e, + 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x6f, 0x75, + 0x72, 0x63, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, + 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x12, 0x20, 0x0a, + 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, + 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, + 0x6f, 0x0a, 0x04, 0x48, 0x65, 0x6c, 0x70, 0x12, 0x2b, 0x0a, 0x05, 0x6c, 0x69, 0x6e, 0x6b, 0x73, + 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x15, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, + 0x72, 0x70, 0x63, 0x2e, 0x48, 0x65, 0x6c, 0x70, 0x2e, 0x4c, 0x69, 0x6e, 0x6b, 0x52, 0x05, 0x6c, + 0x69, 0x6e, 0x6b, 0x73, 0x1a, 0x3a, 0x0a, 0x04, 0x4c, 0x69, 0x6e, 0x6b, 0x12, 0x20, 0x0a, 0x0b, + 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, + 0x09, 0x52, 0x0b, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x10, + 0x0a, 0x03, 0x75, 0x72, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x75, 0x72, 0x6c, + 0x22, 0x44, 0x0a, 0x10, 0x4c, 0x6f, 0x63, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x4d, 0x65, 0x73, + 0x73, 0x61, 0x67, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x06, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x65, 0x12, 0x18, 0x0a, 0x07, + 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x6d, + 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x42, 0x6c, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x72, 0x70, 0x63, 0x42, 0x11, 0x45, 0x72, 0x72, 0x6f, 0x72, 0x44, + 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, + 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, + 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x61, 0x70, 0x69, 0x73, 0x2f, 0x72, 0x70, 0x63, 0x2f, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, + 0x69, 0x6c, 0x73, 0x3b, 0x65, 0x72, 0x72, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0xa2, 0x02, + 0x03, 0x52, 0x50, 0x43, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( @@ -1116,7 +1240,7 @@ func file_google_rpc_error_details_proto_rawDescGZIP() []byte { return file_google_rpc_error_details_proto_rawDescData } -var file_google_rpc_error_details_proto_msgTypes = make([]protoimpl.MessageInfo, 15) +var file_google_rpc_error_details_proto_msgTypes = make([]protoimpl.MessageInfo, 16) var file_google_rpc_error_details_proto_goTypes = []interface{}{ (*ErrorInfo)(nil), // 0: google.rpc.ErrorInfo (*RetryInfo)(nil), // 1: google.rpc.RetryInfo @@ -1130,24 +1254,26 @@ var file_google_rpc_error_details_proto_goTypes = []interface{}{ (*LocalizedMessage)(nil), // 9: google.rpc.LocalizedMessage nil, // 10: google.rpc.ErrorInfo.MetadataEntry (*QuotaFailure_Violation)(nil), // 11: google.rpc.QuotaFailure.Violation - (*PreconditionFailure_Violation)(nil), // 12: google.rpc.PreconditionFailure.Violation - (*BadRequest_FieldViolation)(nil), // 13: google.rpc.BadRequest.FieldViolation - (*Help_Link)(nil), // 14: google.rpc.Help.Link - (*durationpb.Duration)(nil), // 15: google.protobuf.Duration + nil, // 12: google.rpc.QuotaFailure.Violation.QuotaDimensionsEntry + (*PreconditionFailure_Violation)(nil), // 13: google.rpc.PreconditionFailure.Violation + (*BadRequest_FieldViolation)(nil), // 14: google.rpc.BadRequest.FieldViolation + (*Help_Link)(nil), // 15: google.rpc.Help.Link + (*durationpb.Duration)(nil), // 16: google.protobuf.Duration } var file_google_rpc_error_details_proto_depIdxs = []int32{ 10, // 0: google.rpc.ErrorInfo.metadata:type_name -> google.rpc.ErrorInfo.MetadataEntry - 15, // 1: google.rpc.RetryInfo.retry_delay:type_name -> google.protobuf.Duration + 16, // 1: google.rpc.RetryInfo.retry_delay:type_name -> google.protobuf.Duration 11, // 2: google.rpc.QuotaFailure.violations:type_name -> google.rpc.QuotaFailure.Violation - 12, // 3: google.rpc.PreconditionFailure.violations:type_name -> google.rpc.PreconditionFailure.Violation - 13, // 4: google.rpc.BadRequest.field_violations:type_name -> google.rpc.BadRequest.FieldViolation - 14, // 5: google.rpc.Help.links:type_name -> google.rpc.Help.Link - 9, // 6: google.rpc.BadRequest.FieldViolation.localized_message:type_name -> google.rpc.LocalizedMessage - 7, // [7:7] is the sub-list for method output_type - 7, // [7:7] is the sub-list for method input_type - 7, // [7:7] is the sub-list for extension type_name - 7, // [7:7] is the sub-list for extension extendee - 0, // [0:7] is the sub-list for field type_name + 13, // 3: google.rpc.PreconditionFailure.violations:type_name -> google.rpc.PreconditionFailure.Violation + 14, // 4: google.rpc.BadRequest.field_violations:type_name -> google.rpc.BadRequest.FieldViolation + 15, // 5: google.rpc.Help.links:type_name -> google.rpc.Help.Link + 12, // 6: google.rpc.QuotaFailure.Violation.quota_dimensions:type_name -> google.rpc.QuotaFailure.Violation.QuotaDimensionsEntry + 9, // 7: google.rpc.BadRequest.FieldViolation.localized_message:type_name -> google.rpc.LocalizedMessage + 8, // [8:8] is the sub-list for method output_type + 8, // [8:8] is the sub-list for method input_type + 8, // [8:8] is the sub-list for extension type_name + 8, // [8:8] is the sub-list for extension extendee + 0, // [0:8] is the sub-list for field type_name } func init() { file_google_rpc_error_details_proto_init() } @@ -1288,7 +1414,7 @@ func file_google_rpc_error_details_proto_init() { return nil } } - file_google_rpc_error_details_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { + file_google_rpc_error_details_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*PreconditionFailure_Violation); i { case 0: return &v.state @@ -1300,7 +1426,7 @@ func file_google_rpc_error_details_proto_init() { return nil } } - file_google_rpc_error_details_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { + file_google_rpc_error_details_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*BadRequest_FieldViolation); i { case 0: return &v.state @@ -1312,7 +1438,7 @@ func file_google_rpc_error_details_proto_init() { return nil } } - file_google_rpc_error_details_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { + file_google_rpc_error_details_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*Help_Link); i { case 0: return &v.state @@ -1325,13 +1451,14 @@ func file_google_rpc_error_details_proto_init() { } } } + file_google_rpc_error_details_proto_msgTypes[11].OneofWrappers = []interface{}{} type x struct{} out := protoimpl.TypeBuilder{ File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_google_rpc_error_details_proto_rawDesc, NumEnums: 0, - NumMessages: 15, + NumMessages: 16, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go index 6ad1b1c1d..06a3f7106 100644 --- a/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/rpc/status/status.pb.go @@ -1,4 +1,4 @@ -// Copyright 2024 Google LLC +// Copyright 2025 Google LLC // // Licensed under the Apache License, Version 2.0 (the "License"); // you may not use this file except in compliance with the License. diff --git a/vendor/google.golang.org/grpc/CONTRIBUTING.md b/vendor/google.golang.org/grpc/CONTRIBUTING.md index d9bfa6e1e..2079de7b0 100644 --- a/vendor/google.golang.org/grpc/CONTRIBUTING.md +++ b/vendor/google.golang.org/grpc/CONTRIBUTING.md @@ -1,73 +1,159 @@ # How to contribute -We definitely welcome your patches and contributions to gRPC! Please read the gRPC -organization's [governance rules](https://github.com/grpc/grpc-community/blob/master/governance.md) -and [contribution guidelines](https://github.com/grpc/grpc-community/blob/master/CONTRIBUTING.md) before proceeding. +We welcome your patches and contributions to gRPC! Please read the gRPC +organization's [governance +rules](https://github.com/grpc/grpc-community/blob/master/governance.md) before +proceeding. If you are new to GitHub, please start by reading [Pull Request howto](https://help.github.com/articles/about-pull-requests/) ## Legal requirements In order to protect both you and ourselves, you will need to sign the -[Contributor License Agreement](https://identity.linuxfoundation.org/projects/cncf). +[Contributor License +Agreement](https://identity.linuxfoundation.org/projects/cncf). When you create +your first PR, a link will be added as a comment that contains the steps needed +to complete this process. + +## Getting Started + +A great way to start is by searching through our open issues. [Unassigned issues +labeled as "help +wanted"](https://github.com/grpc/grpc-go/issues?q=sort%3Aupdated-desc%20is%3Aissue%20is%3Aopen%20label%3A%22Status%3A%20Help%20Wanted%22%20no%3Aassignee) +are especially nice for first-time contributors, as they should be well-defined +problems that already have agreed-upon solutions. + +## Code Style + +We follow [Google's published Go style +guide](https://google.github.io/styleguide/go/). Note that there are three +primary documents that make up this style guide; please follow them as closely +as possible. If a reviewer recommends something that contradicts those +guidelines, there may be valid reasons to do so, but it should be rare. ## Guidelines for Pull Requests -How to get your contributions merged smoothly and quickly. + +Please read the following carefully to ensure your contributions can be merged +smoothly and quickly. + +### PR Contents - Create **small PRs** that are narrowly focused on **addressing a single - concern**. We often times receive PRs that are trying to fix several things at - a time, but only one fix is considered acceptable, nothing gets merged and - both author's & review's time is wasted. Create more PRs to address different - concerns and everyone will be happy. + concern**. We often receive PRs that attempt to fix several things at the same + time, and if one part of the PR has a problem, that will hold up the entire + PR. + +- If your change does not address an **open issue** with an **agreed + resolution**, consider opening an issue and discussing it first. If you are + suggesting a behavioral or API change, consider starting with a [gRFC + proposal](https://github.com/grpc/proposal). Many new features that are not + bug fixes will require cross-language agreement. + +- If you want to fix **formatting or style**, consider whether your changes are + an obvious improvement or might be considered a personal preference. If a + style change is based on preference, it likely will not be accepted. If it + corrects widely agreed-upon anti-patterns, then please do create a PR and + explain the benefits of the change. + +- For correcting **misspellings**, please be aware that we use some terms that + are sometimes flagged by spell checkers. As an example, "if an only if" is + often written as "iff". Please do not make spelling correction changes unless + you are certain they are misspellings. + +- **All tests need to be passing** before your change can be merged. We + recommend you run tests locally before creating your PR to catch breakages + early on: -- If you are searching for features to work on, issues labeled [Status: Help - Wanted](https://github.com/grpc/grpc-go/issues?q=is%3Aissue+is%3Aopen+sort%3Aupdated-desc+label%3A%22Status%3A+Help+Wanted%22) - is a great place to start. These issues are well-documented and usually can be - resolved with a single pull request. + - `./scripts/vet.sh` to catch vet errors. + - `go test -cpu 1,4 -timeout 7m ./...` to run the tests. + - `go test -race -cpu 1,4 -timeout 7m ./...` to run tests in race mode. -- If you are adding a new file, make sure it has the copyright message template - at the top as a comment. You can copy over the message from an existing file - and update the year. + Note that we have a multi-module repo, so `go test` commands may need to be + run from the root of each module in order to cause all tests to run. + + *Alternatively*, you may find it easier to push your changes to your fork on + GitHub, which will trigger a GitHub Actions run that you can use to verify + everything is passing. + +- Note that there are two GitHub actions checks that need not be green: + + 1. We test the freshness of the generated proto code we maintain via the + `vet-proto` check. If the source proto files are updated, but our repo is + not updated, an optional checker will fail. This will be fixed by our team + in a separate PR and will not prevent the merge of your PR. + + 2. We run a checker that will fail if there is any change in dependencies of + an exported package via the `dependencies` check. If new dependencies are + added that are not appropriate, we may not accept your PR (see below). + +- If you are adding a **new file**, make sure it has the **copyright message** + template at the top as a comment. You can copy the message from an existing + file and update the year. - The grpc package should only depend on standard Go packages and a small number - of exceptions. If your contribution introduces new dependencies which are NOT - in the [list](https://godoc.org/google.golang.org/grpc?imports), you need a - discussion with gRPC-Go authors and consultants. + of exceptions. **If your contribution introduces new dependencies**, you will + need a discussion with gRPC-Go maintainers. -- For speculative changes, consider opening an issue and discussing it first. If - you are suggesting a behavioral or API change, consider starting with a [gRFC - proposal](https://github.com/grpc/proposal). +### PR Descriptions -- Provide a good **PR description** as a record of **what** change is being made - and **why** it was made. Link to a GitHub issue if it exists. +- **PR titles** should start with the name of the component being addressed, or + the type of change. Examples: transport, client, server, round_robin, xds, + cleanup, deps. -- If you want to fix formatting or style, consider whether your changes are an - obvious improvement or might be considered a personal preference. If a style - change is based on preference, it likely will not be accepted. If it corrects - widely agreed-upon anti-patterns, then please do create a PR and explain the - benefits of the change. +- Read and follow the **guidelines for PR titles and descriptions** here: + https://google.github.io/eng-practices/review/developer/cl-descriptions.html -- Unless your PR is trivial, you should expect there will be reviewer comments - that you'll need to address before merging. We'll mark it as `Status: Requires - Reporter Clarification` if we expect you to respond to these comments in a - timely manner. If the PR remains inactive for 6 days, it will be marked as - `stale` and automatically close 7 days after that if we don't hear back from - you. + *particularly* the sections "First Line" and "Body is Informative". -- Maintain **clean commit history** and use **meaningful commit messages**. PRs - with messy commit history are difficult to review and won't be merged. Use - `rebase -i upstream/master` to curate your commit history and/or to bring in - latest changes from master (but avoid rebasing in the middle of a code - review). + Note: your PR description will be used as the git commit message in a + squash-and-merge if your PR is approved. We may make changes to this as + necessary. -- Keep your PR up to date with upstream/master (if there are merge conflicts, we - can't really merge your change). +- **Does this PR relate to an open issue?** On the first line, please use the + tag `Fixes #` to ensure the issue is closed when the PR is merged. Or + use `Updates #` if the PR is related to an open issue, but does not fix + it. Consider filing an issue if one does not already exist. -- **All tests need to be passing** before your change can be merged. We - recommend you **run tests locally** before creating your PR to catch breakages - early on. - - `./scripts/vet.sh` to catch vet errors - - `go test -cpu 1,4 -timeout 7m ./...` to run the tests - - `go test -race -cpu 1,4 -timeout 7m ./...` to run tests in race mode +- PR descriptions *must* conclude with **release notes** as follows: + + ``` + RELEASE NOTES: + * : + ``` + + This need not match the PR title. + + The summary must: + + * be something that gRPC users will understand. + + * clearly explain the feature being added, the issue being fixed, or the + behavior being changed, etc. If fixing a bug, be clear about how the bug + can be triggered by an end-user. + + * begin with a capital letter and use complete sentences. -- Exceptions to the rules can be made if there's a compelling reason for doing so. + * be as short as possible to describe the change being made. + + If a PR is *not* end-user visible -- e.g. a cleanup, testing change, or + GitHub-related, use `RELEASE NOTES: n/a`. + +### PR Process + +- Please **self-review** your code changes before sending your PR. This will + prevent simple, obvious errors from causing delays. + +- Maintain a **clean commit history** and use **meaningful commit messages**. + PRs with messy commit histories are difficult to review and won't be merged. + Before sending your PR, ensure your changes are based on top of the latest + `upstream/master` commits, and avoid rebasing in the middle of a code review. + You should **never use `git push -f`** unless absolutely necessary during a + review, as it can interfere with GitHub's tracking of comments. + +- Unless your PR is trivial, you should **expect reviewer comments** that you + will need to address before merging. We'll label the PR as `Status: Requires + Reporter Clarification` if we expect you to respond to these comments in a + timely manner. If the PR remains inactive for 6 days, it will be marked as + `stale`, and we will automatically close it after 7 days if we don't hear back + from you. Please feel free to ping issues or bugs if you do not get a response + within a week. diff --git a/vendor/google.golang.org/grpc/MAINTAINERS.md b/vendor/google.golang.org/grpc/MAINTAINERS.md index 5d4096d46..df35bb9a8 100644 --- a/vendor/google.golang.org/grpc/MAINTAINERS.md +++ b/vendor/google.golang.org/grpc/MAINTAINERS.md @@ -9,21 +9,19 @@ for general contribution guidelines. ## Maintainers (in alphabetical order) -- [aranjans](https://github.com/aranjans), Google LLC - [arjan-bal](https://github.com/arjan-bal), Google LLC - [arvindbr8](https://github.com/arvindbr8), Google LLC - [atollena](https://github.com/atollena), Datadog, Inc. - [dfawley](https://github.com/dfawley), Google LLC - [easwars](https://github.com/easwars), Google LLC -- [erm-g](https://github.com/erm-g), Google LLC - [gtcooke94](https://github.com/gtcooke94), Google LLC -- [purnesh42h](https://github.com/purnesh42h), Google LLC -- [zasweq](https://github.com/zasweq), Google LLC ## Emeritus Maintainers (in alphabetical order) - [adelez](https://github.com/adelez) +- [aranjans](https://github.com/aranjans) - [canguler](https://github.com/canguler) - [cesarghali](https://github.com/cesarghali) +- [erm-g](https://github.com/erm-g) - [iamqizhao](https://github.com/iamqizhao) - [jeanbza](https://github.com/jeanbza) - [jtattermusch](https://github.com/jtattermusch) @@ -32,5 +30,7 @@ for general contribution guidelines. - [matt-kwong](https://github.com/matt-kwong) - [menghanl](https://github.com/menghanl) - [nicolasnoble](https://github.com/nicolasnoble) +- [purnesh42h](https://github.com/purnesh42h) - [srini100](https://github.com/srini100) - [yongni](https://github.com/yongni) +- [zasweq](https://github.com/zasweq) diff --git a/vendor/google.golang.org/grpc/README.md b/vendor/google.golang.org/grpc/README.md index b572707c6..f9a88d597 100644 --- a/vendor/google.golang.org/grpc/README.md +++ b/vendor/google.golang.org/grpc/README.md @@ -32,6 +32,7 @@ import "google.golang.org/grpc" - [Low-level technical docs](Documentation) from this repository - [Performance benchmark][] - [Examples](examples) +- [Contribution guidelines](CONTRIBUTING.md) ## FAQ diff --git a/vendor/google.golang.org/grpc/balancer/balancer.go b/vendor/google.golang.org/grpc/balancer/balancer.go index c9b343c71..b1264017d 100644 --- a/vendor/google.golang.org/grpc/balancer/balancer.go +++ b/vendor/google.golang.org/grpc/balancer/balancer.go @@ -360,6 +360,10 @@ type Balancer interface { // call SubConn.Shutdown for its existing SubConns; however, this will be // required in a future release, so it is recommended. Close() + // ExitIdle instructs the LB policy to reconnect to backends / exit the + // IDLE state, if appropriate and possible. Note that SubConns that enter + // the IDLE state will not reconnect until SubConn.Connect is called. + ExitIdle() } // ExitIdler is an optional interface for balancers to implement. If @@ -367,8 +371,8 @@ type Balancer interface { // the ClientConn is idle. If unimplemented, ClientConn.Connect will cause // all SubConns to connect. // -// Notice: it will be required for all balancers to implement this in a future -// release. +// Deprecated: All balancers must implement this interface. This interface will +// be removed in a future release. type ExitIdler interface { // ExitIdle instructs the LB policy to reconnect to backends / exit the // IDLE state, if appropriate and possible. Note that SubConns that enter diff --git a/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go b/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go index cc606f4da..360db08eb 100644 --- a/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go +++ b/vendor/google.golang.org/grpc/balancer/endpointsharding/endpointsharding.go @@ -37,6 +37,8 @@ import ( "google.golang.org/grpc/resolver" ) +var randIntN = rand.IntN + // ChildState is the balancer state of a child along with the endpoint which // identifies the child balancer. type ChildState struct { @@ -45,7 +47,15 @@ type ChildState struct { // Balancer exposes only the ExitIdler interface of the child LB policy. // Other methods of the child policy are called only by endpointsharding. - Balancer balancer.ExitIdler + Balancer ExitIdler +} + +// ExitIdler provides access to only the ExitIdle method of the child balancer. +type ExitIdler interface { + // ExitIdle instructs the LB policy to reconnect to backends / exit the + // IDLE state, if appropriate and possible. Note that SubConns that enter + // the IDLE state will not reconnect until SubConn.Connect is called. + ExitIdle() } // Options are the options to configure the behaviour of the @@ -104,6 +114,21 @@ type endpointSharding struct { mu sync.Mutex } +// rotateEndpoints returns a slice of all the input endpoints rotated a random +// amount. +func rotateEndpoints(es []resolver.Endpoint) []resolver.Endpoint { + les := len(es) + if les == 0 { + return es + } + r := randIntN(les) + // Make a copy to avoid mutating data beyond the end of es. + ret := make([]resolver.Endpoint, les) + copy(ret, es[r:]) + copy(ret[les-r:], es[:r]) + return ret +} + // UpdateClientConnState creates a child for new endpoints and deletes children // for endpoints that are no longer present. It also updates all the children, // and sends a single synchronous update of the childrens' aggregated state at @@ -125,7 +150,7 @@ func (es *endpointSharding) UpdateClientConnState(state balancer.ClientConnState newChildren := resolver.NewEndpointMap[*balancerWrapper]() // Update/Create new children. - for _, endpoint := range state.ResolverState.Endpoints { + for _, endpoint := range rotateEndpoints(state.ResolverState.Endpoints) { if _, ok := newChildren.Get(endpoint); ok { // Endpoint child was already created, continue to avoid duplicate // update. @@ -205,6 +230,16 @@ func (es *endpointSharding) Close() { } } +func (es *endpointSharding) ExitIdle() { + es.childMu.Lock() + defer es.childMu.Unlock() + for _, bw := range es.children.Load().Values() { + if !bw.isClosed { + bw.child.ExitIdle() + } + } +} + // updateState updates this component's state. It sends the aggregated state, // and a picker with round robin behavior with all the child states present if // needed. @@ -261,7 +296,7 @@ func (es *endpointSharding) updateState() { p := &pickerWithChildStates{ pickers: pickers, childStates: childStates, - next: uint32(rand.IntN(len(pickers))), + next: uint32(randIntN(len(pickers))), } es.cc.UpdateState(balancer.State{ ConnectivityState: aggState, @@ -326,15 +361,13 @@ func (bw *balancerWrapper) UpdateState(state balancer.State) { // ExitIdle pings an IDLE child balancer to exit idle in a new goroutine to // avoid deadlocks due to synchronous balancer state updates. func (bw *balancerWrapper) ExitIdle() { - if ei, ok := bw.child.(balancer.ExitIdler); ok { - go func() { - bw.es.childMu.Lock() - if !bw.isClosed { - ei.ExitIdle() - } - bw.es.childMu.Unlock() - }() - } + go func() { + bw.es.childMu.Lock() + if !bw.isClosed { + bw.child.ExitIdle() + } + bw.es.childMu.Unlock() + }() } // updateClientConnStateLocked delivers the ClientConnState to the child diff --git a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go index 732eb56bb..01ac7f6f3 100644 --- a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go +++ b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer.pb.go @@ -19,7 +19,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.36.5 +// protoc-gen-go v1.36.6 // protoc v5.27.1 // source: grpc/lb/v1/load_balancer.proto @@ -642,115 +642,47 @@ func (x *Server) GetDrop() bool { var File_grpc_lb_v1_load_balancer_proto protoreflect.FileDescriptor -var file_grpc_lb_v1_load_balancer_proto_rawDesc = string([]byte{ - 0x0a, 0x1e, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x6c, 0x62, 0x2f, 0x76, 0x31, 0x2f, 0x6c, 0x6f, 0x61, - 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x12, 0x0a, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x1a, 0x1e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x1a, 0x1f, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x69, - 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xc1, 0x01, - 0x0a, 0x12, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x12, 0x50, 0x0a, 0x0f, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, - 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, - 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x49, 0x6e, 0x69, 0x74, 0x69, - 0x61, 0x6c, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x71, - 0x75, 0x65, 0x73, 0x74, 0x48, 0x00, 0x52, 0x0e, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x52, - 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x3c, 0x0a, 0x0c, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, - 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x53, 0x74, 0x61, 0x74, 0x73, 0x48, 0x00, 0x52, 0x0b, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, - 0x74, 0x61, 0x74, 0x73, 0x42, 0x1b, 0x0a, 0x19, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x62, 0x61, 0x6c, - 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x5f, 0x74, 0x79, 0x70, - 0x65, 0x22, 0x2f, 0x0a, 0x19, 0x49, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x4c, 0x6f, 0x61, 0x64, - 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x12, 0x12, - 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, - 0x6d, 0x65, 0x22, 0x60, 0x0a, 0x13, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74, - 0x73, 0x50, 0x65, 0x72, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x2c, 0x0a, 0x12, 0x6c, 0x6f, 0x61, - 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x6c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, - 0x63, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x1b, 0x0a, 0x09, 0x6e, 0x75, 0x6d, 0x5f, 0x63, - 0x61, 0x6c, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x08, 0x6e, 0x75, 0x6d, 0x43, - 0x61, 0x6c, 0x6c, 0x73, 0x22, 0xb0, 0x03, 0x0a, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, - 0x74, 0x61, 0x74, 0x73, 0x12, 0x38, 0x0a, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, - 0x70, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, - 0x61, 0x6d, 0x70, 0x52, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x12, 0x2a, - 0x0a, 0x11, 0x6e, 0x75, 0x6d, 0x5f, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x73, 0x74, 0x61, 0x72, - 0x74, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x03, 0x52, 0x0f, 0x6e, 0x75, 0x6d, 0x43, 0x61, - 0x6c, 0x6c, 0x73, 0x53, 0x74, 0x61, 0x72, 0x74, 0x65, 0x64, 0x12, 0x2c, 0x0a, 0x12, 0x6e, 0x75, - 0x6d, 0x5f, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x6e, 0x75, 0x6d, 0x43, 0x61, 0x6c, 0x6c, 0x73, - 0x46, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64, 0x12, 0x5d, 0x0a, 0x2d, 0x6e, 0x75, 0x6d, 0x5f, - 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64, 0x5f, 0x77, - 0x69, 0x74, 0x68, 0x5f, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x66, 0x61, 0x69, 0x6c, 0x65, - 0x64, 0x5f, 0x74, 0x6f, 0x5f, 0x73, 0x65, 0x6e, 0x64, 0x18, 0x06, 0x20, 0x01, 0x28, 0x03, 0x52, - 0x26, 0x6e, 0x75, 0x6d, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x46, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, - 0x64, 0x57, 0x69, 0x74, 0x68, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x46, 0x61, 0x69, 0x6c, 0x65, - 0x64, 0x54, 0x6f, 0x53, 0x65, 0x6e, 0x64, 0x12, 0x48, 0x0a, 0x21, 0x6e, 0x75, 0x6d, 0x5f, 0x63, - 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x65, 0x64, 0x5f, 0x6b, 0x6e, - 0x6f, 0x77, 0x6e, 0x5f, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x18, 0x07, 0x20, 0x01, - 0x28, 0x03, 0x52, 0x1d, 0x6e, 0x75, 0x6d, 0x43, 0x61, 0x6c, 0x6c, 0x73, 0x46, 0x69, 0x6e, 0x69, - 0x73, 0x68, 0x65, 0x64, 0x4b, 0x6e, 0x6f, 0x77, 0x6e, 0x52, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65, - 0x64, 0x12, 0x58, 0x0a, 0x18, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x5f, 0x66, 0x69, 0x6e, 0x69, 0x73, - 0x68, 0x65, 0x64, 0x5f, 0x77, 0x69, 0x74, 0x68, 0x5f, 0x64, 0x72, 0x6f, 0x70, 0x18, 0x08, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, - 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74, 0x73, 0x50, 0x65, 0x72, 0x54, - 0x6f, 0x6b, 0x65, 0x6e, 0x52, 0x15, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x46, 0x69, 0x6e, 0x69, 0x73, - 0x68, 0x65, 0x64, 0x57, 0x69, 0x74, 0x68, 0x44, 0x72, 0x6f, 0x70, 0x4a, 0x04, 0x08, 0x04, 0x10, - 0x05, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x22, 0x90, 0x02, 0x0a, 0x13, 0x4c, 0x6f, 0x61, 0x64, - 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, - 0x53, 0x0a, 0x10, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x72, 0x65, 0x73, 0x70, 0x6f, - 0x6e, 0x73, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x72, 0x70, 0x63, - 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x49, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x4c, 0x6f, - 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, - 0x65, 0x48, 0x00, 0x52, 0x0f, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x52, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x39, 0x0a, 0x0b, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x5f, 0x6c, - 0x69, 0x73, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, 0x72, 0x70, 0x63, - 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x4c, 0x69, 0x73, - 0x74, 0x48, 0x00, 0x52, 0x0a, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x4c, 0x69, 0x73, 0x74, 0x12, - 0x4b, 0x0a, 0x11, 0x66, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x5f, 0x72, 0x65, 0x73, 0x70, - 0x6f, 0x6e, 0x73, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, 0x67, 0x72, 0x70, - 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x46, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, - 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x48, 0x00, 0x52, 0x10, 0x66, 0x61, 0x6c, 0x6c, - 0x62, 0x61, 0x63, 0x6b, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x42, 0x1c, 0x0a, 0x1a, - 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x72, 0x65, 0x73, - 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x22, 0x12, 0x0a, 0x10, 0x46, 0x61, - 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x22, 0x7e, - 0x0a, 0x1a, 0x49, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, - 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x12, 0x5a, 0x0a, 0x1c, - 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x61, 0x74, 0x73, 0x5f, 0x72, 0x65, 0x70, - 0x6f, 0x72, 0x74, 0x5f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x19, 0x63, - 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x61, 0x74, 0x73, 0x52, 0x65, 0x70, 0x6f, 0x72, 0x74, - 0x49, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x4a, 0x04, 0x08, 0x01, 0x10, 0x02, 0x22, 0x40, - 0x0a, 0x0a, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x4c, 0x69, 0x73, 0x74, 0x12, 0x2c, 0x0a, 0x07, - 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, - 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65, - 0x72, 0x52, 0x07, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x73, 0x4a, 0x04, 0x08, 0x03, 0x10, 0x04, - 0x22, 0x83, 0x01, 0x0a, 0x06, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x12, 0x1d, 0x0a, 0x0a, 0x69, - 0x70, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52, - 0x09, 0x69, 0x70, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f, - 0x72, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x2c, - 0x0a, 0x12, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x5f, 0x74, - 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x10, 0x6c, 0x6f, 0x61, 0x64, - 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x12, 0x12, 0x0a, 0x04, - 0x64, 0x72, 0x6f, 0x70, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x52, 0x04, 0x64, 0x72, 0x6f, 0x70, - 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x32, 0x62, 0x0a, 0x0c, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, - 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x12, 0x52, 0x0a, 0x0b, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, - 0x65, 0x4c, 0x6f, 0x61, 0x64, 0x12, 0x1e, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, - 0x76, 0x31, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, - 0x71, 0x75, 0x65, 0x73, 0x74, 0x1a, 0x1f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, - 0x76, 0x31, 0x2e, 0x4c, 0x6f, 0x61, 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x52, 0x65, - 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x28, 0x01, 0x30, 0x01, 0x42, 0x57, 0x0a, 0x0d, 0x69, 0x6f, - 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x6c, 0x62, 0x2e, 0x76, 0x31, 0x42, 0x11, 0x4c, 0x6f, 0x61, - 0x64, 0x42, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, - 0x5a, 0x31, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, - 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, - 0x72, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x6c, 0x62, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x6c, 0x62, - 0x5f, 0x76, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_grpc_lb_v1_load_balancer_proto_rawDesc = "" + + "\n" + + "\x1egrpc/lb/v1/load_balancer.proto\x12\n" + + "grpc.lb.v1\x1a\x1egoogle/protobuf/duration.proto\x1a\x1fgoogle/protobuf/timestamp.proto\"\xc1\x01\n" + + "\x12LoadBalanceRequest\x12P\n" + + "\x0finitial_request\x18\x01 \x01(\v2%.grpc.lb.v1.InitialLoadBalanceRequestH\x00R\x0einitialRequest\x12<\n" + + "\fclient_stats\x18\x02 \x01(\v2\x17.grpc.lb.v1.ClientStatsH\x00R\vclientStatsB\x1b\n" + + "\x19load_balance_request_type\"/\n" + + "\x19InitialLoadBalanceRequest\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\"`\n" + + "\x13ClientStatsPerToken\x12,\n" + + "\x12load_balance_token\x18\x01 \x01(\tR\x10loadBalanceToken\x12\x1b\n" + + "\tnum_calls\x18\x02 \x01(\x03R\bnumCalls\"\xb0\x03\n" + + "\vClientStats\x128\n" + + "\ttimestamp\x18\x01 \x01(\v2\x1a.google.protobuf.TimestampR\ttimestamp\x12*\n" + + "\x11num_calls_started\x18\x02 \x01(\x03R\x0fnumCallsStarted\x12,\n" + + "\x12num_calls_finished\x18\x03 \x01(\x03R\x10numCallsFinished\x12]\n" + + "-num_calls_finished_with_client_failed_to_send\x18\x06 \x01(\x03R&numCallsFinishedWithClientFailedToSend\x12H\n" + + "!num_calls_finished_known_received\x18\a \x01(\x03R\x1dnumCallsFinishedKnownReceived\x12X\n" + + "\x18calls_finished_with_drop\x18\b \x03(\v2\x1f.grpc.lb.v1.ClientStatsPerTokenR\x15callsFinishedWithDropJ\x04\b\x04\x10\x05J\x04\b\x05\x10\x06\"\x90\x02\n" + + "\x13LoadBalanceResponse\x12S\n" + + "\x10initial_response\x18\x01 \x01(\v2&.grpc.lb.v1.InitialLoadBalanceResponseH\x00R\x0finitialResponse\x129\n" + + "\vserver_list\x18\x02 \x01(\v2\x16.grpc.lb.v1.ServerListH\x00R\n" + + "serverList\x12K\n" + + "\x11fallback_response\x18\x03 \x01(\v2\x1c.grpc.lb.v1.FallbackResponseH\x00R\x10fallbackResponseB\x1c\n" + + "\x1aload_balance_response_type\"\x12\n" + + "\x10FallbackResponse\"~\n" + + "\x1aInitialLoadBalanceResponse\x12Z\n" + + "\x1cclient_stats_report_interval\x18\x02 \x01(\v2\x19.google.protobuf.DurationR\x19clientStatsReportIntervalJ\x04\b\x01\x10\x02\"@\n" + + "\n" + + "ServerList\x12,\n" + + "\aservers\x18\x01 \x03(\v2\x12.grpc.lb.v1.ServerR\aserversJ\x04\b\x03\x10\x04\"\x83\x01\n" + + "\x06Server\x12\x1d\n" + + "\n" + + "ip_address\x18\x01 \x01(\fR\tipAddress\x12\x12\n" + + "\x04port\x18\x02 \x01(\x05R\x04port\x12,\n" + + "\x12load_balance_token\x18\x03 \x01(\tR\x10loadBalanceToken\x12\x12\n" + + "\x04drop\x18\x04 \x01(\bR\x04dropJ\x04\b\x05\x10\x062b\n" + + "\fLoadBalancer\x12R\n" + + "\vBalanceLoad\x12\x1e.grpc.lb.v1.LoadBalanceRequest\x1a\x1f.grpc.lb.v1.LoadBalanceResponse(\x010\x01BW\n" + + "\rio.grpc.lb.v1B\x11LoadBalancerProtoP\x01Z1google.golang.org/grpc/balancer/grpclb/grpc_lb_v1b\x06proto3" var ( file_grpc_lb_v1_load_balancer_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go index 84e6a2505..c4ace87b2 100644 --- a/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go +++ b/vendor/google.golang.org/grpc/balancer/grpclb/grpc_lb_v1/load_balancer_grpc.pb.go @@ -86,7 +86,7 @@ type LoadBalancerServer interface { type UnimplementedLoadBalancerServer struct{} func (UnimplementedLoadBalancerServer) BalanceLoad(grpc.BidiStreamingServer[LoadBalanceRequest, LoadBalanceResponse]) error { - return status.Errorf(codes.Unimplemented, "method BalanceLoad not implemented") + return status.Error(codes.Unimplemented, "method BalanceLoad not implemented") } func (UnimplementedLoadBalancerServer) testEmbeddedByValue() {} diff --git a/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go b/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go index f2df56120..002052120 100644 --- a/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go +++ b/vendor/google.golang.org/grpc/balancer/grpclb/grpclb_remote_balancer.go @@ -82,14 +82,8 @@ func (lb *lbBalancer) processServerList(l *lbpb.ServerList) { } md := metadata.Pairs(lbTokenKey, s.LoadBalanceToken) - ip := net.IP(s.IpAddress) - ipStr := ip.String() - if ip.To4() == nil { - // Add square brackets to ipv6 addresses, otherwise net.Dial() and - // net.SplitHostPort() will return too many colons error. - ipStr = fmt.Sprintf("[%s]", ipStr) - } - addr := imetadata.Set(resolver.Address{Addr: fmt.Sprintf("%s:%d", ipStr, s.Port)}, md) + ipStr := net.IP(s.IpAddress).String() + addr := imetadata.Set(resolver.Address{Addr: net.JoinHostPort(ipStr, fmt.Sprintf("%d", s.Port))}, md) if lb.logger.V(2) { lb.logger.Infof("Server list entry:|%d|, ipStr:|%s|, port:|%d|, load balancer token:|%v|", i, ipStr, s.Port, s.LoadBalanceToken) } diff --git a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go index ea8899818..b15c10e46 100644 --- a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go +++ b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirst.go @@ -169,7 +169,7 @@ func (b *pickfirstBalancer) UpdateClientConnState(state balancer.ClientConnState addrs = state.ResolverState.Addresses if cfg.ShuffleAddressList { addrs = append([]resolver.Address{}, addrs...) - rand.Shuffle(len(addrs), func(i, j int) { addrs[i], addrs[j] = addrs[j], addrs[i] }) + internal.RandShuffle(len(addrs), func(i, j int) { addrs[i], addrs[j] = addrs[j], addrs[i] }) } } diff --git a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go index 494314f23..9ffdd28a0 100644 --- a/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go +++ b/vendor/google.golang.org/grpc/balancer/pickfirst/pickfirstleaf/pickfirstleaf.go @@ -54,18 +54,9 @@ func init() { balancer.Register(pickfirstBuilder{}) } -type ( - // enableHealthListenerKeyType is a unique key type used in resolver - // attributes to indicate whether the health listener usage is enabled. - enableHealthListenerKeyType struct{} - // managedByPickfirstKeyType is an attribute key type to inform Outlier - // Detection that the generic health listener is being used. - // TODO: https://github.com/grpc/grpc-go/issues/7915 - Remove this when - // implementing the dualstack design. This is a hack. Once Dualstack is - // completed, outlier detection will stop sending ejection updates through - // the connectivity listener. - managedByPickfirstKeyType struct{} -) +// enableHealthListenerKeyType is a unique key type used in resolver +// attributes to indicate whether the health listener usage is enabled. +type enableHealthListenerKeyType struct{} var ( logger = grpclog.Component("pick-first-leaf-lb") @@ -76,21 +67,21 @@ var ( disconnectionsMetric = expstats.RegisterInt64Count(expstats.MetricDescriptor{ Name: "grpc.lb.pick_first.disconnections", Description: "EXPERIMENTAL. Number of times the selected subchannel becomes disconnected.", - Unit: "disconnection", + Unit: "{disconnection}", Labels: []string{"grpc.target"}, Default: false, }) connectionAttemptsSucceededMetric = expstats.RegisterInt64Count(expstats.MetricDescriptor{ Name: "grpc.lb.pick_first.connection_attempts_succeeded", Description: "EXPERIMENTAL. Number of successful connection attempts.", - Unit: "attempt", + Unit: "{attempt}", Labels: []string{"grpc.target"}, Default: false, }) connectionAttemptsFailedMetric = expstats.RegisterInt64Count(expstats.MetricDescriptor{ Name: "grpc.lb.pick_first.connection_attempts_failed", Description: "EXPERIMENTAL. Number of failed connection attempts.", - Unit: "attempt", + Unit: "{attempt}", Labels: []string{"grpc.target"}, Default: false, }) @@ -149,17 +140,6 @@ func EnableHealthListener(state resolver.State) resolver.State { return state } -// IsManagedByPickfirst returns whether an address belongs to a SubConn -// managed by the pickfirst LB policy. -// TODO: https://github.com/grpc/grpc-go/issues/7915 - This is a hack to disable -// outlier_detection via the with connectivity listener when using pick_first. -// Once Dualstack changes are complete, all SubConns will be created by -// pick_first and outlier detection will only use the health listener for -// ejection. This hack can then be removed. -func IsManagedByPickfirst(addr resolver.Address) bool { - return addr.BalancerAttributes.Value(managedByPickfirstKeyType{}) != nil -} - type pfConfig struct { serviceconfig.LoadBalancingConfig `json:"-"` @@ -186,7 +166,6 @@ type scData struct { } func (b *pickfirstBalancer) newSCData(addr resolver.Address) (*scData, error) { - addr.BalancerAttributes = addr.BalancerAttributes.WithValue(managedByPickfirstKeyType{}, true) sd := &scData{ rawConnectivityState: connectivity.Idle, effectiveState: connectivity.Idle, @@ -304,7 +283,7 @@ func (b *pickfirstBalancer) UpdateClientConnState(state balancer.ClientConnState newAddrs = state.ResolverState.Addresses if cfg.ShuffleAddressList { newAddrs = append([]resolver.Address{}, newAddrs...) - internal.RandShuffle(len(endpoints), func(i, j int) { endpoints[i], endpoints[j] = endpoints[j], endpoints[i] }) + internal.RandShuffle(len(newAddrs), func(i, j int) { newAddrs[i], newAddrs[j] = newAddrs[j], newAddrs[i] }) } } @@ -372,6 +351,13 @@ func (b *pickfirstBalancer) ExitIdle() { b.mu.Lock() defer b.mu.Unlock() if b.state == connectivity.Idle { + // Move the balancer into CONNECTING state immediately. This is done to + // avoid staying in IDLE if a resolver update arrives before the first + // SubConn reports CONNECTING. + b.updateBalancerState(balancer.State{ + ConnectivityState: connectivity.Connecting, + Picker: &picker{err: balancer.ErrNoSubConnAvailable}, + }) b.startFirstPassLocked() } } @@ -625,7 +611,7 @@ func (b *pickfirstBalancer) updateSubConnState(sd *scData, newState balancer.Sub if !b.addressList.seekTo(sd.addr) { // This should not fail as we should have only one SubConn after // entering READY. The SubConn should be present in the addressList. - b.logger.Errorf("Address %q not found address list in %v", sd.addr, b.addressList.addresses) + b.logger.Errorf("Address %q not found address list in %v", sd.addr, b.addressList.addresses) return } if !b.healthCheckingEnabled { diff --git a/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go b/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go index 35da5d1ec..22045bf39 100644 --- a/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go +++ b/vendor/google.golang.org/grpc/balancer/roundrobin/roundrobin.go @@ -70,10 +70,3 @@ func (b *rrBalancer) UpdateClientConnState(ccs balancer.ClientConnState) error { ResolverState: pickfirstleaf.EnableHealthListener(ccs.ResolverState), }) } - -func (b *rrBalancer) ExitIdle() { - // Should always be ok, as child is endpoint sharding. - if ei, ok := b.Balancer.(balancer.ExitIdler); ok { - ei.ExitIdle() - } -} diff --git a/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go b/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go index 825c31795..b1364a032 100644 --- a/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go +++ b/vendor/google.golang.org/grpc/binarylog/grpc_binarylog_v1/binarylog.pb.go @@ -18,7 +18,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.36.5 +// protoc-gen-go v1.36.6 // protoc v5.27.1 // source: grpc/binlog/v1/binarylog.proto @@ -858,133 +858,68 @@ func (x *Address) GetIpPort() uint32 { var File_grpc_binlog_v1_binarylog_proto protoreflect.FileDescriptor -var file_grpc_binlog_v1_binarylog_proto_rawDesc = string([]byte{ - 0x0a, 0x1e, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x62, 0x69, 0x6e, 0x6c, 0x6f, 0x67, 0x2f, 0x76, 0x31, - 0x2f, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x12, 0x11, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, - 0x2e, 0x76, 0x31, 0x1a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x1a, 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xbb, 0x07, 0x0a, 0x0c, 0x47, 0x72, 0x70, 0x63, 0x4c, 0x6f, 0x67, - 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x38, 0x0a, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, - 0x6d, 0x70, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x54, 0x69, 0x6d, 0x65, 0x73, - 0x74, 0x61, 0x6d, 0x70, 0x52, 0x09, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x12, - 0x17, 0x0a, 0x07, 0x63, 0x61, 0x6c, 0x6c, 0x5f, 0x69, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x04, - 0x52, 0x06, 0x63, 0x61, 0x6c, 0x6c, 0x49, 0x64, 0x12, 0x35, 0x0a, 0x17, 0x73, 0x65, 0x71, 0x75, - 0x65, 0x6e, 0x63, 0x65, 0x5f, 0x69, 0x64, 0x5f, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x5f, 0x63, - 0x61, 0x6c, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x04, 0x52, 0x14, 0x73, 0x65, 0x71, 0x75, 0x65, - 0x6e, 0x63, 0x65, 0x49, 0x64, 0x57, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x43, 0x61, 0x6c, 0x6c, 0x12, - 0x3d, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, - 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, - 0x31, 0x2e, 0x47, 0x72, 0x70, 0x63, 0x4c, 0x6f, 0x67, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x2e, 0x45, - 0x76, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x3e, - 0x0a, 0x06, 0x6c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26, - 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, - 0x76, 0x31, 0x2e, 0x47, 0x72, 0x70, 0x63, 0x4c, 0x6f, 0x67, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x2e, - 0x4c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x52, 0x06, 0x6c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x12, 0x46, - 0x0a, 0x0d, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, - 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, - 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x48, 0x00, 0x52, 0x0c, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x46, 0x0a, 0x0d, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, - 0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, - 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, - 0x31, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x48, 0x00, - 0x52, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x12, 0x36, - 0x0a, 0x07, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, - 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x48, 0x00, 0x52, 0x07, 0x6d, - 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x36, 0x0a, 0x07, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x65, - 0x72, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, - 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x54, 0x72, 0x61, 0x69, - 0x6c, 0x65, 0x72, 0x48, 0x00, 0x52, 0x07, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x65, 0x72, 0x12, 0x2b, - 0x0a, 0x11, 0x70, 0x61, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x5f, 0x74, 0x72, 0x75, 0x6e, 0x63, 0x61, - 0x74, 0x65, 0x64, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x52, 0x10, 0x70, 0x61, 0x79, 0x6c, 0x6f, - 0x61, 0x64, 0x54, 0x72, 0x75, 0x6e, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x2e, 0x0a, 0x04, 0x70, - 0x65, 0x65, 0x72, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63, - 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x41, 0x64, - 0x64, 0x72, 0x65, 0x73, 0x73, 0x52, 0x04, 0x70, 0x65, 0x65, 0x72, 0x22, 0xf5, 0x01, 0x0a, 0x09, - 0x45, 0x76, 0x65, 0x6e, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x16, 0x0a, 0x12, 0x45, 0x56, 0x45, - 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, - 0x00, 0x12, 0x1c, 0x0a, 0x18, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x10, 0x01, 0x12, - 0x1c, 0x0a, 0x18, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, - 0x52, 0x56, 0x45, 0x52, 0x5f, 0x48, 0x45, 0x41, 0x44, 0x45, 0x52, 0x10, 0x02, 0x12, 0x1d, 0x0a, - 0x19, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x4c, 0x49, 0x45, - 0x4e, 0x54, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x03, 0x12, 0x1d, 0x0a, 0x19, - 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, 0x45, - 0x52, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x04, 0x12, 0x20, 0x0a, 0x1c, 0x45, - 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, - 0x5f, 0x48, 0x41, 0x4c, 0x46, 0x5f, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x10, 0x05, 0x12, 0x1d, 0x0a, - 0x19, 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x45, 0x52, 0x56, - 0x45, 0x52, 0x5f, 0x54, 0x52, 0x41, 0x49, 0x4c, 0x45, 0x52, 0x10, 0x06, 0x12, 0x15, 0x0a, 0x11, - 0x45, 0x56, 0x45, 0x4e, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x43, 0x41, 0x4e, 0x43, 0x45, - 0x4c, 0x10, 0x07, 0x22, 0x42, 0x0a, 0x06, 0x4c, 0x6f, 0x67, 0x67, 0x65, 0x72, 0x12, 0x12, 0x0a, - 0x0e, 0x4c, 0x4f, 0x47, 0x47, 0x45, 0x52, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, - 0x00, 0x12, 0x11, 0x0a, 0x0d, 0x4c, 0x4f, 0x47, 0x47, 0x45, 0x52, 0x5f, 0x43, 0x4c, 0x49, 0x45, - 0x4e, 0x54, 0x10, 0x01, 0x12, 0x11, 0x0a, 0x0d, 0x4c, 0x4f, 0x47, 0x47, 0x45, 0x52, 0x5f, 0x53, - 0x45, 0x52, 0x56, 0x45, 0x52, 0x10, 0x02, 0x42, 0x09, 0x0a, 0x07, 0x70, 0x61, 0x79, 0x6c, 0x6f, - 0x61, 0x64, 0x22, 0xbb, 0x01, 0x0a, 0x0c, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x48, 0x65, 0x61, - 0x64, 0x65, 0x72, 0x12, 0x37, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, - 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, - 0x74, 0x61, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x1f, 0x0a, 0x0b, - 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x0a, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1c, 0x0a, - 0x09, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x09, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x12, 0x33, 0x0a, 0x07, 0x74, - 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, - 0x22, 0x47, 0x0a, 0x0c, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, - 0x12, 0x37, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, - 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x52, - 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x22, 0xb1, 0x01, 0x0a, 0x07, 0x54, 0x72, - 0x61, 0x69, 0x6c, 0x65, 0x72, 0x12, 0x37, 0x0a, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, - 0x61, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, - 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61, - 0x64, 0x61, 0x74, 0x61, 0x52, 0x08, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x12, 0x1f, - 0x0a, 0x0b, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x0d, 0x52, 0x0a, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x43, 0x6f, 0x64, 0x65, 0x12, - 0x25, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x5f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, - 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0d, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x4d, - 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x25, 0x0a, 0x0e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, - 0x5f, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0d, - 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x44, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x22, 0x35, 0x0a, - 0x07, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6c, 0x65, 0x6e, 0x67, - 0x74, 0x68, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x06, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, - 0x12, 0x12, 0x0a, 0x04, 0x64, 0x61, 0x74, 0x61, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x04, - 0x64, 0x61, 0x74, 0x61, 0x22, 0x42, 0x0a, 0x08, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, - 0x12, 0x36, 0x0a, 0x05, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x20, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, - 0x2e, 0x76, 0x31, 0x2e, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72, - 0x79, 0x52, 0x05, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x22, 0x37, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x61, - 0x64, 0x61, 0x74, 0x61, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x22, 0xb8, 0x01, 0x0a, 0x07, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x33, 0x0a, - 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x1f, 0x2e, 0x67, 0x72, - 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2e, 0x76, 0x31, 0x2e, - 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, - 0x70, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x07, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x17, 0x0a, 0x07, - 0x69, 0x70, 0x5f, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x06, 0x69, - 0x70, 0x50, 0x6f, 0x72, 0x74, 0x22, 0x45, 0x0a, 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x10, 0x0a, - 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, - 0x0d, 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x50, 0x56, 0x34, 0x10, 0x01, 0x12, 0x0d, - 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, 0x50, 0x56, 0x36, 0x10, 0x02, 0x12, 0x0d, 0x0a, - 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x49, 0x58, 0x10, 0x03, 0x42, 0x5c, 0x0a, 0x14, - 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x62, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, - 0x67, 0x2e, 0x76, 0x31, 0x42, 0x0e, 0x42, 0x69, 0x6e, 0x61, 0x72, 0x79, 0x4c, 0x6f, 0x67, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x32, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, - 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x62, - 0x69, 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x62, 0x69, - 0x6e, 0x61, 0x72, 0x79, 0x6c, 0x6f, 0x67, 0x5f, 0x76, 0x31, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, -}) +const file_grpc_binlog_v1_binarylog_proto_rawDesc = "" + + "\n" + + "\x1egrpc/binlog/v1/binarylog.proto\x12\x11grpc.binarylog.v1\x1a\x1egoogle/protobuf/duration.proto\x1a\x1fgoogle/protobuf/timestamp.proto\"\xbb\a\n" + + "\fGrpcLogEntry\x128\n" + + "\ttimestamp\x18\x01 \x01(\v2\x1a.google.protobuf.TimestampR\ttimestamp\x12\x17\n" + + "\acall_id\x18\x02 \x01(\x04R\x06callId\x125\n" + + "\x17sequence_id_within_call\x18\x03 \x01(\x04R\x14sequenceIdWithinCall\x12=\n" + + "\x04type\x18\x04 \x01(\x0e2).grpc.binarylog.v1.GrpcLogEntry.EventTypeR\x04type\x12>\n" + + "\x06logger\x18\x05 \x01(\x0e2&.grpc.binarylog.v1.GrpcLogEntry.LoggerR\x06logger\x12F\n" + + "\rclient_header\x18\x06 \x01(\v2\x1f.grpc.binarylog.v1.ClientHeaderH\x00R\fclientHeader\x12F\n" + + "\rserver_header\x18\a \x01(\v2\x1f.grpc.binarylog.v1.ServerHeaderH\x00R\fserverHeader\x126\n" + + "\amessage\x18\b \x01(\v2\x1a.grpc.binarylog.v1.MessageH\x00R\amessage\x126\n" + + "\atrailer\x18\t \x01(\v2\x1a.grpc.binarylog.v1.TrailerH\x00R\atrailer\x12+\n" + + "\x11payload_truncated\x18\n" + + " \x01(\bR\x10payloadTruncated\x12.\n" + + "\x04peer\x18\v \x01(\v2\x1a.grpc.binarylog.v1.AddressR\x04peer\"\xf5\x01\n" + + "\tEventType\x12\x16\n" + + "\x12EVENT_TYPE_UNKNOWN\x10\x00\x12\x1c\n" + + "\x18EVENT_TYPE_CLIENT_HEADER\x10\x01\x12\x1c\n" + + "\x18EVENT_TYPE_SERVER_HEADER\x10\x02\x12\x1d\n" + + "\x19EVENT_TYPE_CLIENT_MESSAGE\x10\x03\x12\x1d\n" + + "\x19EVENT_TYPE_SERVER_MESSAGE\x10\x04\x12 \n" + + "\x1cEVENT_TYPE_CLIENT_HALF_CLOSE\x10\x05\x12\x1d\n" + + "\x19EVENT_TYPE_SERVER_TRAILER\x10\x06\x12\x15\n" + + "\x11EVENT_TYPE_CANCEL\x10\a\"B\n" + + "\x06Logger\x12\x12\n" + + "\x0eLOGGER_UNKNOWN\x10\x00\x12\x11\n" + + "\rLOGGER_CLIENT\x10\x01\x12\x11\n" + + "\rLOGGER_SERVER\x10\x02B\t\n" + + "\apayload\"\xbb\x01\n" + + "\fClientHeader\x127\n" + + "\bmetadata\x18\x01 \x01(\v2\x1b.grpc.binarylog.v1.MetadataR\bmetadata\x12\x1f\n" + + "\vmethod_name\x18\x02 \x01(\tR\n" + + "methodName\x12\x1c\n" + + "\tauthority\x18\x03 \x01(\tR\tauthority\x123\n" + + "\atimeout\x18\x04 \x01(\v2\x19.google.protobuf.DurationR\atimeout\"G\n" + + "\fServerHeader\x127\n" + + "\bmetadata\x18\x01 \x01(\v2\x1b.grpc.binarylog.v1.MetadataR\bmetadata\"\xb1\x01\n" + + "\aTrailer\x127\n" + + "\bmetadata\x18\x01 \x01(\v2\x1b.grpc.binarylog.v1.MetadataR\bmetadata\x12\x1f\n" + + "\vstatus_code\x18\x02 \x01(\rR\n" + + "statusCode\x12%\n" + + "\x0estatus_message\x18\x03 \x01(\tR\rstatusMessage\x12%\n" + + "\x0estatus_details\x18\x04 \x01(\fR\rstatusDetails\"5\n" + + "\aMessage\x12\x16\n" + + "\x06length\x18\x01 \x01(\rR\x06length\x12\x12\n" + + "\x04data\x18\x02 \x01(\fR\x04data\"B\n" + + "\bMetadata\x126\n" + + "\x05entry\x18\x01 \x03(\v2 .grpc.binarylog.v1.MetadataEntryR\x05entry\"7\n" + + "\rMetadataEntry\x12\x10\n" + + "\x03key\x18\x01 \x01(\tR\x03key\x12\x14\n" + + "\x05value\x18\x02 \x01(\fR\x05value\"\xb8\x01\n" + + "\aAddress\x123\n" + + "\x04type\x18\x01 \x01(\x0e2\x1f.grpc.binarylog.v1.Address.TypeR\x04type\x12\x18\n" + + "\aaddress\x18\x02 \x01(\tR\aaddress\x12\x17\n" + + "\aip_port\x18\x03 \x01(\rR\x06ipPort\"E\n" + + "\x04Type\x12\x10\n" + + "\fTYPE_UNKNOWN\x10\x00\x12\r\n" + + "\tTYPE_IPV4\x10\x01\x12\r\n" + + "\tTYPE_IPV6\x10\x02\x12\r\n" + + "\tTYPE_UNIX\x10\x03B\\\n" + + "\x14io.grpc.binarylog.v1B\x0eBinaryLogProtoP\x01Z2google.golang.org/grpc/binarylog/grpc_binarylog_v1b\x06proto3" var ( file_grpc_binlog_v1_binarylog_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/grpc/clientconn.go b/vendor/google.golang.org/grpc/clientconn.go index 4f350ca56..a3c315f2d 100644 --- a/vendor/google.golang.org/grpc/clientconn.go +++ b/vendor/google.golang.org/grpc/clientconn.go @@ -208,7 +208,7 @@ func NewClient(target string, opts ...DialOption) (conn *ClientConn, err error) channelz.Infof(logger, cc.channelz, "Channel authority set to %q", cc.authority) cc.csMgr = newConnectivityStateManager(cc.ctx, cc.channelz) - cc.pickerWrapper = newPickerWrapper(cc.dopts.copts.StatsHandlers) + cc.pickerWrapper = newPickerWrapper() cc.metricsRecorderList = stats.NewMetricsRecorderList(cc.dopts.copts.StatsHandlers) @@ -456,7 +456,7 @@ func (cc *ClientConn) validateTransportCredentials() error { func (cc *ClientConn) channelzRegistration(target string) { parentChannel, _ := cc.dopts.channelzParent.(*channelz.Channel) cc.channelz = channelz.RegisterChannel(parentChannel, target) - cc.addTraceEvent("created") + cc.addTraceEvent(fmt.Sprintf("created for target %q", target)) } // chainUnaryClientInterceptors chains all unary client interceptors into one. @@ -689,22 +689,31 @@ func (cc *ClientConn) Connect() { cc.mu.Unlock() } -// waitForResolvedAddrs blocks until the resolver has provided addresses or the -// context expires. Returns nil unless the context expires first; otherwise -// returns a status error based on the context. -func (cc *ClientConn) waitForResolvedAddrs(ctx context.Context) error { +// waitForResolvedAddrs blocks until the resolver provides addresses or the +// context expires, whichever happens first. +// +// Error is nil unless the context expires first; otherwise returns a status +// error based on the context. +// +// The returned boolean indicates whether it did block or not. If the +// resolution has already happened once before, it returns false without +// blocking. Otherwise, it wait for the resolution and return true if +// resolution has succeeded or return false along with error if resolution has +// failed. +func (cc *ClientConn) waitForResolvedAddrs(ctx context.Context) (bool, error) { // This is on the RPC path, so we use a fast path to avoid the // more-expensive "select" below after the resolver has returned once. if cc.firstResolveEvent.HasFired() { - return nil + return false, nil } + internal.NewStreamWaitingForResolver() select { case <-cc.firstResolveEvent.Done(): - return nil + return true, nil case <-ctx.Done(): - return status.FromContextError(ctx.Err()).Err() + return false, status.FromContextError(ctx.Err()).Err() case <-cc.ctx.Done(): - return ErrClientConnClosing + return false, ErrClientConnClosing } } @@ -1067,13 +1076,6 @@ func (cc *ClientConn) healthCheckConfig() *healthCheckConfig { return cc.sc.healthCheckConfig } -func (cc *ClientConn) getTransport(ctx context.Context, failfast bool, method string) (transport.ClientTransport, balancer.PickResult, error) { - return cc.pickerWrapper.pick(ctx, failfast, balancer.PickInfo{ - Ctx: ctx, - FullMethodName: method, - }) -} - func (cc *ClientConn) applyServiceConfigAndBalancer(sc *ServiceConfig, configSelector iresolver.ConfigSelector) { if sc == nil { // should never reach here. @@ -1822,7 +1824,7 @@ func (cc *ClientConn) initAuthority() error { } else if auth, ok := cc.resolverBuilder.(resolver.AuthorityOverrider); ok { cc.authority = auth.OverrideAuthority(cc.parsedTarget) } else if strings.HasPrefix(endpoint, ":") { - cc.authority = "localhost" + endpoint + cc.authority = "localhost" + encodeAuthority(endpoint) } else { cc.authority = encodeAuthority(endpoint) } diff --git a/vendor/google.golang.org/grpc/credentials/alts/alts.go b/vendor/google.golang.org/grpc/credentials/alts/alts.go index afcdb8a0d..35539eb1a 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/alts.go +++ b/vendor/google.golang.org/grpc/credentials/alts/alts.go @@ -133,10 +133,11 @@ func DefaultServerOptions() *ServerOptions { // altsTC is the credentials required for authenticating a connection using ALTS. // It implements credentials.TransportCredentials interface. type altsTC struct { - info *credentials.ProtocolInfo - side core.Side - accounts []string - hsAddress string + info *credentials.ProtocolInfo + side core.Side + accounts []string + hsAddress string + boundAccessToken string } // NewClientCreds constructs a client-side ALTS TransportCredentials object. @@ -198,6 +199,7 @@ func (g *altsTC) ClientHandshake(ctx context.Context, addr string, rawConn net.C MaxRpcVersion: maxRPCVersion, MinRpcVersion: minRPCVersion, } + opts.BoundAccessToken = g.boundAccessToken chs, err := handshaker.NewClientHandshaker(ctx, hsConn, rawConn, opts) if err != nil { return nil, nil, err diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go index 1795d0c9e..46617132a 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/common.go @@ -54,11 +54,10 @@ func SliceForAppend(in []byte, n int) (head, tail []byte) { func ParseFramedMsg(b []byte, maxLen uint32) ([]byte, []byte, error) { // If the size field is not complete, return the provided buffer as // remaining buffer. - if len(b) < MsgLenFieldSize { + length, sufficientBytes := parseMessageLength(b) + if !sufficientBytes { return nil, b, nil } - msgLenField := b[:MsgLenFieldSize] - length := binary.LittleEndian.Uint32(msgLenField) if length > maxLen { return nil, nil, fmt.Errorf("received the frame length %d larger than the limit %d", length, maxLen) } @@ -68,3 +67,14 @@ func ParseFramedMsg(b []byte, maxLen uint32) ([]byte, []byte, error) { } return b[:MsgLenFieldSize+length], b[MsgLenFieldSize+length:], nil } + +// parseMessageLength returns the message length based on frame header. It also +// returns a boolean indicating if the buffer contains sufficient bytes to parse +// the length header. If there are insufficient bytes, (0, false) is returned. +func parseMessageLength(b []byte) (uint32, bool) { + if len(b) < MsgLenFieldSize { + return 0, false + } + msgLenField := b[:MsgLenFieldSize] + return binary.LittleEndian.Uint32(msgLenField), true +} diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go index f1ea7bb20..f9d2646d4 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/conn/record.go @@ -31,14 +31,18 @@ import ( // ALTSRecordCrypto is the interface for gRPC ALTS record protocol. type ALTSRecordCrypto interface { - // Encrypt encrypts the plaintext and computes the tag (if any) of dst - // and plaintext. dst and plaintext may fully overlap or not at all. + // Encrypt encrypts the plaintext, computes the tag (if any) of dst and + // plaintext, and appends the result to dst, returning the updated slice. + // dst and plaintext may fully overlap or not at all. Encrypt(dst, plaintext []byte) ([]byte, error) // EncryptionOverhead returns the tag size (if any) in bytes. EncryptionOverhead() int - // Decrypt decrypts ciphertext and verify the tag (if any). dst and - // ciphertext may alias exactly or not at all. To reuse ciphertext's - // storage for the decrypted output, use ciphertext[:0] as dst. + // Decrypt decrypts ciphertext and verifies the tag (if any). If successful, + // this function appends the resulting plaintext to dst, returning the + // updated slice. dst and ciphertext may alias exactly or not at all. To + // reuse ciphertext's storage for the decrypted output, use ciphertext[:0] + // as dst. Even if the function fails, the contents of dst, up to its + // capacity, may be overwritten. Decrypt(dst, ciphertext []byte) ([]byte, error) } @@ -63,6 +67,8 @@ const ( // The maximum write buffer size. This *must* be multiple of // altsRecordDefaultLength. altsWriteBufferMaxSize = 512 * 1024 // 512KiB + // The initial buffer used to read from the network. + altsReadBufferInitialSize = 32 * 1024 // 32KiB ) var ( @@ -83,7 +89,7 @@ type conn struct { net.Conn crypto ALTSRecordCrypto // buf holds data that has been read from the connection and decrypted, - // but has not yet been returned by Read. + // but has not yet been returned by Read. It is a sub-slice of protected. buf []byte payloadLengthLimit int // protected holds data read from the network but have not yet been @@ -111,21 +117,13 @@ func NewConn(c net.Conn, side core.Side, recordProtocol string, key []byte, prot } overhead := MsgLenFieldSize + msgTypeFieldSize + crypto.EncryptionOverhead() payloadLengthLimit := altsRecordDefaultLength - overhead - var protectedBuf []byte - if protected == nil { - // We pre-allocate protected to be of size - // 2*altsRecordDefaultLength-1 during initialization. We only - // read from the network into protected when protected does not - // contain a complete frame, which is at most - // altsRecordDefaultLength-1 (bytes). And we read at most - // altsRecordDefaultLength (bytes) data into protected at one - // time. Therefore, 2*altsRecordDefaultLength-1 is large enough - // to buffer data read from the network. - protectedBuf = make([]byte, 0, 2*altsRecordDefaultLength-1) - } else { - protectedBuf = make([]byte, len(protected)) - copy(protectedBuf, protected) - } + // We pre-allocate protected to be of size 32KB during initialization. + // We increase the size of the buffer by the required amount if it can't + // hold a complete encrypted record. + protectedBuf := make([]byte, max(altsReadBufferInitialSize, len(protected))) + // Copy additional data from hanshaker service. + copy(protectedBuf, protected) + protectedBuf = protectedBuf[:len(protected)] altsConn := &conn{ Conn: c, @@ -162,11 +160,26 @@ func (p *conn) Read(b []byte) (n int, err error) { // Check whether a complete frame has been received yet. for len(framedMsg) == 0 { if len(p.protected) == cap(p.protected) { - tmp := make([]byte, len(p.protected), cap(p.protected)+altsRecordDefaultLength) - copy(tmp, p.protected) - p.protected = tmp + // We can parse the length header to know exactly how large + // the buffer needs to be to hold the entire frame. + length, didParse := parseMessageLength(p.protected) + if !didParse { + // The protected buffer is initialized with a capacity of + // larger than 4B. It should always hold the message length + // header. + panic(fmt.Sprintf("protected buffer length shorter than expected: %d vs %d", len(p.protected), MsgLenFieldSize)) + } + oldProtectedBuf := p.protected + // The new buffer must be able to hold the message length header + // and the entire message. + requiredCapacity := int(length) + MsgLenFieldSize + p.protected = make([]byte, requiredCapacity) + // Copy the contents of the old buffer and set the length of the + // new buffer to the number of bytes already read. + copy(p.protected, oldProtectedBuf) + p.protected = p.protected[:len(oldProtectedBuf)] } - n, err = p.Conn.Read(p.protected[len(p.protected):min(cap(p.protected), len(p.protected)+altsRecordDefaultLength)]) + n, err = p.Conn.Read(p.protected[len(p.protected):cap(p.protected)]) if err != nil { return 0, err } @@ -185,6 +198,15 @@ func (p *conn) Read(b []byte) (n int, err error) { } ciphertext := msg[msgTypeFieldSize:] + // Decrypt directly into the buffer, avoiding a copy from p.buf if + // possible. + if len(b) >= len(ciphertext) { + dec, err := p.crypto.Decrypt(b[:0], ciphertext) + if err != nil { + return 0, err + } + return len(dec), nil + } // Decrypt requires that if the dst and ciphertext alias, they // must alias exactly. Code here used to use msg[:0], but msg // starts MsgLenFieldSize+msgTypeFieldSize bytes earlier than diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go index 50721f690..f4974b504 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/handshaker.go @@ -88,6 +88,8 @@ type ClientHandshakerOptions struct { TargetServiceAccounts []string // RPCVersions specifies the gRPC versions accepted by the client. RPCVersions *altspb.RpcProtocolVersions + // BoundAccessToken is a bound access token to be sent to the server for authentication. + BoundAccessToken string } // ServerHandshakerOptions contains the server handshaker options that can @@ -195,7 +197,9 @@ func (h *altsHandshaker) ClientHandshake(ctx context.Context) (net.Conn, credent }, }, } - + if h.clientOpts.BoundAccessToken != "" { + req.GetClientStart().AccessToken = h.clientOpts.BoundAccessToken + } conn, result, err := h.doHandshake(req) if err != nil { return nil, nil, err @@ -294,11 +298,11 @@ func (h *altsHandshaker) doHandshake(req *altspb.HandshakerReq) (net.Conn, *alts func (h *altsHandshaker) accessHandshakerService(req *altspb.HandshakerReq) (*altspb.HandshakerResp, error) { if err := h.stream.Send(req); err != nil { - return nil, err + return nil, fmt.Errorf("failed to send ALTS handshaker request: %w", err) } resp, err := h.stream.Recv() if err != nil { - return nil, err + return nil, fmt.Errorf("failed to receive ALTS handshaker response: %w", err) } return resp, nil } @@ -308,6 +312,7 @@ func (h *altsHandshaker) accessHandshakerService(req *altspb.HandshakerReq) (*al // whatever received from the network and send it to the handshaker service. func (h *altsHandshaker) processUntilDone(resp *altspb.HandshakerResp, extra []byte) (*altspb.HandshakerResult, []byte, error) { var lastWriteTime time.Time + buf := make([]byte, frameLimit) for { if len(resp.OutFrames) > 0 { lastWriteTime = time.Now() @@ -318,7 +323,6 @@ func (h *altsHandshaker) processUntilDone(resp *altspb.HandshakerResp, extra []b if resp.Result != nil { return resp.Result, extra, nil } - buf := make([]byte, frameLimit) n, err := h.conn.Read(buf) if err != nil && err != io.EOF { return nil, nil, err diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go index e0a1afc11..2580995d9 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/handshaker/service/service.go @@ -22,9 +22,12 @@ package service import ( "sync" + "time" grpc "google.golang.org/grpc" "google.golang.org/grpc/credentials/insecure" + "google.golang.org/grpc/internal/envconfig" + "google.golang.org/grpc/keepalive" ) var ( @@ -50,7 +53,17 @@ func Dial(hsAddress string) (*grpc.ClientConn, error) { // Disable the service config to avoid unnecessary TXT record lookups that // cause timeouts with some versions of systemd-resolved. var err error - hsConn, err = grpc.NewClient(hsAddress, grpc.WithTransportCredentials(insecure.NewCredentials()), grpc.WithDisableServiceConfig()) + opts := []grpc.DialOption{ + grpc.WithTransportCredentials(insecure.NewCredentials()), + grpc.WithDisableServiceConfig(), + } + if envconfig.ALTSHandshakerKeepaliveParams { + opts = append(opts, grpc.WithKeepaliveParams(keepalive.ClientParameters{ + Timeout: 10 * time.Second, + Time: 10 * time.Minute, + })) + } + hsConn, err = grpc.NewClient(hsAddress, opts...) if err != nil { return nil, err } diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go index ac2957a4e..331dd6c84 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/altscontext.pb.go @@ -17,7 +17,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.36.5 +// protoc-gen-go v1.36.6 // protoc v5.27.1 // source: grpc/gcp/altscontext.proto @@ -139,52 +139,21 @@ func (x *AltsContext) GetPeerAttributes() map[string]string { var File_grpc_gcp_altscontext_proto protoreflect.FileDescriptor -var file_grpc_gcp_altscontext_proto_rawDesc = string([]byte{ - 0x0a, 0x1a, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x63, - 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x08, 0x67, 0x72, - 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x1a, 0x28, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, - 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72, - 0x69, 0x74, 0x79, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x22, 0xf1, 0x03, 0x0a, 0x0b, 0x41, 0x6c, 0x74, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, - 0x12, 0x31, 0x0a, 0x14, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, - 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x63, 0x6f, 0x6c, 0x12, 0x27, 0x0a, 0x0f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x72, 0x65, - 0x63, 0x6f, 0x72, 0x64, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x3e, 0x0a, 0x0e, - 0x73, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x5f, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, - 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x52, 0x0d, 0x73, - 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x30, 0x0a, 0x14, - 0x70, 0x65, 0x65, 0x72, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, 0x63, 0x63, - 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x70, 0x65, 0x65, 0x72, - 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x32, - 0x0a, 0x15, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, - 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, 0x6c, - 0x6f, 0x63, 0x61, 0x6c, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x63, 0x63, 0x6f, 0x75, - 0x6e, 0x74, 0x12, 0x49, 0x0a, 0x11, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76, - 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, - 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x0f, 0x70, 0x65, - 0x65, 0x72, 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x52, 0x0a, - 0x0f, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, - 0x18, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, - 0x70, 0x2e, 0x41, 0x6c, 0x74, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x2e, 0x50, 0x65, - 0x65, 0x72, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, - 0x79, 0x52, 0x0e, 0x70, 0x65, 0x65, 0x72, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, - 0x73, 0x1a, 0x41, 0x0a, 0x13, 0x50, 0x65, 0x65, 0x72, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, - 0x74, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, - 0x3a, 0x02, 0x38, 0x01, 0x42, 0x6c, 0x0a, 0x15, 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, - 0x61, 0x6c, 0x74, 0x73, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x42, 0x10, 0x41, - 0x6c, 0x74, 0x73, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, - 0x01, 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, - 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x63, 0x72, 0x65, 0x64, 0x65, 0x6e, - 0x74, 0x69, 0x61, 0x6c, 0x73, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, - 0x6e, 0x61, 0x6c, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x67, - 0x63, 0x70, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_grpc_gcp_altscontext_proto_rawDesc = "" + + "\n" + + "\x1agrpc/gcp/altscontext.proto\x12\bgrpc.gcp\x1a(grpc/gcp/transport_security_common.proto\"\xf1\x03\n" + + "\vAltsContext\x121\n" + + "\x14application_protocol\x18\x01 \x01(\tR\x13applicationProtocol\x12'\n" + + "\x0frecord_protocol\x18\x02 \x01(\tR\x0erecordProtocol\x12>\n" + + "\x0esecurity_level\x18\x03 \x01(\x0e2\x17.grpc.gcp.SecurityLevelR\rsecurityLevel\x120\n" + + "\x14peer_service_account\x18\x04 \x01(\tR\x12peerServiceAccount\x122\n" + + "\x15local_service_account\x18\x05 \x01(\tR\x13localServiceAccount\x12I\n" + + "\x11peer_rpc_versions\x18\x06 \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\x0fpeerRpcVersions\x12R\n" + + "\x0fpeer_attributes\x18\a \x03(\v2).grpc.gcp.AltsContext.PeerAttributesEntryR\x0epeerAttributes\x1aA\n" + + "\x13PeerAttributesEntry\x12\x10\n" + + "\x03key\x18\x01 \x01(\tR\x03key\x12\x14\n" + + "\x05value\x18\x02 \x01(\tR\x05value:\x028\x01Bl\n" + + "\x15io.grpc.alts.internalB\x10AltsContextProtoP\x01Z?google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcpb\x06proto3" var ( file_grpc_gcp_altscontext_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go index 12759ac28..6370b2a6d 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker.pb.go @@ -17,7 +17,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.36.5 +// protoc-gen-go v1.36.6 // protoc v5.27.1 // source: grpc/gcp/handshaker.proto @@ -331,9 +331,11 @@ type StartClientHandshakeReq struct { // ALTS connections. The access token that should be used to authenticate to // the peer. The access token MUST be strongly bound to the ALTS credentials // used to establish the connection that the token is sent over. - AccessToken string `protobuf:"bytes,11,opt,name=access_token,json=accessToken,proto3" json:"access_token,omitempty"` - unknownFields protoimpl.UnknownFields - sizeCache protoimpl.SizeCache + AccessToken string `protobuf:"bytes,11,opt,name=access_token,json=accessToken,proto3" json:"access_token,omitempty"` + // (Optional) Ordered transport protocol preferences supported by the client. + TransportProtocolPreferences *TransportProtocolPreferences `protobuf:"bytes,12,opt,name=transport_protocol_preferences,json=transportProtocolPreferences,proto3" json:"transport_protocol_preferences,omitempty"` + unknownFields protoimpl.UnknownFields + sizeCache protoimpl.SizeCache } func (x *StartClientHandshakeReq) Reset() { @@ -443,6 +445,13 @@ func (x *StartClientHandshakeReq) GetAccessToken() string { return "" } +func (x *StartClientHandshakeReq) GetTransportProtocolPreferences() *TransportProtocolPreferences { + if x != nil { + return x.TransportProtocolPreferences + } + return nil +} + type ServerHandshakeParameters struct { state protoimpl.MessageState `protogen:"open.v1"` // The record protocols supported by the server, e.g., @@ -534,9 +543,11 @@ type StartServerHandshakeReq struct { // (Optional) RPC protocol versions supported by the server. RpcVersions *RpcProtocolVersions `protobuf:"bytes,6,opt,name=rpc_versions,json=rpcVersions,proto3" json:"rpc_versions,omitempty"` // (Optional) Maximum frame size supported by the server. - MaxFrameSize uint32 `protobuf:"varint,7,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"` - unknownFields protoimpl.UnknownFields - sizeCache protoimpl.SizeCache + MaxFrameSize uint32 `protobuf:"varint,7,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"` + // (Optional) Transport protocol preferences supported by the server. + TransportProtocolPreferences *TransportProtocolPreferences `protobuf:"bytes,8,opt,name=transport_protocol_preferences,json=transportProtocolPreferences,proto3" json:"transport_protocol_preferences,omitempty"` + unknownFields protoimpl.UnknownFields + sizeCache protoimpl.SizeCache } func (x *StartServerHandshakeReq) Reset() { @@ -618,6 +629,13 @@ func (x *StartServerHandshakeReq) GetMaxFrameSize() uint32 { return 0 } +func (x *StartServerHandshakeReq) GetTransportProtocolPreferences() *TransportProtocolPreferences { + if x != nil { + return x.TransportProtocolPreferences + } + return nil +} + type NextHandshakeMessageReq struct { state protoimpl.MessageState `protogen:"open.v1"` // Bytes in out_frames returned from the peer's HandshakerResp. It is possible @@ -798,9 +816,11 @@ type HandshakerResult struct { // The RPC protocol versions supported by the peer. PeerRpcVersions *RpcProtocolVersions `protobuf:"bytes,7,opt,name=peer_rpc_versions,json=peerRpcVersions,proto3" json:"peer_rpc_versions,omitempty"` // The maximum frame size of the peer. - MaxFrameSize uint32 `protobuf:"varint,8,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"` - unknownFields protoimpl.UnknownFields - sizeCache protoimpl.SizeCache + MaxFrameSize uint32 `protobuf:"varint,8,opt,name=max_frame_size,json=maxFrameSize,proto3" json:"max_frame_size,omitempty"` + // (Optional) The transport protocol negotiated for this connection. + TransportProtocol *NegotiatedTransportProtocol `protobuf:"bytes,9,opt,name=transport_protocol,json=transportProtocol,proto3" json:"transport_protocol,omitempty"` + unknownFields protoimpl.UnknownFields + sizeCache protoimpl.SizeCache } func (x *HandshakerResult) Reset() { @@ -889,6 +909,13 @@ func (x *HandshakerResult) GetMaxFrameSize() uint32 { return 0 } +func (x *HandshakerResult) GetTransportProtocol() *NegotiatedTransportProtocol { + if x != nil { + return x.TransportProtocol + } + return nil +} + type HandshakerStatus struct { state protoimpl.MessageState `protogen:"open.v1"` // The status code. This could be the gRPC status code. @@ -1024,206 +1051,94 @@ func (x *HandshakerResp) GetStatus() *HandshakerStatus { var File_grpc_gcp_handshaker_proto protoreflect.FileDescriptor -var file_grpc_gcp_handshaker_proto_rawDesc = string([]byte{ - 0x0a, 0x19, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f, 0x68, 0x61, 0x6e, 0x64, 0x73, - 0x68, 0x61, 0x6b, 0x65, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x08, 0x67, 0x72, 0x70, - 0x63, 0x2e, 0x67, 0x63, 0x70, 0x1a, 0x28, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f, - 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72, 0x69, - 0x74, 0x79, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, - 0x74, 0x0a, 0x08, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x12, 0x1d, 0x0a, 0x0a, 0x69, - 0x70, 0x5f, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x09, 0x69, 0x70, 0x41, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x70, 0x6f, - 0x72, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x04, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x35, - 0x0a, 0x08, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, - 0x32, 0x19, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x4e, 0x65, 0x74, 0x77, - 0x6f, 0x72, 0x6b, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x52, 0x08, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x22, 0xe8, 0x01, 0x0a, 0x08, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, - 0x74, 0x79, 0x12, 0x29, 0x0a, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x5f, 0x61, 0x63, - 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x0e, 0x73, - 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x12, 0x1c, 0x0a, - 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x48, - 0x00, 0x52, 0x08, 0x68, 0x6f, 0x73, 0x74, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x42, 0x0a, 0x0a, 0x61, - 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x22, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65, 0x6e, 0x74, - 0x69, 0x74, 0x79, 0x2e, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x45, 0x6e, - 0x74, 0x72, 0x79, 0x52, 0x0a, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x1a, - 0x3d, 0x0a, 0x0f, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73, 0x45, 0x6e, 0x74, - 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x42, 0x10, - 0x0a, 0x0e, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x5f, 0x6f, 0x6e, 0x65, 0x6f, 0x66, - 0x22, 0xfb, 0x04, 0x0a, 0x17, 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, - 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x12, 0x5b, 0x0a, 0x1b, - 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72, 0x69, - 0x74, 0x79, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x0e, 0x32, 0x1b, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e, - 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x52, 0x19, - 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, - 0x79, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x33, 0x0a, 0x15, 0x61, 0x70, 0x70, - 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, - 0x6c, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x29, - 0x0a, 0x10, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, - 0x6c, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, - 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x3f, 0x0a, 0x11, 0x74, 0x61, 0x72, - 0x67, 0x65, 0x74, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x18, 0x04, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, - 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x10, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, - 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x0e, 0x6c, 0x6f, - 0x63, 0x61, 0x6c, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, 0x05, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64, - 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x49, 0x64, 0x65, - 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x39, 0x0a, 0x0e, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x65, - 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, - 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, - 0x74, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, - 0x12, 0x3b, 0x0a, 0x0f, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, - 0x69, 0x6e, 0x74, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, - 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x52, 0x0e, 0x72, - 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x45, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x12, 0x1f, 0x0a, - 0x0b, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x08, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x0a, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x40, - 0x0a, 0x0c, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x09, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, - 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, - 0x6f, 0x6e, 0x73, 0x52, 0x0b, 0x72, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, - 0x12, 0x24, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x5f, 0x73, 0x69, - 0x7a, 0x65, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x46, 0x72, 0x61, - 0x6d, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x12, 0x26, 0x0a, 0x0c, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, - 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0x80, 0x01, - 0x01, 0x52, 0x0b, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x54, 0x6f, 0x6b, 0x65, 0x6e, 0x22, 0xaf, - 0x01, 0x0a, 0x19, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, - 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x12, 0x29, 0x0a, 0x10, - 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0f, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x12, 0x3d, 0x0a, 0x10, 0x6c, 0x6f, 0x63, 0x61, 0x6c, - 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65, - 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0f, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x49, 0x64, 0x65, 0x6e, - 0x74, 0x69, 0x74, 0x69, 0x65, 0x73, 0x12, 0x1e, 0x0a, 0x05, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x09, 0x42, 0x03, 0x80, 0x01, 0x01, 0x48, 0x00, 0x52, 0x05, 0x74, 0x6f, - 0x6b, 0x65, 0x6e, 0x88, 0x01, 0x01, 0x42, 0x08, 0x0a, 0x06, 0x5f, 0x74, 0x6f, 0x6b, 0x65, 0x6e, - 0x22, 0xa5, 0x04, 0x0a, 0x17, 0x53, 0x74, 0x61, 0x72, 0x74, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, - 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x12, 0x33, 0x0a, 0x15, - 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x63, 0x6f, 0x6c, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x14, 0x61, 0x70, 0x70, - 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, - 0x73, 0x12, 0x6d, 0x0a, 0x14, 0x68, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x5f, 0x70, - 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x3a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x53, 0x74, 0x61, 0x72, 0x74, - 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52, - 0x65, 0x71, 0x2e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, - 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x13, 0x68, 0x61, 0x6e, - 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, - 0x12, 0x19, 0x0a, 0x08, 0x69, 0x6e, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, 0x03, 0x20, 0x01, - 0x28, 0x0c, 0x52, 0x07, 0x69, 0x6e, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x0e, 0x6c, - 0x6f, 0x63, 0x61, 0x6c, 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x18, 0x04, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45, - 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x45, 0x6e, - 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x12, 0x3b, 0x0a, 0x0f, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, - 0x5f, 0x65, 0x6e, 0x64, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x45, 0x6e, 0x64, 0x70, 0x6f, - 0x69, 0x6e, 0x74, 0x52, 0x0e, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x45, 0x6e, 0x64, 0x70, 0x6f, - 0x69, 0x6e, 0x74, 0x12, 0x40, 0x0a, 0x0c, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, - 0x6f, 0x6e, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x72, 0x70, 0x63, - 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, - 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x0b, 0x72, 0x70, 0x63, 0x56, 0x65, 0x72, - 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x66, 0x72, 0x61, - 0x6d, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x0c, 0x6d, - 0x61, 0x78, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x53, 0x69, 0x7a, 0x65, 0x1a, 0x6b, 0x0a, 0x18, 0x48, - 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, - 0x72, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x39, 0x0a, 0x05, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, - 0x67, 0x63, 0x70, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, - 0x61, 0x6b, 0x65, 0x50, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73, 0x52, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x62, 0x0a, 0x17, 0x4e, 0x65, 0x78, 0x74, - 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, - 0x52, 0x65, 0x71, 0x12, 0x19, 0x0a, 0x08, 0x69, 0x6e, 0x5f, 0x62, 0x79, 0x74, 0x65, 0x73, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x07, 0x69, 0x6e, 0x42, 0x79, 0x74, 0x65, 0x73, 0x12, 0x2c, - 0x0a, 0x12, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x5f, 0x6c, 0x61, 0x74, 0x65, 0x6e, 0x63, - 0x79, 0x5f, 0x6d, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x10, 0x6e, 0x65, 0x74, 0x77, - 0x6f, 0x72, 0x6b, 0x4c, 0x61, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4d, 0x73, 0x22, 0xe5, 0x01, 0x0a, - 0x0d, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x52, 0x65, 0x71, 0x12, 0x46, - 0x0a, 0x0c, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, - 0x53, 0x74, 0x61, 0x72, 0x74, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x48, 0x61, 0x6e, 0x64, 0x73, - 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x48, 0x00, 0x52, 0x0b, 0x63, 0x6c, 0x69, 0x65, 0x6e, - 0x74, 0x53, 0x74, 0x61, 0x72, 0x74, 0x12, 0x46, 0x0a, 0x0c, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, - 0x5f, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, - 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x53, 0x74, 0x61, 0x72, 0x74, 0x53, 0x65, 0x72, - 0x76, 0x65, 0x72, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x52, 0x65, 0x71, 0x48, - 0x00, 0x52, 0x0b, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x53, 0x74, 0x61, 0x72, 0x74, 0x12, 0x37, - 0x0a, 0x04, 0x6e, 0x65, 0x78, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x21, 0x2e, 0x67, - 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x4e, 0x65, 0x78, 0x74, 0x48, 0x61, 0x6e, 0x64, - 0x73, 0x68, 0x61, 0x6b, 0x65, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x52, 0x65, 0x71, 0x48, - 0x00, 0x52, 0x04, 0x6e, 0x65, 0x78, 0x74, 0x42, 0x0b, 0x0a, 0x09, 0x72, 0x65, 0x71, 0x5f, 0x6f, - 0x6e, 0x65, 0x6f, 0x66, 0x22, 0x9a, 0x03, 0x0a, 0x10, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, - 0x6b, 0x65, 0x72, 0x52, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x12, 0x31, 0x0a, 0x14, 0x61, 0x70, 0x70, - 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, - 0x6c, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x13, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x27, 0x0a, 0x0f, - 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x5f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x18, - 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x19, 0x0a, 0x08, 0x6b, 0x65, 0x79, 0x5f, 0x64, 0x61, 0x74, - 0x61, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x07, 0x6b, 0x65, 0x79, 0x44, 0x61, 0x74, 0x61, - 0x12, 0x37, 0x0a, 0x0d, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, - 0x79, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, - 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0c, 0x70, 0x65, 0x65, - 0x72, 0x49, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x12, 0x39, 0x0a, 0x0e, 0x6c, 0x6f, 0x63, - 0x61, 0x6c, 0x5f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x12, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x49, 0x64, 0x65, - 0x6e, 0x74, 0x69, 0x74, 0x79, 0x52, 0x0d, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x49, 0x64, 0x65, 0x6e, - 0x74, 0x69, 0x74, 0x79, 0x12, 0x2a, 0x0a, 0x11, 0x6b, 0x65, 0x65, 0x70, 0x5f, 0x63, 0x68, 0x61, - 0x6e, 0x6e, 0x65, 0x6c, 0x5f, 0x6f, 0x70, 0x65, 0x6e, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, - 0x0f, 0x6b, 0x65, 0x65, 0x70, 0x43, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x4f, 0x70, 0x65, 0x6e, - 0x12, 0x49, 0x0a, 0x11, 0x70, 0x65, 0x65, 0x72, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, - 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x72, - 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, - 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x0f, 0x70, 0x65, 0x65, 0x72, - 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x24, 0x0a, 0x0e, 0x6d, - 0x61, 0x78, 0x5f, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x5f, 0x73, 0x69, 0x7a, 0x65, 0x18, 0x08, 0x20, - 0x01, 0x28, 0x0d, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x53, 0x69, 0x7a, - 0x65, 0x22, 0x40, 0x0a, 0x10, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x53, - 0x74, 0x61, 0x74, 0x75, 0x73, 0x12, 0x12, 0x0a, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x0d, 0x52, 0x04, 0x63, 0x6f, 0x64, 0x65, 0x12, 0x18, 0x0a, 0x07, 0x64, 0x65, 0x74, - 0x61, 0x69, 0x6c, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x64, 0x65, 0x74, 0x61, - 0x69, 0x6c, 0x73, 0x22, 0xbe, 0x01, 0x0a, 0x0e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, - 0x65, 0x72, 0x52, 0x65, 0x73, 0x70, 0x12, 0x1d, 0x0a, 0x0a, 0x6f, 0x75, 0x74, 0x5f, 0x66, 0x72, - 0x61, 0x6d, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x09, 0x6f, 0x75, 0x74, 0x46, - 0x72, 0x61, 0x6d, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0e, 0x62, 0x79, 0x74, 0x65, 0x73, 0x5f, 0x63, - 0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x0d, 0x62, - 0x79, 0x74, 0x65, 0x73, 0x43, 0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x12, 0x32, 0x0a, 0x06, - 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, 0x2e, 0x67, - 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, - 0x65, 0x72, 0x52, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x52, 0x06, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, - 0x12, 0x32, 0x0a, 0x06, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, - 0x32, 0x1a, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e, 0x64, - 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x53, 0x74, 0x61, 0x74, 0x75, 0x73, 0x52, 0x06, 0x73, 0x74, - 0x61, 0x74, 0x75, 0x73, 0x2a, 0x4a, 0x0a, 0x11, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, - 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x12, 0x22, 0x0a, 0x1e, 0x48, 0x41, 0x4e, - 0x44, 0x53, 0x48, 0x41, 0x4b, 0x45, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x43, 0x4f, 0x4c, 0x5f, - 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, - 0x03, 0x54, 0x4c, 0x53, 0x10, 0x01, 0x12, 0x08, 0x0a, 0x04, 0x41, 0x4c, 0x54, 0x53, 0x10, 0x02, - 0x2a, 0x45, 0x0a, 0x0f, 0x4e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x63, 0x6f, 0x6c, 0x12, 0x20, 0x0a, 0x1c, 0x4e, 0x45, 0x54, 0x57, 0x4f, 0x52, 0x4b, 0x5f, 0x50, - 0x52, 0x4f, 0x54, 0x4f, 0x43, 0x4f, 0x4c, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, - 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x54, 0x43, 0x50, 0x10, 0x01, 0x12, 0x07, - 0x0a, 0x03, 0x55, 0x44, 0x50, 0x10, 0x02, 0x32, 0x5b, 0x0a, 0x11, 0x48, 0x61, 0x6e, 0x64, 0x73, - 0x68, 0x61, 0x6b, 0x65, 0x72, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0x46, 0x0a, 0x0b, - 0x44, 0x6f, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x12, 0x17, 0x2e, 0x67, 0x72, - 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, - 0x72, 0x52, 0x65, 0x71, 0x1a, 0x18, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, - 0x48, 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x52, 0x65, 0x73, 0x70, 0x22, 0x00, - 0x28, 0x01, 0x30, 0x01, 0x42, 0x6b, 0x0a, 0x15, 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, - 0x61, 0x6c, 0x74, 0x73, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x42, 0x0f, 0x48, - 0x61, 0x6e, 0x64, 0x73, 0x68, 0x61, 0x6b, 0x65, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, - 0x5a, 0x3f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, - 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x63, 0x72, 0x65, 0x64, 0x65, 0x6e, 0x74, - 0x69, 0x61, 0x6c, 0x73, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, - 0x61, 0x6c, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x67, 0x63, - 0x70, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_grpc_gcp_handshaker_proto_rawDesc = "" + + "\n" + + "\x19grpc/gcp/handshaker.proto\x12\bgrpc.gcp\x1a(grpc/gcp/transport_security_common.proto\"t\n" + + "\bEndpoint\x12\x1d\n" + + "\n" + + "ip_address\x18\x01 \x01(\tR\tipAddress\x12\x12\n" + + "\x04port\x18\x02 \x01(\x05R\x04port\x125\n" + + "\bprotocol\x18\x03 \x01(\x0e2\x19.grpc.gcp.NetworkProtocolR\bprotocol\"\xe8\x01\n" + + "\bIdentity\x12)\n" + + "\x0fservice_account\x18\x01 \x01(\tH\x00R\x0eserviceAccount\x12\x1c\n" + + "\bhostname\x18\x02 \x01(\tH\x00R\bhostname\x12B\n" + + "\n" + + "attributes\x18\x03 \x03(\v2\".grpc.gcp.Identity.AttributesEntryR\n" + + "attributes\x1a=\n" + + "\x0fAttributesEntry\x12\x10\n" + + "\x03key\x18\x01 \x01(\tR\x03key\x12\x14\n" + + "\x05value\x18\x02 \x01(\tR\x05value:\x028\x01B\x10\n" + + "\x0eidentity_oneof\"\xe9\x05\n" + + "\x17StartClientHandshakeReq\x12[\n" + + "\x1bhandshake_security_protocol\x18\x01 \x01(\x0e2\x1b.grpc.gcp.HandshakeProtocolR\x19handshakeSecurityProtocol\x123\n" + + "\x15application_protocols\x18\x02 \x03(\tR\x14applicationProtocols\x12)\n" + + "\x10record_protocols\x18\x03 \x03(\tR\x0frecordProtocols\x12?\n" + + "\x11target_identities\x18\x04 \x03(\v2\x12.grpc.gcp.IdentityR\x10targetIdentities\x129\n" + + "\x0elocal_identity\x18\x05 \x01(\v2\x12.grpc.gcp.IdentityR\rlocalIdentity\x129\n" + + "\x0elocal_endpoint\x18\x06 \x01(\v2\x12.grpc.gcp.EndpointR\rlocalEndpoint\x12;\n" + + "\x0fremote_endpoint\x18\a \x01(\v2\x12.grpc.gcp.EndpointR\x0eremoteEndpoint\x12\x1f\n" + + "\vtarget_name\x18\b \x01(\tR\n" + + "targetName\x12@\n" + + "\frpc_versions\x18\t \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\vrpcVersions\x12$\n" + + "\x0emax_frame_size\x18\n" + + " \x01(\rR\fmaxFrameSize\x12&\n" + + "\faccess_token\x18\v \x01(\tB\x03\x80\x01\x01R\vaccessToken\x12l\n" + + "\x1etransport_protocol_preferences\x18\f \x01(\v2&.grpc.gcp.TransportProtocolPreferencesR\x1ctransportProtocolPreferences\"\xaf\x01\n" + + "\x19ServerHandshakeParameters\x12)\n" + + "\x10record_protocols\x18\x01 \x03(\tR\x0frecordProtocols\x12=\n" + + "\x10local_identities\x18\x02 \x03(\v2\x12.grpc.gcp.IdentityR\x0flocalIdentities\x12\x1e\n" + + "\x05token\x18\x03 \x01(\tB\x03\x80\x01\x01H\x00R\x05token\x88\x01\x01B\b\n" + + "\x06_token\"\x93\x05\n" + + "\x17StartServerHandshakeReq\x123\n" + + "\x15application_protocols\x18\x01 \x03(\tR\x14applicationProtocols\x12m\n" + + "\x14handshake_parameters\x18\x02 \x03(\v2:.grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntryR\x13handshakeParameters\x12\x19\n" + + "\bin_bytes\x18\x03 \x01(\fR\ainBytes\x129\n" + + "\x0elocal_endpoint\x18\x04 \x01(\v2\x12.grpc.gcp.EndpointR\rlocalEndpoint\x12;\n" + + "\x0fremote_endpoint\x18\x05 \x01(\v2\x12.grpc.gcp.EndpointR\x0eremoteEndpoint\x12@\n" + + "\frpc_versions\x18\x06 \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\vrpcVersions\x12$\n" + + "\x0emax_frame_size\x18\a \x01(\rR\fmaxFrameSize\x12l\n" + + "\x1etransport_protocol_preferences\x18\b \x01(\v2&.grpc.gcp.TransportProtocolPreferencesR\x1ctransportProtocolPreferences\x1ak\n" + + "\x18HandshakeParametersEntry\x12\x10\n" + + "\x03key\x18\x01 \x01(\x05R\x03key\x129\n" + + "\x05value\x18\x02 \x01(\v2#.grpc.gcp.ServerHandshakeParametersR\x05value:\x028\x01\"b\n" + + "\x17NextHandshakeMessageReq\x12\x19\n" + + "\bin_bytes\x18\x01 \x01(\fR\ainBytes\x12,\n" + + "\x12network_latency_ms\x18\x02 \x01(\rR\x10networkLatencyMs\"\xe5\x01\n" + + "\rHandshakerReq\x12F\n" + + "\fclient_start\x18\x01 \x01(\v2!.grpc.gcp.StartClientHandshakeReqH\x00R\vclientStart\x12F\n" + + "\fserver_start\x18\x02 \x01(\v2!.grpc.gcp.StartServerHandshakeReqH\x00R\vserverStart\x127\n" + + "\x04next\x18\x03 \x01(\v2!.grpc.gcp.NextHandshakeMessageReqH\x00R\x04nextB\v\n" + + "\treq_oneof\"\xf0\x03\n" + + "\x10HandshakerResult\x121\n" + + "\x14application_protocol\x18\x01 \x01(\tR\x13applicationProtocol\x12'\n" + + "\x0frecord_protocol\x18\x02 \x01(\tR\x0erecordProtocol\x12\x19\n" + + "\bkey_data\x18\x03 \x01(\fR\akeyData\x127\n" + + "\rpeer_identity\x18\x04 \x01(\v2\x12.grpc.gcp.IdentityR\fpeerIdentity\x129\n" + + "\x0elocal_identity\x18\x05 \x01(\v2\x12.grpc.gcp.IdentityR\rlocalIdentity\x12*\n" + + "\x11keep_channel_open\x18\x06 \x01(\bR\x0fkeepChannelOpen\x12I\n" + + "\x11peer_rpc_versions\x18\a \x01(\v2\x1d.grpc.gcp.RpcProtocolVersionsR\x0fpeerRpcVersions\x12$\n" + + "\x0emax_frame_size\x18\b \x01(\rR\fmaxFrameSize\x12T\n" + + "\x12transport_protocol\x18\t \x01(\v2%.grpc.gcp.NegotiatedTransportProtocolR\x11transportProtocol\"@\n" + + "\x10HandshakerStatus\x12\x12\n" + + "\x04code\x18\x01 \x01(\rR\x04code\x12\x18\n" + + "\adetails\x18\x02 \x01(\tR\adetails\"\xbe\x01\n" + + "\x0eHandshakerResp\x12\x1d\n" + + "\n" + + "out_frames\x18\x01 \x01(\fR\toutFrames\x12%\n" + + "\x0ebytes_consumed\x18\x02 \x01(\rR\rbytesConsumed\x122\n" + + "\x06result\x18\x03 \x01(\v2\x1a.grpc.gcp.HandshakerResultR\x06result\x122\n" + + "\x06status\x18\x04 \x01(\v2\x1a.grpc.gcp.HandshakerStatusR\x06status*J\n" + + "\x11HandshakeProtocol\x12\"\n" + + "\x1eHANDSHAKE_PROTOCOL_UNSPECIFIED\x10\x00\x12\a\n" + + "\x03TLS\x10\x01\x12\b\n" + + "\x04ALTS\x10\x02*E\n" + + "\x0fNetworkProtocol\x12 \n" + + "\x1cNETWORK_PROTOCOL_UNSPECIFIED\x10\x00\x12\a\n" + + "\x03TCP\x10\x01\x12\a\n" + + "\x03UDP\x10\x022[\n" + + "\x11HandshakerService\x12F\n" + + "\vDoHandshake\x12\x17.grpc.gcp.HandshakerReq\x1a\x18.grpc.gcp.HandshakerResp\"\x00(\x010\x01Bk\n" + + "\x15io.grpc.alts.internalB\x0fHandshakerProtoP\x01Z?google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcpb\x06proto3" var ( file_grpc_gcp_handshaker_proto_rawDescOnce sync.Once @@ -1240,21 +1155,23 @@ func file_grpc_gcp_handshaker_proto_rawDescGZIP() []byte { var file_grpc_gcp_handshaker_proto_enumTypes = make([]protoimpl.EnumInfo, 2) var file_grpc_gcp_handshaker_proto_msgTypes = make([]protoimpl.MessageInfo, 12) var file_grpc_gcp_handshaker_proto_goTypes = []any{ - (HandshakeProtocol)(0), // 0: grpc.gcp.HandshakeProtocol - (NetworkProtocol)(0), // 1: grpc.gcp.NetworkProtocol - (*Endpoint)(nil), // 2: grpc.gcp.Endpoint - (*Identity)(nil), // 3: grpc.gcp.Identity - (*StartClientHandshakeReq)(nil), // 4: grpc.gcp.StartClientHandshakeReq - (*ServerHandshakeParameters)(nil), // 5: grpc.gcp.ServerHandshakeParameters - (*StartServerHandshakeReq)(nil), // 6: grpc.gcp.StartServerHandshakeReq - (*NextHandshakeMessageReq)(nil), // 7: grpc.gcp.NextHandshakeMessageReq - (*HandshakerReq)(nil), // 8: grpc.gcp.HandshakerReq - (*HandshakerResult)(nil), // 9: grpc.gcp.HandshakerResult - (*HandshakerStatus)(nil), // 10: grpc.gcp.HandshakerStatus - (*HandshakerResp)(nil), // 11: grpc.gcp.HandshakerResp - nil, // 12: grpc.gcp.Identity.AttributesEntry - nil, // 13: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry - (*RpcProtocolVersions)(nil), // 14: grpc.gcp.RpcProtocolVersions + (HandshakeProtocol)(0), // 0: grpc.gcp.HandshakeProtocol + (NetworkProtocol)(0), // 1: grpc.gcp.NetworkProtocol + (*Endpoint)(nil), // 2: grpc.gcp.Endpoint + (*Identity)(nil), // 3: grpc.gcp.Identity + (*StartClientHandshakeReq)(nil), // 4: grpc.gcp.StartClientHandshakeReq + (*ServerHandshakeParameters)(nil), // 5: grpc.gcp.ServerHandshakeParameters + (*StartServerHandshakeReq)(nil), // 6: grpc.gcp.StartServerHandshakeReq + (*NextHandshakeMessageReq)(nil), // 7: grpc.gcp.NextHandshakeMessageReq + (*HandshakerReq)(nil), // 8: grpc.gcp.HandshakerReq + (*HandshakerResult)(nil), // 9: grpc.gcp.HandshakerResult + (*HandshakerStatus)(nil), // 10: grpc.gcp.HandshakerStatus + (*HandshakerResp)(nil), // 11: grpc.gcp.HandshakerResp + nil, // 12: grpc.gcp.Identity.AttributesEntry + nil, // 13: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry + (*RpcProtocolVersions)(nil), // 14: grpc.gcp.RpcProtocolVersions + (*TransportProtocolPreferences)(nil), // 15: grpc.gcp.TransportProtocolPreferences + (*NegotiatedTransportProtocol)(nil), // 16: grpc.gcp.NegotiatedTransportProtocol } var file_grpc_gcp_handshaker_proto_depIdxs = []int32{ 1, // 0: grpc.gcp.Endpoint.protocol:type_name -> grpc.gcp.NetworkProtocol @@ -1265,27 +1182,30 @@ var file_grpc_gcp_handshaker_proto_depIdxs = []int32{ 2, // 5: grpc.gcp.StartClientHandshakeReq.local_endpoint:type_name -> grpc.gcp.Endpoint 2, // 6: grpc.gcp.StartClientHandshakeReq.remote_endpoint:type_name -> grpc.gcp.Endpoint 14, // 7: grpc.gcp.StartClientHandshakeReq.rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions - 3, // 8: grpc.gcp.ServerHandshakeParameters.local_identities:type_name -> grpc.gcp.Identity - 13, // 9: grpc.gcp.StartServerHandshakeReq.handshake_parameters:type_name -> grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry - 2, // 10: grpc.gcp.StartServerHandshakeReq.local_endpoint:type_name -> grpc.gcp.Endpoint - 2, // 11: grpc.gcp.StartServerHandshakeReq.remote_endpoint:type_name -> grpc.gcp.Endpoint - 14, // 12: grpc.gcp.StartServerHandshakeReq.rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions - 4, // 13: grpc.gcp.HandshakerReq.client_start:type_name -> grpc.gcp.StartClientHandshakeReq - 6, // 14: grpc.gcp.HandshakerReq.server_start:type_name -> grpc.gcp.StartServerHandshakeReq - 7, // 15: grpc.gcp.HandshakerReq.next:type_name -> grpc.gcp.NextHandshakeMessageReq - 3, // 16: grpc.gcp.HandshakerResult.peer_identity:type_name -> grpc.gcp.Identity - 3, // 17: grpc.gcp.HandshakerResult.local_identity:type_name -> grpc.gcp.Identity - 14, // 18: grpc.gcp.HandshakerResult.peer_rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions - 9, // 19: grpc.gcp.HandshakerResp.result:type_name -> grpc.gcp.HandshakerResult - 10, // 20: grpc.gcp.HandshakerResp.status:type_name -> grpc.gcp.HandshakerStatus - 5, // 21: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry.value:type_name -> grpc.gcp.ServerHandshakeParameters - 8, // 22: grpc.gcp.HandshakerService.DoHandshake:input_type -> grpc.gcp.HandshakerReq - 11, // 23: grpc.gcp.HandshakerService.DoHandshake:output_type -> grpc.gcp.HandshakerResp - 23, // [23:24] is the sub-list for method output_type - 22, // [22:23] is the sub-list for method input_type - 22, // [22:22] is the sub-list for extension type_name - 22, // [22:22] is the sub-list for extension extendee - 0, // [0:22] is the sub-list for field type_name + 15, // 8: grpc.gcp.StartClientHandshakeReq.transport_protocol_preferences:type_name -> grpc.gcp.TransportProtocolPreferences + 3, // 9: grpc.gcp.ServerHandshakeParameters.local_identities:type_name -> grpc.gcp.Identity + 13, // 10: grpc.gcp.StartServerHandshakeReq.handshake_parameters:type_name -> grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry + 2, // 11: grpc.gcp.StartServerHandshakeReq.local_endpoint:type_name -> grpc.gcp.Endpoint + 2, // 12: grpc.gcp.StartServerHandshakeReq.remote_endpoint:type_name -> grpc.gcp.Endpoint + 14, // 13: grpc.gcp.StartServerHandshakeReq.rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions + 15, // 14: grpc.gcp.StartServerHandshakeReq.transport_protocol_preferences:type_name -> grpc.gcp.TransportProtocolPreferences + 4, // 15: grpc.gcp.HandshakerReq.client_start:type_name -> grpc.gcp.StartClientHandshakeReq + 6, // 16: grpc.gcp.HandshakerReq.server_start:type_name -> grpc.gcp.StartServerHandshakeReq + 7, // 17: grpc.gcp.HandshakerReq.next:type_name -> grpc.gcp.NextHandshakeMessageReq + 3, // 18: grpc.gcp.HandshakerResult.peer_identity:type_name -> grpc.gcp.Identity + 3, // 19: grpc.gcp.HandshakerResult.local_identity:type_name -> grpc.gcp.Identity + 14, // 20: grpc.gcp.HandshakerResult.peer_rpc_versions:type_name -> grpc.gcp.RpcProtocolVersions + 16, // 21: grpc.gcp.HandshakerResult.transport_protocol:type_name -> grpc.gcp.NegotiatedTransportProtocol + 9, // 22: grpc.gcp.HandshakerResp.result:type_name -> grpc.gcp.HandshakerResult + 10, // 23: grpc.gcp.HandshakerResp.status:type_name -> grpc.gcp.HandshakerStatus + 5, // 24: grpc.gcp.StartServerHandshakeReq.HandshakeParametersEntry.value:type_name -> grpc.gcp.ServerHandshakeParameters + 8, // 25: grpc.gcp.HandshakerService.DoHandshake:input_type -> grpc.gcp.HandshakerReq + 11, // 26: grpc.gcp.HandshakerService.DoHandshake:output_type -> grpc.gcp.HandshakerResp + 26, // [26:27] is the sub-list for method output_type + 25, // [25:26] is the sub-list for method input_type + 25, // [25:25] is the sub-list for extension type_name + 25, // [25:25] is the sub-list for extension extendee + 0, // [0:25] is the sub-list for field type_name } func init() { file_grpc_gcp_handshaker_proto_init() } diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go index 34443b1d2..21cb01be6 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/handshaker_grpc.pb.go @@ -95,7 +95,7 @@ type HandshakerServiceServer interface { type UnimplementedHandshakerServiceServer struct{} func (UnimplementedHandshakerServiceServer) DoHandshake(grpc.BidiStreamingServer[HandshakerReq, HandshakerResp]) error { - return status.Errorf(codes.Unimplemented, "method DoHandshake not implemented") + return status.Error(codes.Unimplemented, "method DoHandshake not implemented") } func (UnimplementedHandshakerServiceServer) mustEmbedUnimplementedHandshakerServiceServer() {} func (UnimplementedHandshakerServiceServer) testEmbeddedByValue() {} diff --git a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go index 5d38a74c6..cf48193cb 100644 --- a/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go +++ b/vendor/google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcp/transport_security_common.pb.go @@ -17,7 +17,7 @@ // Code generated by protoc-gen-go. DO NOT EDIT. // versions: -// protoc-gen-go v1.36.5 +// protoc-gen-go v1.36.6 // protoc v5.27.1 // source: grpc/gcp/transport_security_common.proto @@ -144,6 +144,97 @@ func (x *RpcProtocolVersions) GetMinRpcVersion() *RpcProtocolVersions_Version { return nil } +// The ordered list of protocols that the client wishes to use, or the set +// that the server supports. +type TransportProtocolPreferences struct { + state protoimpl.MessageState `protogen:"open.v1"` + TransportProtocol []string `protobuf:"bytes,1,rep,name=transport_protocol,json=transportProtocol,proto3" json:"transport_protocol,omitempty"` + unknownFields protoimpl.UnknownFields + sizeCache protoimpl.SizeCache +} + +func (x *TransportProtocolPreferences) Reset() { + *x = TransportProtocolPreferences{} + mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *TransportProtocolPreferences) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*TransportProtocolPreferences) ProtoMessage() {} + +func (x *TransportProtocolPreferences) ProtoReflect() protoreflect.Message { + mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use TransportProtocolPreferences.ProtoReflect.Descriptor instead. +func (*TransportProtocolPreferences) Descriptor() ([]byte, []int) { + return file_grpc_gcp_transport_security_common_proto_rawDescGZIP(), []int{1} +} + +func (x *TransportProtocolPreferences) GetTransportProtocol() []string { + if x != nil { + return x.TransportProtocol + } + return nil +} + +// The negotiated transport protocol. +type NegotiatedTransportProtocol struct { + state protoimpl.MessageState `protogen:"open.v1"` + TransportProtocol string `protobuf:"bytes,1,opt,name=transport_protocol,json=transportProtocol,proto3" json:"transport_protocol,omitempty"` + unknownFields protoimpl.UnknownFields + sizeCache protoimpl.SizeCache +} + +func (x *NegotiatedTransportProtocol) Reset() { + *x = NegotiatedTransportProtocol{} + mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[2] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) +} + +func (x *NegotiatedTransportProtocol) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*NegotiatedTransportProtocol) ProtoMessage() {} + +func (x *NegotiatedTransportProtocol) ProtoReflect() protoreflect.Message { + mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[2] + if x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use NegotiatedTransportProtocol.ProtoReflect.Descriptor instead. +func (*NegotiatedTransportProtocol) Descriptor() ([]byte, []int) { + return file_grpc_gcp_transport_security_common_proto_rawDescGZIP(), []int{2} +} + +func (x *NegotiatedTransportProtocol) GetTransportProtocol() string { + if x != nil { + return x.TransportProtocol + } + return "" +} + // RPC version contains a major version and a minor version. type RpcProtocolVersions_Version struct { state protoimpl.MessageState `protogen:"open.v1"` @@ -155,7 +246,7 @@ type RpcProtocolVersions_Version struct { func (x *RpcProtocolVersions_Version) Reset() { *x = RpcProtocolVersions_Version{} - mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1] + mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[3] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -167,7 +258,7 @@ func (x *RpcProtocolVersions_Version) String() string { func (*RpcProtocolVersions_Version) ProtoMessage() {} func (x *RpcProtocolVersions_Version) ProtoReflect() protoreflect.Message { - mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[1] + mi := &file_grpc_gcp_transport_security_common_proto_msgTypes[3] if x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -199,40 +290,24 @@ func (x *RpcProtocolVersions_Version) GetMinor() uint32 { var File_grpc_gcp_transport_security_common_proto protoreflect.FileDescriptor -var file_grpc_gcp_transport_security_common_proto_rawDesc = string([]byte{ - 0x0a, 0x28, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x67, 0x63, 0x70, 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73, - 0x70, 0x6f, 0x72, 0x74, 0x5f, 0x73, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x5f, 0x63, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x08, 0x67, 0x72, 0x70, 0x63, - 0x2e, 0x67, 0x63, 0x70, 0x22, 0xea, 0x01, 0x0a, 0x13, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x4d, 0x0a, 0x0f, - 0x6d, 0x61, 0x78, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, - 0x2e, 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, - 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x6d, 0x61, - 0x78, 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x4d, 0x0a, 0x0f, 0x6d, - 0x69, 0x6e, 0x5f, 0x72, 0x70, 0x63, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, 0x67, 0x63, 0x70, 0x2e, - 0x52, 0x70, 0x63, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x56, 0x65, 0x72, 0x73, 0x69, - 0x6f, 0x6e, 0x73, 0x2e, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x0d, 0x6d, 0x69, 0x6e, - 0x52, 0x70, 0x63, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x1a, 0x35, 0x0a, 0x07, 0x56, 0x65, - 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x0d, 0x52, 0x05, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x12, 0x14, 0x0a, 0x05, 0x6d, - 0x69, 0x6e, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x05, 0x6d, 0x69, 0x6e, 0x6f, - 0x72, 0x2a, 0x51, 0x0a, 0x0d, 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, 0x4c, 0x65, 0x76, - 0x65, 0x6c, 0x12, 0x11, 0x0a, 0x0d, 0x53, 0x45, 0x43, 0x55, 0x52, 0x49, 0x54, 0x59, 0x5f, 0x4e, - 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x12, 0x0a, 0x0e, 0x49, 0x4e, 0x54, 0x45, 0x47, 0x52, 0x49, - 0x54, 0x59, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x01, 0x12, 0x19, 0x0a, 0x15, 0x49, 0x4e, 0x54, - 0x45, 0x47, 0x52, 0x49, 0x54, 0x59, 0x5f, 0x41, 0x4e, 0x44, 0x5f, 0x50, 0x52, 0x49, 0x56, 0x41, - 0x43, 0x59, 0x10, 0x02, 0x42, 0x78, 0x0a, 0x15, 0x69, 0x6f, 0x2e, 0x67, 0x72, 0x70, 0x63, 0x2e, - 0x61, 0x6c, 0x74, 0x73, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x42, 0x1c, 0x54, - 0x72, 0x61, 0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x53, 0x65, 0x63, 0x75, 0x72, 0x69, 0x74, 0x79, - 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x3f, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, - 0x2f, 0x67, 0x72, 0x70, 0x63, 0x2f, 0x63, 0x72, 0x65, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x61, 0x6c, - 0x73, 0x2f, 0x61, 0x6c, 0x74, 0x73, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x2f, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x72, 0x70, 0x63, 0x5f, 0x67, 0x63, 0x70, 0x62, 0x06, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_grpc_gcp_transport_security_common_proto_rawDesc = "" + + "\n" + + "(grpc/gcp/transport_security_common.proto\x12\bgrpc.gcp\"\xea\x01\n" + + "\x13RpcProtocolVersions\x12M\n" + + "\x0fmax_rpc_version\x18\x01 \x01(\v2%.grpc.gcp.RpcProtocolVersions.VersionR\rmaxRpcVersion\x12M\n" + + "\x0fmin_rpc_version\x18\x02 \x01(\v2%.grpc.gcp.RpcProtocolVersions.VersionR\rminRpcVersion\x1a5\n" + + "\aVersion\x12\x14\n" + + "\x05major\x18\x01 \x01(\rR\x05major\x12\x14\n" + + "\x05minor\x18\x02 \x01(\rR\x05minor\"M\n" + + "\x1cTransportProtocolPreferences\x12-\n" + + "\x12transport_protocol\x18\x01 \x03(\tR\x11transportProtocol\"L\n" + + "\x1bNegotiatedTransportProtocol\x12-\n" + + "\x12transport_protocol\x18\x01 \x01(\tR\x11transportProtocol*Q\n" + + "\rSecurityLevel\x12\x11\n" + + "\rSECURITY_NONE\x10\x00\x12\x12\n" + + "\x0eINTEGRITY_ONLY\x10\x01\x12\x19\n" + + "\x15INTEGRITY_AND_PRIVACY\x10\x02Bx\n" + + "\x15io.grpc.alts.internalB\x1cTransportSecurityCommonProtoP\x01Z?google.golang.org/grpc/credentials/alts/internal/proto/grpc_gcpb\x06proto3" var ( file_grpc_gcp_transport_security_common_proto_rawDescOnce sync.Once @@ -247,15 +322,17 @@ func file_grpc_gcp_transport_security_common_proto_rawDescGZIP() []byte { } var file_grpc_gcp_transport_security_common_proto_enumTypes = make([]protoimpl.EnumInfo, 1) -var file_grpc_gcp_transport_security_common_proto_msgTypes = make([]protoimpl.MessageInfo, 2) +var file_grpc_gcp_transport_security_common_proto_msgTypes = make([]protoimpl.MessageInfo, 4) var file_grpc_gcp_transport_security_common_proto_goTypes = []any{ - (SecurityLevel)(0), // 0: grpc.gcp.SecurityLevel - (*RpcProtocolVersions)(nil), // 1: grpc.gcp.RpcProtocolVersions - (*RpcProtocolVersions_Version)(nil), // 2: grpc.gcp.RpcProtocolVersions.Version + (SecurityLevel)(0), // 0: grpc.gcp.SecurityLevel + (*RpcProtocolVersions)(nil), // 1: grpc.gcp.RpcProtocolVersions + (*TransportProtocolPreferences)(nil), // 2: grpc.gcp.TransportProtocolPreferences + (*NegotiatedTransportProtocol)(nil), // 3: grpc.gcp.NegotiatedTransportProtocol + (*RpcProtocolVersions_Version)(nil), // 4: grpc.gcp.RpcProtocolVersions.Version } var file_grpc_gcp_transport_security_common_proto_depIdxs = []int32{ - 2, // 0: grpc.gcp.RpcProtocolVersions.max_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version - 2, // 1: grpc.gcp.RpcProtocolVersions.min_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version + 4, // 0: grpc.gcp.RpcProtocolVersions.max_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version + 4, // 1: grpc.gcp.RpcProtocolVersions.min_rpc_version:type_name -> grpc.gcp.RpcProtocolVersions.Version 2, // [2:2] is the sub-list for method output_type 2, // [2:2] is the sub-list for method input_type 2, // [2:2] is the sub-list for extension type_name @@ -274,7 +351,7 @@ func file_grpc_gcp_transport_security_common_proto_init() { GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: unsafe.Slice(unsafe.StringData(file_grpc_gcp_transport_security_common_proto_rawDesc), len(file_grpc_gcp_transport_security_common_proto_rawDesc)), NumEnums: 1, - NumMessages: 2, + NumMessages: 4, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/google.golang.org/grpc/credentials/credentials.go b/vendor/google.golang.org/grpc/credentials/credentials.go index 665e790bb..c8e337cdd 100644 --- a/vendor/google.golang.org/grpc/credentials/credentials.go +++ b/vendor/google.golang.org/grpc/credentials/credentials.go @@ -96,10 +96,11 @@ func (c CommonAuthInfo) GetCommonAuthInfo() CommonAuthInfo { return c } -// ProtocolInfo provides information regarding the gRPC wire protocol version, -// security protocol, security protocol version in use, server name, etc. +// ProtocolInfo provides static information regarding transport credentials. type ProtocolInfo struct { // ProtocolVersion is the gRPC wire protocol version. + // + // Deprecated: this is unused by gRPC. ProtocolVersion string // SecurityProtocol is the security protocol in use. SecurityProtocol string @@ -109,7 +110,16 @@ type ProtocolInfo struct { // // Deprecated: please use Peer.AuthInfo. SecurityVersion string - // ServerName is the user-configured server name. + // ServerName is the user-configured server name. If set, this overrides + // the default :authority header used for all RPCs on the channel using the + // containing credentials, unless grpc.WithAuthority is set on the channel, + // in which case that setting will take precedence. + // + // This must be a valid `:authority` header according to + // [RFC3986](https://datatracker.ietf.org/doc/html/rfc3986#section-3.2). + // + // Deprecated: Users should use grpc.WithAuthority to override the authority + // on a channel instead of configuring the credentials. ServerName string } @@ -120,6 +130,20 @@ type AuthInfo interface { AuthType() string } +// AuthorityValidator validates the authority used to override the `:authority` +// header. This is an optional interface that implementations of AuthInfo can +// implement if they support per-RPC authority overrides. It is invoked when the +// application attempts to override the HTTP/2 `:authority` header using the +// CallAuthority call option. +type AuthorityValidator interface { + // ValidateAuthority checks the authority value used to override the + // `:authority` header. The authority parameter is the override value + // provided by the application via the CallAuthority option. This value + // typically corresponds to the server hostname or endpoint the RPC is + // targeting. It returns non-nil error if the validation fails. + ValidateAuthority(authority string) error +} + // ErrConnDispatched indicates that rawConn has been dispatched out of gRPC // and the caller should not close rawConn. var ErrConnDispatched = errors.New("credentials: rawConn is dispatched out of gRPC") @@ -159,12 +183,17 @@ type TransportCredentials interface { // Clone makes a copy of this TransportCredentials. Clone() TransportCredentials // OverrideServerName specifies the value used for the following: + // // - verifying the hostname on the returned certificates // - as SNI in the client's handshake to support virtual hosting // - as the value for `:authority` header at stream creation time // - // Deprecated: use grpc.WithAuthority instead. Will be supported - // throughout 1.x. + // The provided string should be a valid `:authority` header according to + // [RFC3986](https://datatracker.ietf.org/doc/html/rfc3986#section-3.2). + // + // Deprecated: this method is unused by gRPC. Users should use + // grpc.WithAuthority to override the authority on a channel instead of + // configuring the credentials. OverrideServerName(string) error } @@ -207,14 +236,32 @@ type RequestInfo struct { AuthInfo AuthInfo } +// requestInfoKey is a struct to be used as the key to store RequestInfo in a +// context. +type requestInfoKey struct{} + // RequestInfoFromContext extracts the RequestInfo from the context if it exists. // // This API is experimental. func RequestInfoFromContext(ctx context.Context) (ri RequestInfo, ok bool) { - ri, ok = icredentials.RequestInfoFromContext(ctx).(RequestInfo) + ri, ok = ctx.Value(requestInfoKey{}).(RequestInfo) return ri, ok } +// NewContextWithRequestInfo creates a new context from ctx and attaches ri to it. +// +// This RequestInfo will be accessible via RequestInfoFromContext. +// +// Intended to be used from tests for PerRPCCredentials implementations (that +// often need to check connection's SecurityLevel). Should not be used from +// non-test code: the gRPC client already prepares a context with the correct +// RequestInfo attached when calling PerRPCCredentials.GetRequestMetadata. +// +// This API is experimental. +func NewContextWithRequestInfo(ctx context.Context, ri RequestInfo) context.Context { + return context.WithValue(ctx, requestInfoKey{}, ri) +} + // ClientHandshakeInfo holds data to be passed to ClientHandshake. This makes // it possible to pass arbitrary data to the handshaker from gRPC, resolver, // balancer etc. Individual credential implementations control the actual diff --git a/vendor/google.golang.org/grpc/credentials/insecure/insecure.go b/vendor/google.golang.org/grpc/credentials/insecure/insecure.go index 4c805c644..93156c0f3 100644 --- a/vendor/google.golang.org/grpc/credentials/insecure/insecure.go +++ b/vendor/google.golang.org/grpc/credentials/insecure/insecure.go @@ -30,7 +30,7 @@ import ( // NewCredentials returns a credentials which disables transport security. // // Note that using this credentials with per-RPC credentials which require -// transport security is incompatible and will cause grpc.Dial() to fail. +// transport security is incompatible and will cause RPCs to fail. func NewCredentials() credentials.TransportCredentials { return insecureTC{} } @@ -71,6 +71,12 @@ func (info) AuthType() string { return "insecure" } +// ValidateAuthority allows any value to be overridden for the :authority +// header. +func (info) ValidateAuthority(string) error { + return nil +} + // insecureBundle implements an insecure bundle. // An insecure bundle provides a thin wrapper around insecureTC to support // the credentials.Bundle interface. diff --git a/vendor/google.golang.org/grpc/credentials/tls.go b/vendor/google.golang.org/grpc/credentials/tls.go index bd5fe22b6..8277be7d6 100644 --- a/vendor/google.golang.org/grpc/credentials/tls.go +++ b/vendor/google.golang.org/grpc/credentials/tls.go @@ -22,6 +22,7 @@ import ( "context" "crypto/tls" "crypto/x509" + "errors" "fmt" "net" "net/url" @@ -50,6 +51,21 @@ func (t TLSInfo) AuthType() string { return "tls" } +// ValidateAuthority validates the provided authority being used to override the +// :authority header by verifying it against the peer certificates. It returns a +// non-nil error if the validation fails. +func (t TLSInfo) ValidateAuthority(authority string) error { + var errs []error + for _, cert := range t.State.PeerCertificates { + var err error + if err = cert.VerifyHostname(authority); err == nil { + return nil + } + errs = append(errs, err) + } + return fmt.Errorf("credentials: invalid authority %q: %v", authority, errors.Join(errs...)) +} + // cipherSuiteLookup returns the string version of a TLS cipher suite ID. func cipherSuiteLookup(cipherSuiteID uint16) string { for _, s := range tls.CipherSuites() { @@ -94,14 +110,14 @@ func (c tlsCreds) Info() ProtocolInfo { func (c *tlsCreds) ClientHandshake(ctx context.Context, authority string, rawConn net.Conn) (_ net.Conn, _ AuthInfo, err error) { // use local cfg to avoid clobbering ServerName if using multiple endpoints cfg := credinternal.CloneTLSConfig(c.config) - if cfg.ServerName == "" { - serverName, _, err := net.SplitHostPort(authority) - if err != nil { - // If the authority had no host port or if the authority cannot be parsed, use it as-is. - serverName = authority - } - cfg.ServerName = serverName + + serverName, _, err := net.SplitHostPort(authority) + if err != nil { + // If the authority had no host port or if the authority cannot be parsed, use it as-is. + serverName = authority } + cfg.ServerName = serverName + conn := tls.Client(rawConn, cfg) errChannel := make(chan error, 1) go func() { @@ -243,9 +259,11 @@ func applyDefaults(c *tls.Config) *tls.Config { // certificates to establish the identity of the client need to be included in // the credentials (eg: for mTLS), use NewTLS instead, where a complete // tls.Config can be specified. -// serverNameOverride is for testing only. If set to a non empty string, -// it will override the virtual host name of authority (e.g. :authority header -// field) in requests. +// +// serverNameOverride is for testing only. If set to a non empty string, it will +// override the virtual host name of authority (e.g. :authority header field) in +// requests. Users should use grpc.WithAuthority passed to grpc.NewClient to +// override the authority of the client instead. func NewClientTLSFromCert(cp *x509.CertPool, serverNameOverride string) TransportCredentials { return NewTLS(&tls.Config{ServerName: serverNameOverride, RootCAs: cp}) } @@ -255,9 +273,11 @@ func NewClientTLSFromCert(cp *x509.CertPool, serverNameOverride string) Transpor // certificates to establish the identity of the client need to be included in // the credentials (eg: for mTLS), use NewTLS instead, where a complete // tls.Config can be specified. -// serverNameOverride is for testing only. If set to a non empty string, -// it will override the virtual host name of authority (e.g. :authority header -// field) in requests. +// +// serverNameOverride is for testing only. If set to a non empty string, it will +// override the virtual host name of authority (e.g. :authority header field) in +// requests. Users should use grpc.WithAuthority passed to grpc.NewClient to +// override the authority of the client instead. func NewClientTLSFromFile(certFile, serverNameOverride string) (TransportCredentials, error) { b, err := os.ReadFile(certFile) if err != nil { diff --git a/vendor/google.golang.org/grpc/dialoptions.go b/vendor/google.golang.org/grpc/dialoptions.go index 405a2ffeb..7a5ac2e7c 100644 --- a/vendor/google.golang.org/grpc/dialoptions.go +++ b/vendor/google.golang.org/grpc/dialoptions.go @@ -213,6 +213,7 @@ func WithReadBufferSize(s int) DialOption { func WithInitialWindowSize(s int32) DialOption { return newFuncDialOption(func(o *dialOptions) { o.copts.InitialWindowSize = s + o.copts.StaticWindowSize = true }) } @@ -222,6 +223,26 @@ func WithInitialWindowSize(s int32) DialOption { func WithInitialConnWindowSize(s int32) DialOption { return newFuncDialOption(func(o *dialOptions) { o.copts.InitialConnWindowSize = s + o.copts.StaticWindowSize = true + }) +} + +// WithStaticStreamWindowSize returns a DialOption which sets the initial +// stream window size to the value provided and disables dynamic flow control. +func WithStaticStreamWindowSize(s int32) DialOption { + return newFuncDialOption(func(o *dialOptions) { + o.copts.InitialWindowSize = s + o.copts.StaticWindowSize = true + }) +} + +// WithStaticConnWindowSize returns a DialOption which sets the initial +// connection window size to the value provided and disables dynamic flow +// control. +func WithStaticConnWindowSize(s int32) DialOption { + return newFuncDialOption(func(o *dialOptions) { + o.copts.InitialConnWindowSize = s + o.copts.StaticWindowSize = true }) } @@ -360,7 +381,7 @@ func WithReturnConnectionError() DialOption { // // Note that using this DialOption with per-RPC credentials (through // WithCredentialsBundle or WithPerRPCCredentials) which require transport -// security is incompatible and will cause grpc.Dial() to fail. +// security is incompatible and will cause RPCs to fail. // // Deprecated: use WithTransportCredentials and insecure.NewCredentials() // instead. Will be supported throughout 1.x. @@ -587,6 +608,8 @@ func WithChainStreamInterceptor(interceptors ...StreamClientInterceptor) DialOpt // WithAuthority returns a DialOption that specifies the value to be used as the // :authority pseudo-header and as the server name in authentication handshake. +// This overrides all other ways of setting authority on the channel, but can be +// overridden per-call by using grpc.CallAuthority. func WithAuthority(a string) DialOption { return newFuncDialOption(func(o *dialOptions) { o.authority = a diff --git a/vendor/google.golang.org/grpc/encoding/proto/proto.go b/vendor/google.golang.org/grpc/encoding/proto/proto.go index ceec319dd..1ab874c7a 100644 --- a/vendor/google.golang.org/grpc/encoding/proto/proto.go +++ b/vendor/google.golang.org/grpc/encoding/proto/proto.go @@ -46,9 +46,25 @@ func (c *codecV2) Marshal(v any) (data mem.BufferSlice, err error) { return nil, fmt.Errorf("proto: failed to marshal, message is %T, want proto.Message", v) } + // Important: if we remove this Size call then we cannot use + // UseCachedSize in MarshalOptions below. size := proto.Size(vv) + + // MarshalOptions with UseCachedSize allows reusing the result from the + // previous Size call. This is safe here because: + // + // 1. We just computed the size. + // 2. We assume the message is not being mutated concurrently. + // + // Important: If the proto.Size call above is removed, using UseCachedSize + // becomes unsafe and may lead to incorrect marshaling. + // + // For more details, see the doc of UseCachedSize: + // https://pkg.go.dev/google.golang.org/protobuf/proto#MarshalOptions + marshalOptions := proto.MarshalOptions{UseCachedSize: true} + if mem.IsBelowBufferPoolingThreshold(size) { - buf, err := proto.Marshal(vv) + buf, err := marshalOptions.Marshal(vv) if err != nil { return nil, err } @@ -56,7 +72,7 @@ func (c *codecV2) Marshal(v any) (data mem.BufferSlice, err error) { } else { pool := mem.DefaultBufferPool() buf := pool.Get(size) - if _, err := (proto.MarshalOptions{}).MarshalAppend((*buf)[:0], vv); err != nil { + if _, err := marshalOptions.MarshalAppend((*buf)[:0], vv); err != nil { pool.Put(buf) return nil, err } diff --git a/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go b/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go index fbc1ca356..ba25b8988 100644 --- a/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go +++ b/vendor/google.golang.org/grpc/internal/balancer/gracefulswitch/gracefulswitch.go @@ -223,15 +223,7 @@ func (gsb *Balancer) ExitIdle() { // There is no need to protect this read with a mutex, as the write to the // Balancer field happens in SwitchTo, which completes before this can be // called. - if ei, ok := balToUpdate.Balancer.(balancer.ExitIdler); ok { - ei.ExitIdle() - return - } - gsb.mu.Lock() - defer gsb.mu.Unlock() - for sc := range balToUpdate.subconns { - sc.Connect() - } + balToUpdate.ExitIdle() } // updateSubConnState forwards the update to the appropriate child. diff --git a/vendor/google.golang.org/grpc/internal/buffer/unbounded.go b/vendor/google.golang.org/grpc/internal/buffer/unbounded.go index 11f91668a..467392b8d 100644 --- a/vendor/google.golang.org/grpc/internal/buffer/unbounded.go +++ b/vendor/google.golang.org/grpc/internal/buffer/unbounded.go @@ -83,6 +83,7 @@ func (b *Unbounded) Load() { default: } } else if b.closing && !b.closed { + b.closed = true close(b.c) } } diff --git a/vendor/google.golang.org/grpc/internal/channelz/trace.go b/vendor/google.golang.org/grpc/internal/channelz/trace.go index 2bffe4777..3b7ba5966 100644 --- a/vendor/google.golang.org/grpc/internal/channelz/trace.go +++ b/vendor/google.golang.org/grpc/internal/channelz/trace.go @@ -194,7 +194,7 @@ func (r RefChannelType) String() string { // If channelz is not turned ON, this will simply log the event descriptions. func AddTraceEvent(l grpclog.DepthLoggerV2, e Entity, depth int, desc *TraceEvent) { // Log only the trace description associated with the bottom most entity. - d := fmt.Sprintf("[%s]%s", e, desc.Desc) + d := fmt.Sprintf("[%s] %s", e, desc.Desc) switch desc.Severity { case CtUnknown, CtInfo: l.InfoDepth(depth+1, d) diff --git a/vendor/google.golang.org/grpc/internal/credentials/credentials.go b/vendor/google.golang.org/grpc/internal/credentials/credentials.go index 9deee7f65..48b22d9cf 100644 --- a/vendor/google.golang.org/grpc/internal/credentials/credentials.go +++ b/vendor/google.golang.org/grpc/internal/credentials/credentials.go @@ -20,20 +20,6 @@ import ( "context" ) -// requestInfoKey is a struct to be used as the key to store RequestInfo in a -// context. -type requestInfoKey struct{} - -// NewRequestInfoContext creates a context with ri. -func NewRequestInfoContext(ctx context.Context, ri any) context.Context { - return context.WithValue(ctx, requestInfoKey{}, ri) -} - -// RequestInfoFromContext extracts the RequestInfo from ctx. -func RequestInfoFromContext(ctx context.Context) any { - return ctx.Value(requestInfoKey{}) -} - // clientHandshakeInfoKey is a struct used as the key to store // ClientHandshakeInfo in a context. type clientHandshakeInfoKey struct{} diff --git a/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go b/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go index cc5713fd9..7e060f5ed 100644 --- a/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go +++ b/vendor/google.golang.org/grpc/internal/envconfig/envconfig.go @@ -26,30 +26,32 @@ import ( ) var ( - // TXTErrIgnore is set if TXT errors should be ignored ("GRPC_GO_IGNORE_TXT_ERRORS" is not "false"). + // EnableTXTServiceConfig is set if the DNS resolver should perform TXT + // lookups for service config ("GRPC_ENABLE_TXT_SERVICE_CONFIG" is not + // "false"). + EnableTXTServiceConfig = boolFromEnv("GRPC_ENABLE_TXT_SERVICE_CONFIG", true) + + // TXTErrIgnore is set if TXT errors should be ignored + // ("GRPC_GO_IGNORE_TXT_ERRORS" is not "false"). TXTErrIgnore = boolFromEnv("GRPC_GO_IGNORE_TXT_ERRORS", true) + // RingHashCap indicates the maximum ring size which defaults to 4096 // entries but may be overridden by setting the environment variable // "GRPC_RING_HASH_CAP". This does not override the default bounds // checking which NACKs configs specifying ring sizes > 8*1024*1024 (~8M). RingHashCap = uint64FromEnv("GRPC_RING_HASH_CAP", 4096, 1, 8*1024*1024) - // LeastRequestLB is set if we should support the least_request_experimental - // LB policy, which can be enabled by setting the environment variable - // "GRPC_EXPERIMENTAL_ENABLE_LEAST_REQUEST" to "true". - LeastRequestLB = boolFromEnv("GRPC_EXPERIMENTAL_ENABLE_LEAST_REQUEST", false) + // ALTSMaxConcurrentHandshakes is the maximum number of concurrent ALTS // handshakes that can be performed. ALTSMaxConcurrentHandshakes = uint64FromEnv("GRPC_ALTS_MAX_CONCURRENT_HANDSHAKES", 100, 1, 100) + // EnforceALPNEnabled is set if TLS connections to servers with ALPN disabled // should be rejected. The HTTP/2 protocol requires ALPN to be enabled, this // option is present for backward compatibility. This option may be overridden // by setting the environment variable "GRPC_ENFORCE_ALPN_ENABLED" to "true" // or "false". EnforceALPNEnabled = boolFromEnv("GRPC_ENFORCE_ALPN_ENABLED", true) - // XDSFallbackSupport is the env variable that controls whether support for - // xDS fallback is turned on. If this is unset or is false, only the first - // xDS server in the list of server configs will be used. - XDSFallbackSupport = boolFromEnv("GRPC_EXPERIMENTAL_XDS_FALLBACK", true) + // NewPickFirstEnabled is set if the new pickfirst leaf policy is to be used // instead of the exiting pickfirst implementation. This can be disabled by // setting the environment variable "GRPC_EXPERIMENTAL_ENABLE_NEW_PICK_FIRST" @@ -69,6 +71,10 @@ var ( // to gRFC A76. It can be enabled by setting the environment variable // "GRPC_EXPERIMENTAL_RING_HASH_SET_REQUEST_HASH_KEY" to "true". RingHashSetRequestHashKey = boolFromEnv("GRPC_EXPERIMENTAL_RING_HASH_SET_REQUEST_HASH_KEY", false) + + // ALTSHandshakerKeepaliveParams is set if we should add the + // KeepaliveParams when dial the ALTS handshaker service. + ALTSHandshakerKeepaliveParams = boolFromEnv("GRPC_EXPERIMENTAL_ALTS_HANDSHAKER_KEEPALIVE_PARAMS", false) ) func boolFromEnv(envVar string, def bool) bool { diff --git a/vendor/google.golang.org/grpc/internal/envconfig/xds.go b/vendor/google.golang.org/grpc/internal/envconfig/xds.go index 2eb97f832..b1f883bca 100644 --- a/vendor/google.golang.org/grpc/internal/envconfig/xds.go +++ b/vendor/google.golang.org/grpc/internal/envconfig/xds.go @@ -63,4 +63,15 @@ var ( // For more details, see: // https://github.com/grpc/proposal/blob/master/A82-xds-system-root-certs.md. XDSSystemRootCertsEnabled = boolFromEnv("GRPC_EXPERIMENTAL_XDS_SYSTEM_ROOT_CERTS", false) + + // XDSSPIFFEEnabled controls if SPIFFE Bundle Maps can be used as roots of + // trust. For more details, see: + // https://github.com/grpc/proposal/blob/master/A87-mtls-spiffe-support.md + XDSSPIFFEEnabled = boolFromEnv("GRPC_EXPERIMENTAL_XDS_MTLS_SPIFFE", false) + + // XDSHTTPConnectEnabled is true if gRPC should parse custom Metadata + // configuring use of an HTTP CONNECT proxy via xDS from cluster resources. + // For more details, see: + // https://github.com/grpc/proposal/blob/master/A86-xds-http-connect.md + XDSHTTPConnectEnabled = boolFromEnv("GRPC_EXPERIMENTAL_XDS_HTTP_CONNECT", false) ) diff --git a/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go b/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go index 8e8e86128..9b6d8a1fa 100644 --- a/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go +++ b/vendor/google.golang.org/grpc/internal/grpcsync/callback_serializer.go @@ -80,25 +80,11 @@ func (cs *CallbackSerializer) ScheduleOr(f func(ctx context.Context), onFailure func (cs *CallbackSerializer) run(ctx context.Context) { defer close(cs.done) - // TODO: when Go 1.21 is the oldest supported version, this loop and Close - // can be replaced with: - // - // context.AfterFunc(ctx, cs.callbacks.Close) - for ctx.Err() == nil { - select { - case <-ctx.Done(): - // Do nothing here. Next iteration of the for loop will not happen, - // since ctx.Err() would be non-nil. - case cb := <-cs.callbacks.Get(): - cs.callbacks.Load() - cb.(func(context.Context))(ctx) - } - } - - // Close the buffer to prevent new callbacks from being added. - cs.callbacks.Close() + // Close the buffer when the context is canceled + // to prevent new callbacks from being added. + context.AfterFunc(ctx, cs.callbacks.Close) - // Run all pending callbacks. + // Run all callbacks. for cb := range cs.callbacks.Get() { cs.callbacks.Load() cb.(func(context.Context))(ctx) diff --git a/vendor/google.golang.org/grpc/internal/grpcsync/event.go b/vendor/google.golang.org/grpc/internal/grpcsync/event.go index fbe697c37..d788c2493 100644 --- a/vendor/google.golang.org/grpc/internal/grpcsync/event.go +++ b/vendor/google.golang.org/grpc/internal/grpcsync/event.go @@ -21,28 +21,25 @@ package grpcsync import ( - "sync" "sync/atomic" ) // Event represents a one-time event that may occur in the future. type Event struct { - fired int32 + fired atomic.Bool c chan struct{} - o sync.Once } // Fire causes e to complete. It is safe to call multiple times, and // concurrently. It returns true iff this call to Fire caused the signaling -// channel returned by Done to close. +// channel returned by Done to close. If Fire returns false, it is possible +// the Done channel has not been closed yet. func (e *Event) Fire() bool { - ret := false - e.o.Do(func() { - atomic.StoreInt32(&e.fired, 1) + if e.fired.CompareAndSwap(false, true) { close(e.c) - ret = true - }) - return ret + return true + } + return false } // Done returns a channel that will be closed when Fire is called. @@ -52,7 +49,7 @@ func (e *Event) Done() <-chan struct{} { // HasFired returns true if Fire has been called. func (e *Event) HasFired() bool { - return atomic.LoadInt32(&e.fired) == 1 + return e.fired.Load() } // NewEvent returns a new, ready-to-use Event. diff --git a/vendor/google.golang.org/grpc/internal/internal.go b/vendor/google.golang.org/grpc/internal/internal.go index 2ce012cda..2699223a2 100644 --- a/vendor/google.golang.org/grpc/internal/internal.go +++ b/vendor/google.golang.org/grpc/internal/internal.go @@ -182,35 +182,6 @@ var ( // other features, including the CSDS service. NewXDSResolverWithClientForTesting any // func(xdsclient.XDSClient) (resolver.Builder, error) - // RegisterRLSClusterSpecifierPluginForTesting registers the RLS Cluster - // Specifier Plugin for testing purposes, regardless of the XDSRLS environment - // variable. - // - // TODO: Remove this function once the RLS env var is removed. - RegisterRLSClusterSpecifierPluginForTesting func() - - // UnregisterRLSClusterSpecifierPluginForTesting unregisters the RLS Cluster - // Specifier Plugin for testing purposes. This is needed because there is no way - // to unregister the RLS Cluster Specifier Plugin after registering it solely - // for testing purposes using RegisterRLSClusterSpecifierPluginForTesting(). - // - // TODO: Remove this function once the RLS env var is removed. - UnregisterRLSClusterSpecifierPluginForTesting func() - - // RegisterRBACHTTPFilterForTesting registers the RBAC HTTP Filter for testing - // purposes, regardless of the RBAC environment variable. - // - // TODO: Remove this function once the RBAC env var is removed. - RegisterRBACHTTPFilterForTesting func() - - // UnregisterRBACHTTPFilterForTesting unregisters the RBAC HTTP Filter for - // testing purposes. This is needed because there is no way to unregister the - // HTTP Filter after registering it solely for testing purposes using - // RegisterRBACHTTPFilterForTesting(). - // - // TODO: Remove this function once the RBAC env var is removed. - UnregisterRBACHTTPFilterForTesting func() - // ORCAAllowAnyMinReportingInterval is for examples/orca use ONLY. ORCAAllowAnyMinReportingInterval any // func(so *orca.ServiceOptions) @@ -266,6 +237,13 @@ var ( TimeAfterFunc = func(d time.Duration, f func()) Timer { return time.AfterFunc(d, f) } + + // NewStreamWaitingForResolver is a test hook that is triggered when a + // new stream blocks while waiting for name resolution. This can be + // used in tests to synchronize resolver updates and avoid race conditions. + // When set, the function will be called before the stream enters + // the blocking state. + NewStreamWaitingForResolver = func() {} ) // HealthChecker defines the signature of the client-side LB channel health diff --git a/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go b/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go index c0e227577..20b8fb098 100644 --- a/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go +++ b/vendor/google.golang.org/grpc/internal/resolver/delegatingresolver/delegatingresolver.go @@ -186,23 +186,15 @@ func (r *delegatingResolver) Close() { r.proxyResolver = nil } -func networkTypeFromAddr(addr resolver.Address) string { - networkType, ok := networktype.Get(addr) - if !ok { - networkType, _ = transport.ParseDialTarget(addr.Addr) - } - return networkType -} - -func isTCPAddressPresent(state *resolver.State) bool { +func needsProxyResolver(state *resolver.State) bool { for _, addr := range state.Addresses { - if networkType := networkTypeFromAddr(addr); networkType == "tcp" { + if !skipProxy(addr) { return true } } for _, endpoint := range state.Endpoints { for _, addr := range endpoint.Addresses { - if networktype := networkTypeFromAddr(addr); networktype == "tcp" { + if !skipProxy(addr) { return true } } @@ -210,6 +202,29 @@ func isTCPAddressPresent(state *resolver.State) bool { return false } +func skipProxy(address resolver.Address) bool { + // Avoid proxy when network is not tcp. + networkType, ok := networktype.Get(address) + if !ok { + networkType, _ = transport.ParseDialTarget(address.Addr) + } + if networkType != "tcp" { + return true + } + + req := &http.Request{URL: &url.URL{ + Scheme: "https", + Host: address.Addr, + }} + // Avoid proxy when address included in `NO_PROXY` environment variable or + // fails to get the proxy address. + url, err := HTTPSProxyFromEnvironment(req) + if err != nil || url == nil { + return true + } + return false +} + // updateClientConnStateLocked constructs a combined list of addresses by // pairing each proxy address with every target address of type TCP. For each // pair, it creates a new [resolver.Address] using the proxy address and @@ -240,8 +255,7 @@ func (r *delegatingResolver) updateClientConnStateLocked() error { } var addresses []resolver.Address for _, targetAddr := range (*r.targetResolverState).Addresses { - // Avoid proxy when network is not tcp. - if networkType := networkTypeFromAddr(targetAddr); networkType != "tcp" { + if skipProxy(targetAddr) { addresses = append(addresses, targetAddr) continue } @@ -259,7 +273,7 @@ func (r *delegatingResolver) updateClientConnStateLocked() error { var addrs []resolver.Address for _, targetAddr := range endpt.Addresses { // Avoid proxy when network is not tcp. - if networkType := networkTypeFromAddr(targetAddr); networkType != "tcp" { + if skipProxy(targetAddr) { addrs = append(addrs, targetAddr) continue } @@ -340,9 +354,10 @@ func (r *delegatingResolver) updateTargetResolverState(state resolver.State) err logger.Infof("Addresses received from target resolver: %v", state.Addresses) } r.targetResolverState = &state - // If no addresses returned by resolver have network type as tcp , do not - // wait for proxy update. - if !isTCPAddressPresent(r.targetResolverState) { + // If all addresses returned by the target resolver have a non-TCP network + // type, or are listed in the `NO_PROXY` environment variable, do not wait + // for proxy update. + if !needsProxyResolver(r.targetResolverState) { return r.cc.UpdateState(*r.targetResolverState) } diff --git a/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go b/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go index ba5c5a95d..ada5251cf 100644 --- a/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go +++ b/vendor/google.golang.org/grpc/internal/resolver/dns/dns_resolver.go @@ -132,13 +132,13 @@ func (b *dnsBuilder) Build(target resolver.Target, cc resolver.ClientConn, opts // DNS address (non-IP). ctx, cancel := context.WithCancel(context.Background()) d := &dnsResolver{ - host: host, - port: port, - ctx: ctx, - cancel: cancel, - cc: cc, - rn: make(chan struct{}, 1), - disableServiceConfig: opts.DisableServiceConfig, + host: host, + port: port, + ctx: ctx, + cancel: cancel, + cc: cc, + rn: make(chan struct{}, 1), + enableServiceConfig: envconfig.EnableTXTServiceConfig && !opts.DisableServiceConfig, } d.resolver, err = internal.NewNetResolver(target.URL.Host) @@ -181,8 +181,8 @@ type dnsResolver struct { // finishes, race detector sometimes will warn lookup (READ the lookup // function pointers) inside watcher() goroutine has data race with // replaceNetFunc (WRITE the lookup function pointers). - wg sync.WaitGroup - disableServiceConfig bool + wg sync.WaitGroup + enableServiceConfig bool } // ResolveNow invoke an immediate resolution of the target that this @@ -346,7 +346,7 @@ func (d *dnsResolver) lookup() (*resolver.State, error) { if len(srv) > 0 { state = grpclbstate.Set(state, &grpclbstate.State{BalancerAddresses: srv}) } - if !d.disableServiceConfig { + if d.enableServiceConfig { state.ServiceConfig = d.lookupTXT(ctx) } return &state, nil diff --git a/vendor/google.golang.org/grpc/internal/status/status.go b/vendor/google.golang.org/grpc/internal/status/status.go index 1186f1e9a..aad171cd0 100644 --- a/vendor/google.golang.org/grpc/internal/status/status.go +++ b/vendor/google.golang.org/grpc/internal/status/status.go @@ -236,3 +236,11 @@ func IsRestrictedControlPlaneCode(s *Status) bool { } return false } + +// RawStatusProto returns the internal protobuf message for use by gRPC itself. +func RawStatusProto(s *Status) *spb.Status { + if s == nil { + return nil + } + return s.s +} diff --git a/vendor/google.golang.org/grpc/internal/transport/controlbuf.go b/vendor/google.golang.org/grpc/internal/transport/controlbuf.go index ef72fbb3a..a2831e5d0 100644 --- a/vendor/google.golang.org/grpc/internal/transport/controlbuf.go +++ b/vendor/google.golang.org/grpc/internal/transport/controlbuf.go @@ -40,6 +40,13 @@ var updateHeaderTblSize = func(e *hpack.Encoder, v uint32) { e.SetMaxDynamicTableSizeLimit(v) } +// itemNodePool is used to reduce heap allocations. +var itemNodePool = sync.Pool{ + New: func() any { + return &itemNode{} + }, +} + type itemNode struct { it any next *itemNode @@ -51,7 +58,9 @@ type itemList struct { } func (il *itemList) enqueue(i any) { - n := &itemNode{it: i} + n := itemNodePool.Get().(*itemNode) + n.next = nil + n.it = i if il.tail == nil { il.head, il.tail = n, n return @@ -71,7 +80,9 @@ func (il *itemList) dequeue() any { return nil } i := il.head.it + temp := il.head il.head = il.head.next + itemNodePool.Put(temp) if il.head == nil { il.tail = nil } @@ -146,10 +157,11 @@ type earlyAbortStream struct { func (*earlyAbortStream) isTransportResponseFrame() bool { return false } type dataFrame struct { - streamID uint32 - endStream bool - h []byte - reader mem.Reader + streamID uint32 + endStream bool + h []byte + data mem.BufferSlice + processing bool // onEachWrite is called every time // a part of data is written out. onEachWrite func() @@ -234,6 +246,7 @@ type outStream struct { itl *itemList bytesOutStanding int wq *writeQuota + reader mem.Reader next *outStream prev *outStream @@ -461,7 +474,9 @@ func (c *controlBuffer) finish() { v.onOrphaned(ErrConnClosing) } case *dataFrame: - _ = v.reader.Close() + if !v.processing { + v.data.Free() + } } } @@ -650,10 +665,11 @@ func (l *loopyWriter) incomingSettingsHandler(s *incomingSettings) error { func (l *loopyWriter) registerStreamHandler(h *registerStream) { str := &outStream{ - id: h.streamID, - state: empty, - itl: &itemList{}, - wq: h.wq, + id: h.streamID, + state: empty, + itl: &itemList{}, + wq: h.wq, + reader: mem.BufferSlice{}.Reader(), } l.estdStreams[h.streamID] = str } @@ -685,10 +701,11 @@ func (l *loopyWriter) headerHandler(h *headerFrame) error { } // Case 2: Client wants to originate stream. str := &outStream{ - id: h.streamID, - state: empty, - itl: &itemList{}, - wq: h.wq, + id: h.streamID, + state: empty, + itl: &itemList{}, + wq: h.wq, + reader: mem.BufferSlice{}.Reader(), } return l.originateStream(str, h) } @@ -790,10 +807,13 @@ func (l *loopyWriter) cleanupStreamHandler(c *cleanupStream) error { // a RST_STREAM before stream initialization thus the stream might // not be established yet. delete(l.estdStreams, c.streamID) + str.reader.Close() str.deleteSelf() for head := str.itl.dequeueAll(); head != nil; head = head.next { if df, ok := head.it.(*dataFrame); ok { - _ = df.reader.Close() + if !df.processing { + df.data.Free() + } } } } @@ -928,7 +948,13 @@ func (l *loopyWriter) processData() (bool, error) { if str == nil { return true, nil } + reader := str.reader dataItem := str.itl.peek().(*dataFrame) // Peek at the first data item this stream. + if !dataItem.processing { + dataItem.processing = true + str.reader.Reset(dataItem.data) + dataItem.data.Free() + } // A data item is represented by a dataFrame, since it later translates into // multiple HTTP2 data frames. // Every dataFrame has two buffers; h that keeps grpc-message header and data @@ -936,13 +962,13 @@ func (l *loopyWriter) processData() (bool, error) { // from data is copied to h to make as big as the maximum possible HTTP2 frame // size. - if len(dataItem.h) == 0 && dataItem.reader.Remaining() == 0 { // Empty data frame + if len(dataItem.h) == 0 && reader.Remaining() == 0 { // Empty data frame // Client sends out empty data frame with endStream = true if err := l.framer.fr.WriteData(dataItem.streamID, dataItem.endStream, nil); err != nil { return false, err } str.itl.dequeue() // remove the empty data item from stream - _ = dataItem.reader.Close() + _ = reader.Close() if str.itl.isEmpty() { str.state = empty } else if trailer, ok := str.itl.peek().(*headerFrame); ok { // the next item is trailers. @@ -971,8 +997,8 @@ func (l *loopyWriter) processData() (bool, error) { } // Compute how much of the header and data we can send within quota and max frame length hSize := min(maxSize, len(dataItem.h)) - dSize := min(maxSize-hSize, dataItem.reader.Remaining()) - remainingBytes := len(dataItem.h) + dataItem.reader.Remaining() - hSize - dSize + dSize := min(maxSize-hSize, reader.Remaining()) + remainingBytes := len(dataItem.h) + reader.Remaining() - hSize - dSize size := hSize + dSize var buf *[]byte @@ -993,7 +1019,7 @@ func (l *loopyWriter) processData() (bool, error) { defer pool.Put(buf) copy((*buf)[:hSize], dataItem.h) - _, _ = dataItem.reader.Read((*buf)[hSize:]) + _, _ = reader.Read((*buf)[hSize:]) } // Now that outgoing flow controls are checked we can replenish str's write quota @@ -1014,7 +1040,7 @@ func (l *loopyWriter) processData() (bool, error) { dataItem.h = dataItem.h[hSize:] if remainingBytes == 0 { // All the data from that message was written out. - _ = dataItem.reader.Close() + _ = reader.Close() str.itl.dequeue() } if str.itl.isEmpty() { diff --git a/vendor/google.golang.org/grpc/internal/transport/handler_server.go b/vendor/google.golang.org/grpc/internal/transport/handler_server.go index 3dea23573..d954a64c3 100644 --- a/vendor/google.golang.org/grpc/internal/transport/handler_server.go +++ b/vendor/google.golang.org/grpc/internal/transport/handler_server.go @@ -277,11 +277,13 @@ func (ht *serverHandlerTransport) writeStatus(s *ServerStream, st *status.Status if err == nil { // transport has not been closed // Note: The trailer fields are compressed with hpack after this call returns. // No WireLength field is set here. + s.hdrMu.Lock() for _, sh := range ht.stats { sh.HandleRPC(s.Context(), &stats.OutTrailer{ Trailer: s.trailer.Copy(), }) } + s.hdrMu.Unlock() } ht.Close(errors.New("finished writing status")) return err diff --git a/vendor/google.golang.org/grpc/internal/transport/http2_client.go b/vendor/google.golang.org/grpc/internal/transport/http2_client.go index 171e690a3..7cb238794 100644 --- a/vendor/google.golang.org/grpc/internal/transport/http2_client.go +++ b/vendor/google.golang.org/grpc/internal/transport/http2_client.go @@ -309,11 +309,9 @@ func NewHTTP2Client(connectCtx, ctx context.Context, addr resolver.Address, opts scheme = "https" } } - dynamicWindow := true icwz := int32(initialWindowSize) if opts.InitialConnWindowSize >= defaultWindowSize { icwz = opts.InitialConnWindowSize - dynamicWindow = false } writeBufSize := opts.WriteBufferSize readBufSize := opts.ReadBufferSize @@ -381,9 +379,8 @@ func NewHTTP2Client(connectCtx, ctx context.Context, addr resolver.Address, opts t.controlBuf = newControlBuffer(t.ctxDone) if opts.InitialWindowSize >= defaultWindowSize { t.initialWindowSize = opts.InitialWindowSize - dynamicWindow = false } - if dynamicWindow { + if !opts.StaticWindowSize { t.bdpEst = &bdpEstimator{ bdp: initialWindowSize, updateFlowControl: t.updateFlowControl, @@ -545,7 +542,7 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr) Method: callHdr.Method, AuthInfo: t.authInfo, } - ctxWithRequestInfo := icredentials.NewRequestInfoContext(ctx, ri) + ctxWithRequestInfo := credentials.NewContextWithRequestInfo(ctx, ri) authData, err := t.getTrAuthData(ctxWithRequestInfo, aud) if err != nil { return nil, err @@ -559,6 +556,19 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr) // Make the slice of certain predictable size to reduce allocations made by append. hfLen := 7 // :method, :scheme, :path, :authority, content-type, user-agent, te hfLen += len(authData) + len(callAuthData) + registeredCompressors := t.registeredCompressors + if callHdr.PreviousAttempts > 0 { + hfLen++ + } + if callHdr.SendCompress != "" { + hfLen++ + } + if registeredCompressors != "" { + hfLen++ + } + if _, ok := ctx.Deadline(); ok { + hfLen++ + } headerFields := make([]hpack.HeaderField, 0, hfLen) headerFields = append(headerFields, hpack.HeaderField{Name: ":method", Value: "POST"}) headerFields = append(headerFields, hpack.HeaderField{Name: ":scheme", Value: t.scheme}) @@ -571,7 +581,6 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr) headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-previous-rpc-attempts", Value: strconv.Itoa(callHdr.PreviousAttempts)}) } - registeredCompressors := t.registeredCompressors if callHdr.SendCompress != "" { headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-encoding", Value: callHdr.SendCompress}) // Include the outgoing compressor name when compressor is not registered @@ -592,6 +601,9 @@ func (t *http2Client) createHeaderFields(ctx context.Context, callHdr *CallHdr) // Send out timeout regardless its value. The server can detect timeout context by itself. // TODO(mmukhi): Perhaps this field should be updated when actually writing out to the wire. timeout := time.Until(dl) + if timeout <= 0 { + return nil, status.Error(codes.DeadlineExceeded, context.DeadlineExceeded.Error()) + } headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-timeout", Value: grpcutil.EncodeDuration(timeout)}) } for k, v := range authData { @@ -749,6 +761,25 @@ func (t *http2Client) NewStream(ctx context.Context, callHdr *CallHdr) (*ClientS callHdr = &newCallHdr } + // The authority specified via the `CallAuthority` CallOption takes the + // highest precedence when determining the `:authority` header. It overrides + // any value present in the Host field of CallHdr. Before applying this + // override, the authority string is validated. If the credentials do not + // implement the AuthorityValidator interface, or if validation fails, the + // RPC is failed with a status code of `UNAVAILABLE`. + if callHdr.Authority != "" { + auth, ok := t.authInfo.(credentials.AuthorityValidator) + if !ok { + return nil, &NewStreamError{Err: status.Errorf(codes.Unavailable, "credentials type %q does not implement the AuthorityValidator interface, but authority override specified with CallAuthority call option", t.authInfo.AuthType())} + } + if err := auth.ValidateAuthority(callHdr.Authority); err != nil { + return nil, &NewStreamError{Err: status.Errorf(codes.Unavailable, "failed to validate authority %q : %v", callHdr.Authority, err)} + } + newCallHdr := *callHdr + newCallHdr.Host = callHdr.Authority + callHdr = &newCallHdr + } + headerFields, err := t.createHeaderFields(ctx, callHdr) if err != nil { return nil, &NewStreamError{Err: err, AllowTransparentRetry: false} @@ -1069,32 +1100,29 @@ func (t *http2Client) GracefulClose() { // Write formats the data into HTTP2 data frame(s) and sends it out. The caller // should proceed only if Write returns nil. func (t *http2Client) write(s *ClientStream, hdr []byte, data mem.BufferSlice, opts *WriteOptions) error { - reader := data.Reader() - if opts.Last { // If it's the last message, update stream state. if !s.compareAndSwapState(streamActive, streamWriteDone) { - _ = reader.Close() return errStreamDone } } else if s.getState() != streamActive { - _ = reader.Close() return errStreamDone } df := &dataFrame{ streamID: s.id, endStream: opts.Last, h: hdr, - reader: reader, + data: data, } - if hdr != nil || df.reader.Remaining() != 0 { // If it's not an empty data frame, check quota. - if err := s.wq.get(int32(len(hdr) + df.reader.Remaining())); err != nil { - _ = reader.Close() + dataLen := data.Len() + if hdr != nil || dataLen != 0 { // If it's not an empty data frame, check quota. + if err := s.wq.get(int32(len(hdr) + dataLen)); err != nil { return err } } + data.Ref() if err := t.controlBuf.put(df); err != nil { - _ = reader.Close() + data.Free() return err } t.incrMsgSent() @@ -1483,13 +1511,6 @@ func (t *http2Client) operateHeaders(frame *http2.MetaHeadersFrame) { case "grpc-message": grpcMessage = decodeGrpcMessage(hf.Value) case ":status": - if hf.Value == "200" { - httpStatusErr = "" - statusCode := 200 - httpStatusCode = &statusCode - break - } - c, err := strconv.ParseInt(hf.Value, 10, 32) if err != nil { se := status.New(codes.Internal, fmt.Sprintf("transport: malformed http-status: %v", err)) @@ -1497,7 +1518,19 @@ func (t *http2Client) operateHeaders(frame *http2.MetaHeadersFrame) { return } statusCode := int(c) + if statusCode >= 100 && statusCode < 200 { + if endStream { + se := status.New(codes.Internal, fmt.Sprintf( + "protocol error: informational header with status code %d must not have END_STREAM set", statusCode)) + t.closeStream(s, se.Err(), true, http2.ErrCodeProtocol, se, nil, endStream) + } + return + } httpStatusCode = &statusCode + if statusCode == 200 { + httpStatusErr = "" + break + } httpStatusErr = fmt.Sprintf( "unexpected HTTP status code received from server: %d (%s)", diff --git a/vendor/google.golang.org/grpc/internal/transport/http2_server.go b/vendor/google.golang.org/grpc/internal/transport/http2_server.go index 7e53eb173..83cee314c 100644 --- a/vendor/google.golang.org/grpc/internal/transport/http2_server.go +++ b/vendor/google.golang.org/grpc/internal/transport/http2_server.go @@ -39,6 +39,7 @@ import ( "google.golang.org/grpc/internal/grpclog" "google.golang.org/grpc/internal/grpcutil" "google.golang.org/grpc/internal/pretty" + istatus "google.golang.org/grpc/internal/status" "google.golang.org/grpc/internal/syscall" "google.golang.org/grpc/mem" "google.golang.org/protobuf/proto" @@ -131,6 +132,10 @@ type http2Server struct { maxStreamID uint32 // max stream ID ever seen logger *grpclog.PrefixLogger + // setResetPingStrikes is stored as a closure instead of making this a + // method on http2Server to avoid a heap allocation when converting a method + // to a closure for passing to frames objects. + setResetPingStrikes func() } // NewServerTransport creates a http2 transport with conn and configuration @@ -175,16 +180,13 @@ func NewServerTransport(conn net.Conn, config *ServerConfig) (_ ServerTransport, Val: config.MaxStreams, }) } - dynamicWindow := true iwz := int32(initialWindowSize) if config.InitialWindowSize >= defaultWindowSize { iwz = config.InitialWindowSize - dynamicWindow = false } icwz := int32(initialWindowSize) if config.InitialConnWindowSize >= defaultWindowSize { icwz = config.InitialConnWindowSize - dynamicWindow = false } if iwz != defaultWindowSize { isettings = append(isettings, http2.Setting{ @@ -265,6 +267,9 @@ func NewServerTransport(conn net.Conn, config *ServerConfig) (_ ServerTransport, initialWindowSize: iwz, bufferPool: config.BufferPool, } + t.setResetPingStrikes = func() { + atomic.StoreUint32(&t.resetPingStrikes, 1) + } var czSecurity credentials.ChannelzSecurityValue if au, ok := authInfo.(credentials.ChannelzSecurityInfo); ok { czSecurity = au.GetSecurityValue() @@ -284,7 +289,7 @@ func NewServerTransport(conn net.Conn, config *ServerConfig) (_ ServerTransport, t.logger = prefixLoggerForServerTransport(t) t.controlBuf = newControlBuffer(t.done) - if dynamicWindow { + if !config.StaticWindowSize { t.bdpEst = &bdpEstimator{ bdp: initialWindowSize, updateFlowControl: t.updateFlowControl, @@ -595,10 +600,25 @@ func (t *http2Server) operateHeaders(ctx context.Context, frame *http2.MetaHeade return nil } } + + if s.ctx.Err() != nil { + t.mu.Unlock() + // Early abort in case the timeout was zero or so low it already fired. + t.controlBuf.put(&earlyAbortStream{ + httpStatus: http.StatusOK, + streamID: s.id, + contentSubtype: s.contentSubtype, + status: status.New(codes.DeadlineExceeded, context.DeadlineExceeded.Error()), + rst: !frame.StreamEnded(), + }) + return nil + } + t.activeStreams[streamID] = s if len(t.activeStreams) == 1 { t.idle = time.Time{} } + // Start a timer to close the stream on reaching the deadline. if timeoutSet { // We need to wait for s.cancel to be updated before calling @@ -1015,10 +1035,6 @@ func (t *http2Server) writeHeader(s *ServerStream, md metadata.MD) error { return nil } -func (t *http2Server) setResetPingStrikes() { - atomic.StoreUint32(&t.resetPingStrikes, 1) -} - func (t *http2Server) writeHeaderLocked(s *ServerStream) error { // TODO(mmukhi): Benchmark if the performance gets better if count the metadata and other header fields // first and create a slice of that exact size. @@ -1055,7 +1071,7 @@ func (t *http2Server) writeHeaderLocked(s *ServerStream) error { return nil } -// WriteStatus sends stream status to the client and terminates the stream. +// writeStatus sends stream status to the client and terminates the stream. // There is no further I/O operations being able to perform on this stream. // TODO(zhaoq): Now it indicates the end of entire stream. Revisit if early // OK is adopted. @@ -1083,7 +1099,7 @@ func (t *http2Server) writeStatus(s *ServerStream, st *status.Status) error { headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-status", Value: strconv.Itoa(int(st.Code()))}) headerFields = append(headerFields, hpack.HeaderField{Name: "grpc-message", Value: encodeGrpcMessage(st.Message())}) - if p := st.Proto(); p != nil && len(p.Details) > 0 { + if p := istatus.RawStatusProto(st); len(p.GetDetails()) > 0 { // Do not use the user's grpc-status-details-bin (if present) if we are // even attempting to set our own. delete(s.trailer, grpcStatusDetailsBinHeader) @@ -1131,17 +1147,13 @@ func (t *http2Server) writeStatus(s *ServerStream, st *status.Status) error { // Write converts the data into HTTP2 data frame and sends it out. Non-nil error // is returns if it fails (e.g., framing error, transport error). func (t *http2Server) write(s *ServerStream, hdr []byte, data mem.BufferSlice, _ *WriteOptions) error { - reader := data.Reader() - if !s.isHeaderSent() { // Headers haven't been written yet. if err := t.writeHeader(s, nil); err != nil { - _ = reader.Close() return err } } else { // Writing headers checks for this condition. if s.getState() == streamDone { - _ = reader.Close() return t.streamContextErr(s) } } @@ -1149,15 +1161,16 @@ func (t *http2Server) write(s *ServerStream, hdr []byte, data mem.BufferSlice, _ df := &dataFrame{ streamID: s.id, h: hdr, - reader: reader, + data: data, onEachWrite: t.setResetPingStrikes, } - if err := s.wq.get(int32(len(hdr) + df.reader.Remaining())); err != nil { - _ = reader.Close() + dataLen := data.Len() + if err := s.wq.get(int32(len(hdr) + dataLen)); err != nil { return t.streamContextErr(s) } + data.Ref() if err := t.controlBuf.put(df); err != nil { - _ = reader.Close() + data.Free() return err } t.incrMsgSent() @@ -1340,10 +1353,10 @@ func (t *http2Server) closeStream(s *ServerStream, rst bool, rstCode http2.ErrCo // called to interrupt the potential blocking on other goroutines. s.cancel() - oldState := s.swapState(streamDone) - if oldState == streamDone { - return - } + // We can't return early even if the stream's state is "done" as the state + // might have been set by the `finishStream` method. Deleting the stream via + // `finishStream` can get blocked on flow control. + s.swapState(streamDone) t.deleteStream(s, eosReceived) t.controlBuf.put(&cleanupStream{ diff --git a/vendor/google.golang.org/grpc/internal/transport/http_util.go b/vendor/google.golang.org/grpc/internal/transport/http_util.go index f997f9fdb..e3663f87f 100644 --- a/vendor/google.golang.org/grpc/internal/transport/http_util.go +++ b/vendor/google.golang.org/grpc/internal/transport/http_util.go @@ -196,11 +196,11 @@ func decodeTimeout(s string) (time.Duration, error) { if !ok { return 0, fmt.Errorf("transport: timeout unit is not recognized: %q", s) } - t, err := strconv.ParseInt(s[:size-1], 10, 64) + t, err := strconv.ParseUint(s[:size-1], 10, 64) if err != nil { return 0, err } - const maxHours = math.MaxInt64 / int64(time.Hour) + const maxHours = math.MaxInt64 / uint64(time.Hour) if d == time.Hour && t > maxHours { // This timeout would overflow math.MaxInt64; clamp it. return time.Duration(math.MaxInt64), nil diff --git a/vendor/google.golang.org/grpc/internal/transport/transport.go b/vendor/google.golang.org/grpc/internal/transport/transport.go index af4a4aeab..7dd53e80a 100644 --- a/vendor/google.golang.org/grpc/internal/transport/transport.go +++ b/vendor/google.golang.org/grpc/internal/transport/transport.go @@ -466,6 +466,7 @@ type ServerConfig struct { MaxHeaderListSize *uint32 HeaderTableSize *uint32 BufferPool mem.BufferPool + StaticWindowSize bool } // ConnectOptions covers all relevant options for communicating with the server. @@ -504,6 +505,8 @@ type ConnectOptions struct { MaxHeaderListSize *uint32 // The mem.BufferPool to use when reading/writing to the wire. BufferPool mem.BufferPool + // StaticWindowSize controls whether dynamic window sizing is enabled. + StaticWindowSize bool } // WriteOptions provides additional hints and information for message @@ -540,6 +543,11 @@ type CallHdr struct { PreviousAttempts int // value of grpc-previous-rpc-attempts header to set DoneFunc func() // called when the stream is finished + + // Authority is used to explicitly override the `:authority` header. If set, + // this value takes precedence over the Host field and will be used as the + // value for the `:authority` header. + Authority string } // ClientTransport is the common interface for all gRPC client-side transport diff --git a/vendor/google.golang.org/grpc/internal/xds/clients/config.go b/vendor/google.golang.org/grpc/internal/xds/clients/config.go new file mode 100644 index 000000000..f106465f6 --- /dev/null +++ b/vendor/google.golang.org/grpc/internal/xds/clients/config.go @@ -0,0 +1,112 @@ +/* + * + * Copyright 2024 gRPC authors. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + * + */ + +// Package clients provides implementations of the clients to interact with +// xDS and LRS servers. +// +// # xDS Client +// +// The xDS client allows applications to: +// - Create client instances with in-memory configurations. +// - Register watches for named resources. +// - Receive resources via the ADS (Aggregated Discovery Service) stream. +// +// This enables applications to dynamically discover and configure resources +// such as listeners, routes, clusters, and endpoints from an xDS management +// server. +// +// # LRS Client +// +// The LRS (Load Reporting Service) client allows applications to report load +// data to an LRS server via the LRS stream. This data can be used for +// monitoring, traffic management, and other purposes. +// +// # Experimental +// +// NOTICE: This package is EXPERIMENTAL and may be changed or removed +// in a later release. +package clients + +// ServerIdentifier holds identifying information for connecting to an xDS +// management or LRS server. +type ServerIdentifier struct { + // ServerURI is the target URI of the server. + ServerURI string + + // Extensions can be populated with arbitrary data to be passed to the + // TransportBuilder and/or xDS Client's ResourceType implementations. + // This field can be used to provide additional configuration or context + // specific to the user's needs. + // + // The xDS and LRS clients do not interpret the contents of this field. + // It is the responsibility of the user's custom TransportBuilder and/or + // ResourceType implementations to handle and interpret these extensions. + // + // For example, a custom TransportBuilder might use this field to + // configure a specific security credentials. + // + // Extensions may be any type that is comparable, as they are used as map + // keys internally. If Extensions are not able to be used as a map key, + // the client may panic. + // + // See: https://go.dev/ref/spec#Comparison_operators + // + // Any equivalent extensions in all ServerIdentifiers present in a single + // client's configuration should have the same value. Not following this + // restriction may result in excess resource usage. + Extensions any +} + +// Node represents the identity of the xDS client, allowing xDS and LRS servers +// to identify the source of xDS requests. +type Node struct { + // ID is a string identifier of the application. + ID string + // Cluster is the name of the cluster the application belongs to. + Cluster string + // Locality is the location of the application including region, zone, + // sub-zone. + Locality Locality + // Metadata provides additional context about the application by associating + // arbitrary key-value pairs with it. + Metadata any + // UserAgentName is the user agent name of application. + UserAgentName string + // UserAgentVersion is the user agent version of application. + UserAgentVersion string +} + +// Locality represents the location of the xDS client application. +type Locality struct { + // Region is the region of the xDS client application. + Region string + // Zone is the area within a region. + Zone string + // SubZone is the further subdivision within a zone. + SubZone string +} + +// MetricsReporter is used by the XDSClient to report metrics. +type MetricsReporter interface { + // ReportMetric reports a metric. The metric will be one of the predefined + // set of types depending on the client (XDSClient or LRSClient). + // + // Each client will produce different metrics. Please see the client's + // documentation for a list of possible metrics events. + ReportMetric(metric any) +} diff --git a/vendor/google.golang.org/grpc/internal/xds/clients/transport_builder.go b/vendor/google.golang.org/grpc/internal/xds/clients/transport_builder.go new file mode 100644 index 000000000..f940675d9 --- /dev/null +++ b/vendor/google.golang.org/grpc/internal/xds/clients/transport_builder.go @@ -0,0 +1,53 @@ +/* + * + * Copyright 2024 gRPC authors. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + * + */ + +package clients + +import ( + "context" +) + +// TransportBuilder provides the functionality to create a communication +// channel to an xDS or LRS server. +type TransportBuilder interface { + // Build creates a new Transport instance to the server based on the + // provided ServerIdentifier. + Build(serverIdentifier ServerIdentifier) (Transport, error) +} + +// Transport provides the functionality to communicate with an xDS or LRS +// server using streaming calls. +type Transport interface { + // NewStream creates a new streaming call to the server for the specific + // RPC method name. The returned Stream interface can be used to send and + // receive messages on the stream. + NewStream(context.Context, string) (Stream, error) + + // Close closes the Transport. + Close() +} + +// Stream provides methods to send and receive messages on a stream. Messages +// are represented as a byte slice. +type Stream interface { + // Send sends the provided message on the stream. + Send([]byte) error + + // Recv blocks until the next message is received on the stream. + Recv() ([]byte, error) +} diff --git a/vendor/google.golang.org/grpc/internal/xds/xds.go b/vendor/google.golang.org/grpc/internal/xds/xds.go index 024c388b7..b9a4ec90a 100644 --- a/vendor/google.golang.org/grpc/internal/xds/xds.go +++ b/vendor/google.golang.org/grpc/internal/xds/xds.go @@ -14,12 +14,17 @@ * limitations under the License. */ -// Package xds contains methods to Get/Set handshake cluster names. It is separated -// out from the top level /internal package to avoid circular dependencies. +// Package xds contains functions, structs, and utilities for working with +// handshake cluster names, as well as shared components used by xds balancers +// and resolvers. It is separated from the top-level /internal package to +// avoid circular dependencies. package xds import ( + "fmt" + "google.golang.org/grpc/attributes" + "google.golang.org/grpc/internal/xds/clients" "google.golang.org/grpc/resolver" ) @@ -40,3 +45,60 @@ func GetXDSHandshakeClusterName(attr *attributes.Attributes) (string, bool) { name, ok := v.(string) return name, ok } + +// LocalityString generates a string representation of clients.Locality in the +// format specified in gRFC A76. +func LocalityString(l clients.Locality) string { + return fmt.Sprintf("{region=%q, zone=%q, sub_zone=%q}", l.Region, l.Zone, l.SubZone) +} + +// IsLocalityEqual allows the values to be compared by Attributes.Equal. +func IsLocalityEqual(l clients.Locality, o any) bool { + ol, ok := o.(clients.Locality) + if !ok { + return false + } + return l.Region == ol.Region && l.Zone == ol.Zone && l.SubZone == ol.SubZone +} + +// LocalityFromString converts a string representation of clients.locality as +// specified in gRFC A76, into a LocalityID struct. +func LocalityFromString(s string) (ret clients.Locality, _ error) { + _, err := fmt.Sscanf(s, "{region=%q, zone=%q, sub_zone=%q}", &ret.Region, &ret.Zone, &ret.SubZone) + if err != nil { + return clients.Locality{}, fmt.Errorf("%s is not a well formatted locality ID, error: %v", s, err) + } + return ret, nil +} + +type localityKeyType string + +const localityKey = localityKeyType("grpc.xds.internal.address.locality") + +// GetLocalityID returns the locality ID of addr. +func GetLocalityID(addr resolver.Address) clients.Locality { + path, _ := addr.BalancerAttributes.Value(localityKey).(clients.Locality) + return path +} + +// SetLocalityID sets locality ID in addr to l. +func SetLocalityID(addr resolver.Address, l clients.Locality) resolver.Address { + addr.BalancerAttributes = addr.BalancerAttributes.WithValue(localityKey, l) + return addr +} + +// SetLocalityIDInEndpoint sets locality ID in endpoint to l. +func SetLocalityIDInEndpoint(endpoint resolver.Endpoint, l clients.Locality) resolver.Endpoint { + endpoint.Attributes = endpoint.Attributes.WithValue(localityKey, l) + return endpoint +} + +// ResourceTypeMapForTesting maps TypeUrl to corresponding ResourceType. +var ResourceTypeMapForTesting map[string]any + +// UnknownCSMLabels are TelemetryLabels emitted from CDS if CSM Telemetry Label +// data is not present in the CDS Resource. +var UnknownCSMLabels = map[string]string{ + "csm.service_name": "unknown", + "csm.service_namespace_name": "unknown", +} diff --git a/vendor/google.golang.org/grpc/mem/buffer_slice.go b/vendor/google.golang.org/grpc/mem/buffer_slice.go index 65002e2cc..af510d20c 100644 --- a/vendor/google.golang.org/grpc/mem/buffer_slice.go +++ b/vendor/google.golang.org/grpc/mem/buffer_slice.go @@ -137,6 +137,9 @@ type Reader interface { Close() error // Remaining returns the number of unread bytes remaining in the slice. Remaining() int + // Reset frees the currently held buffer slice and starts reading from the + // provided slice. This allows reusing the reader object. + Reset(s BufferSlice) } type sliceReader struct { @@ -150,6 +153,14 @@ func (r *sliceReader) Remaining() int { return r.len } +func (r *sliceReader) Reset(s BufferSlice) { + r.data.Free() + s.Ref() + r.data = s + r.len = s.Len() + r.bufferIdx = 0 +} + func (r *sliceReader) Close() error { r.data.Free() r.data = nil diff --git a/vendor/google.golang.org/grpc/picker_wrapper.go b/vendor/google.golang.org/grpc/picker_wrapper.go index a2d2a798d..aa52bfe95 100644 --- a/vendor/google.golang.org/grpc/picker_wrapper.go +++ b/vendor/google.golang.org/grpc/picker_wrapper.go @@ -29,7 +29,6 @@ import ( "google.golang.org/grpc/internal/channelz" istatus "google.golang.org/grpc/internal/status" "google.golang.org/grpc/internal/transport" - "google.golang.org/grpc/stats" "google.golang.org/grpc/status" ) @@ -48,14 +47,11 @@ type pickerGeneration struct { // actions and unblock when there's a picker update. type pickerWrapper struct { // If pickerGen holds a nil pointer, the pickerWrapper is closed. - pickerGen atomic.Pointer[pickerGeneration] - statsHandlers []stats.Handler // to record blocking picker calls + pickerGen atomic.Pointer[pickerGeneration] } -func newPickerWrapper(statsHandlers []stats.Handler) *pickerWrapper { - pw := &pickerWrapper{ - statsHandlers: statsHandlers, - } +func newPickerWrapper() *pickerWrapper { + pw := &pickerWrapper{} pw.pickerGen.Store(&pickerGeneration{ blockingCh: make(chan struct{}), }) @@ -93,6 +89,12 @@ func doneChannelzWrapper(acbw *acBalancerWrapper, result *balancer.PickResult) { } } +type pick struct { + transport transport.ClientTransport // the selected transport + result balancer.PickResult // the contents of the pick from the LB policy + blocked bool // set if a picker call queued for a new picker +} + // pick returns the transport that will be used for the RPC. // It may block in the following cases: // - there's no picker @@ -100,15 +102,16 @@ func doneChannelzWrapper(acbw *acBalancerWrapper, result *balancer.PickResult) { // - the current picker returns other errors and failfast is false. // - the subConn returned by the current picker is not READY // When one of these situations happens, pick blocks until the picker gets updated. -func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.PickInfo) (transport.ClientTransport, balancer.PickResult, error) { +func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer.PickInfo) (pick, error) { var ch chan struct{} var lastPickErr error + pickBlocked := false for { pg := pw.pickerGen.Load() if pg == nil { - return nil, balancer.PickResult{}, ErrClientConnClosing + return pick{}, ErrClientConnClosing } if pg.picker == nil { ch = pg.blockingCh @@ -127,9 +130,9 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer. } switch ctx.Err() { case context.DeadlineExceeded: - return nil, balancer.PickResult{}, status.Error(codes.DeadlineExceeded, errStr) + return pick{}, status.Error(codes.DeadlineExceeded, errStr) case context.Canceled: - return nil, balancer.PickResult{}, status.Error(codes.Canceled, errStr) + return pick{}, status.Error(codes.Canceled, errStr) } case <-ch: } @@ -145,9 +148,7 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer. // In the second case, the only way it will get to this conditional is // if there is a new picker. if ch != nil { - for _, sh := range pw.statsHandlers { - sh.HandleRPC(ctx, &stats.PickerUpdated{}) - } + pickBlocked = true } ch = pg.blockingCh @@ -164,7 +165,7 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer. if istatus.IsRestrictedControlPlaneCode(st) { err = status.Errorf(codes.Internal, "received picker error with illegal status: %v", err) } - return nil, balancer.PickResult{}, dropError{error: err} + return pick{}, dropError{error: err} } // For all other errors, wait for ready RPCs should block and other // RPCs should fail with unavailable. @@ -172,7 +173,7 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer. lastPickErr = err continue } - return nil, balancer.PickResult{}, status.Error(codes.Unavailable, err.Error()) + return pick{}, status.Error(codes.Unavailable, err.Error()) } acbw, ok := pickResult.SubConn.(*acBalancerWrapper) @@ -183,9 +184,8 @@ func (pw *pickerWrapper) pick(ctx context.Context, failfast bool, info balancer. if t := acbw.ac.getReadyTransport(); t != nil { if channelz.IsOn() { doneChannelzWrapper(acbw, &pickResult) - return t, pickResult, nil } - return t, pickResult, nil + return pick{transport: t, result: pickResult, blocked: pickBlocked}, nil } if pickResult.Done != nil { // Calling done with nil error, no bytes sent and no bytes received. diff --git a/vendor/google.golang.org/grpc/resolver/resolver.go b/vendor/google.golang.org/grpc/resolver/resolver.go index b84ef26d4..8e6af9514 100644 --- a/vendor/google.golang.org/grpc/resolver/resolver.go +++ b/vendor/google.golang.org/grpc/resolver/resolver.go @@ -332,6 +332,11 @@ type AuthorityOverrider interface { // OverrideAuthority returns the authority to use for a ClientConn with the // given target. The implementation must generate it without blocking, // typically in line, and must keep it unchanged. + // + // The returned string must be a valid ":authority" header value, i.e. be + // encoded according to + // [RFC3986](https://datatracker.ietf.org/doc/html/rfc3986#section-3.2) as + // necessary. OverrideAuthority(Target) string } diff --git a/vendor/google.golang.org/grpc/rpc_util.go b/vendor/google.golang.org/grpc/rpc_util.go index ad20e9dff..47ea09f5c 100644 --- a/vendor/google.golang.org/grpc/rpc_util.go +++ b/vendor/google.golang.org/grpc/rpc_util.go @@ -160,6 +160,7 @@ type callInfo struct { codec baseCodec maxRetryRPCBufferSize int onFinish []func(err error) + authority string } func defaultCallInfo() *callInfo { @@ -365,6 +366,36 @@ func (o MaxRecvMsgSizeCallOption) before(c *callInfo) error { } func (o MaxRecvMsgSizeCallOption) after(*callInfo, *csAttempt) {} +// CallAuthority returns a CallOption that sets the HTTP/2 :authority header of +// an RPC to the specified value. When using CallAuthority, the credentials in +// use must implement the AuthorityValidator interface. +// +// # Experimental +// +// Notice: This API is EXPERIMENTAL and may be changed or removed in a later +// release. +func CallAuthority(authority string) CallOption { + return AuthorityOverrideCallOption{Authority: authority} +} + +// AuthorityOverrideCallOption is a CallOption that indicates the HTTP/2 +// :authority header value to use for the call. +// +// # Experimental +// +// Notice: This type is EXPERIMENTAL and may be changed or removed in a later +// release. +type AuthorityOverrideCallOption struct { + Authority string +} + +func (o AuthorityOverrideCallOption) before(c *callInfo) error { + c.authority = o.Authority + return nil +} + +func (o AuthorityOverrideCallOption) after(*callInfo, *csAttempt) {} + // MaxCallSendMsgSize returns a CallOption which sets the maximum message size // in bytes the client can send. If this is not set, gRPC uses the default // `math.MaxInt32`. diff --git a/vendor/google.golang.org/grpc/server.go b/vendor/google.golang.org/grpc/server.go index 976e70ae0..1da2a542a 100644 --- a/vendor/google.golang.org/grpc/server.go +++ b/vendor/google.golang.org/grpc/server.go @@ -179,6 +179,7 @@ type serverOptions struct { numServerWorkers uint32 bufferPool mem.BufferPool waitForHandlers bool + staticWindowSize bool } var defaultServerOptions = serverOptions{ @@ -279,6 +280,7 @@ func ReadBufferSize(s int) ServerOption { func InitialWindowSize(s int32) ServerOption { return newFuncServerOption(func(o *serverOptions) { o.initialWindowSize = s + o.staticWindowSize = true }) } @@ -287,6 +289,29 @@ func InitialWindowSize(s int32) ServerOption { func InitialConnWindowSize(s int32) ServerOption { return newFuncServerOption(func(o *serverOptions) { o.initialConnWindowSize = s + o.staticWindowSize = true + }) +} + +// StaticStreamWindowSize returns a ServerOption to set the initial stream +// window size to the value provided and disables dynamic flow control. +// The lower bound for window size is 64K and any value smaller than that +// will be ignored. +func StaticStreamWindowSize(s int32) ServerOption { + return newFuncServerOption(func(o *serverOptions) { + o.initialWindowSize = s + o.staticWindowSize = true + }) +} + +// StaticConnWindowSize returns a ServerOption to set the initial connection +// window size to the value provided and disables dynamic flow control. +// The lower bound for window size is 64K and any value smaller than that +// will be ignored. +func StaticConnWindowSize(s int32) ServerOption { + return newFuncServerOption(func(o *serverOptions) { + o.initialConnWindowSize = s + o.staticWindowSize = true }) } @@ -986,6 +1011,7 @@ func (s *Server) newHTTP2Transport(c net.Conn) transport.ServerTransport { MaxHeaderListSize: s.opts.maxHeaderListSize, HeaderTableSize: s.opts.headerTableSize, BufferPool: s.opts.bufferPool, + StaticWindowSize: s.opts.staticWindowSize, } st, err := transport.NewServerTransport(c, config) if err != nil { @@ -1572,6 +1598,7 @@ func (s *Server) processStreamingRPC(ctx context.Context, stream *transport.Serv s: stream, p: &parser{r: stream, bufferPool: s.opts.bufferPool}, codec: s.getCodec(stream.ContentSubtype()), + desc: sd, maxReceiveMessageSize: s.opts.maxReceiveMessageSize, maxSendMessageSize: s.opts.maxSendMessageSize, trInfo: trInfo, diff --git a/vendor/google.golang.org/grpc/stats/handlers.go b/vendor/google.golang.org/grpc/stats/handlers.go index dc03731e4..67194a592 100644 --- a/vendor/google.golang.org/grpc/stats/handlers.go +++ b/vendor/google.golang.org/grpc/stats/handlers.go @@ -38,6 +38,15 @@ type RPCTagInfo struct { // FailFast indicates if this RPC is failfast. // This field is only valid on client side, it's always false on server side. FailFast bool + // NameResolutionDelay indicates if the RPC needed to wait for the + // initial name resolver update before it could begin. This should only + // happen if the channel is IDLE when the RPC is started. Note that + // all retry or hedging attempts for an RPC that experienced a delay + // will have it set. + // + // This field is only valid on the client side; it is always false on + // the server side. + NameResolutionDelay bool } // Handler defines the interface for the related stats handling (e.g., RPCs, connections). diff --git a/vendor/google.golang.org/grpc/stats/stats.go b/vendor/google.golang.org/grpc/stats/stats.go index baf7740ef..10bf998aa 100644 --- a/vendor/google.golang.org/grpc/stats/stats.go +++ b/vendor/google.golang.org/grpc/stats/stats.go @@ -64,15 +64,21 @@ func (s *Begin) IsClient() bool { return s.Client } func (s *Begin) isRPCStats() {} -// PickerUpdated indicates that the LB policy provided a new picker while the -// RPC was waiting for one. -type PickerUpdated struct{} +// DelayedPickComplete indicates that the RPC is unblocked following a delay in +// selecting a connection for the call. +type DelayedPickComplete struct{} -// IsClient indicates if the stats information is from client side. Only Client -// Side interfaces with a Picker, thus always returns true. -func (*PickerUpdated) IsClient() bool { return true } +// IsClient indicates DelayedPickComplete is available on the client. +func (*DelayedPickComplete) IsClient() bool { return true } -func (*PickerUpdated) isRPCStats() {} +func (*DelayedPickComplete) isRPCStats() {} + +// PickerUpdated indicates that the RPC is unblocked following a delay in +// selecting a connection for the call. +// +// Deprecated: will be removed in a future release; use DelayedPickComplete +// instead. +type PickerUpdated = DelayedPickComplete // InPayload contains stats about an incoming payload. type InPayload struct { diff --git a/vendor/google.golang.org/grpc/stream.go b/vendor/google.golang.org/grpc/stream.go index 12163150b..0a0af8961 100644 --- a/vendor/google.golang.org/grpc/stream.go +++ b/vendor/google.golang.org/grpc/stream.go @@ -101,9 +101,9 @@ type ClientStream interface { // It must only be called after stream.CloseAndRecv has returned, or // stream.Recv has returned a non-nil error (including io.EOF). Trailer() metadata.MD - // CloseSend closes the send direction of the stream. It closes the stream - // when non-nil error is met. It is also not safe to call CloseSend - // concurrently with SendMsg. + // CloseSend closes the send direction of the stream. This method always + // returns a nil error. The status of the stream may be discovered using + // RecvMsg. It is also not safe to call CloseSend concurrently with SendMsg. CloseSend() error // Context returns the context for this stream. // @@ -212,14 +212,15 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth } // Provide an opportunity for the first RPC to see the first service config // provided by the resolver. - if err := cc.waitForResolvedAddrs(ctx); err != nil { + nameResolutionDelayed, err := cc.waitForResolvedAddrs(ctx) + if err != nil { return nil, err } var mc serviceconfig.MethodConfig var onCommit func() newStream := func(ctx context.Context, done func()) (iresolver.ClientStream, error) { - return newClientStreamWithParams(ctx, desc, cc, method, mc, onCommit, done, opts...) + return newClientStreamWithParams(ctx, desc, cc, method, mc, onCommit, done, nameResolutionDelayed, opts...) } rpcInfo := iresolver.RPCInfo{Context: ctx, Method: method} @@ -257,7 +258,7 @@ func newClientStream(ctx context.Context, desc *StreamDesc, cc *ClientConn, meth return newStream(ctx, func() {}) } -func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *ClientConn, method string, mc serviceconfig.MethodConfig, onCommit, doneFunc func(), opts ...CallOption) (_ iresolver.ClientStream, err error) { +func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *ClientConn, method string, mc serviceconfig.MethodConfig, onCommit, doneFunc func(), nameResolutionDelayed bool, opts ...CallOption) (_ iresolver.ClientStream, err error) { callInfo := defaultCallInfo() if mc.WaitForReady != nil { callInfo.failFast = !*mc.WaitForReady @@ -296,6 +297,7 @@ func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *Client Method: method, ContentSubtype: callInfo.contentSubtype, DoneFunc: doneFunc, + Authority: callInfo.authority, } // Set our outgoing compression according to the UseCompressor CallOption, if @@ -321,19 +323,20 @@ func newClientStreamWithParams(ctx context.Context, desc *StreamDesc, cc *Client } cs := &clientStream{ - callHdr: callHdr, - ctx: ctx, - methodConfig: &mc, - opts: opts, - callInfo: callInfo, - cc: cc, - desc: desc, - codec: callInfo.codec, - compressorV0: compressorV0, - compressorV1: compressorV1, - cancel: cancel, - firstAttempt: true, - onCommit: onCommit, + callHdr: callHdr, + ctx: ctx, + methodConfig: &mc, + opts: opts, + callInfo: callInfo, + cc: cc, + desc: desc, + codec: callInfo.codec, + compressorV0: compressorV0, + compressorV1: compressorV1, + cancel: cancel, + firstAttempt: true, + onCommit: onCommit, + nameResolutionDelay: nameResolutionDelayed, } if !cc.dopts.disableRetry { cs.retryThrottler = cc.retryThrottler.Load().(*retryThrottler) @@ -417,7 +420,7 @@ func (cs *clientStream) newAttemptLocked(isTransparent bool) (*csAttempt, error) var beginTime time.Time shs := cs.cc.dopts.copts.StatsHandlers for _, sh := range shs { - ctx = sh.TagRPC(ctx, &stats.RPCTagInfo{FullMethodName: method, FailFast: cs.callInfo.failFast}) + ctx = sh.TagRPC(ctx, &stats.RPCTagInfo{FullMethodName: method, FailFast: cs.callInfo.failFast, NameResolutionDelay: cs.nameResolutionDelay}) beginTime = time.Now() begin := &stats.Begin{ Client: true, @@ -466,8 +469,9 @@ func (cs *clientStream) newAttemptLocked(isTransparent bool) (*csAttempt, error) func (a *csAttempt) getTransport() error { cs := a.cs - var err error - a.transport, a.pickResult, err = cs.cc.getTransport(a.ctx, cs.callInfo.failFast, cs.callHdr.Method) + pickInfo := balancer.PickInfo{Ctx: a.ctx, FullMethodName: cs.callHdr.Method} + pick, err := cs.cc.pickerWrapper.pick(a.ctx, cs.callInfo.failFast, pickInfo) + a.transport, a.pickResult = pick.transport, pick.result if err != nil { if de, ok := err.(dropError); ok { err = de.error @@ -478,6 +482,11 @@ func (a *csAttempt) getTransport() error { if a.trInfo != nil { a.trInfo.firstLine.SetRemoteAddr(a.transport.RemoteAddr()) } + if pick.blocked { + for _, sh := range a.statsHandlers { + sh.HandleRPC(a.ctx, &stats.DelayedPickComplete{}) + } + } return nil } @@ -540,6 +549,8 @@ type clientStream struct { sentLast bool // sent an end stream + receivedFirstMsg bool // set after the first message is received + methodConfig *MethodConfig ctx context.Context // the application's context, wrapped by stats/tracing @@ -573,6 +584,9 @@ type clientStream struct { onCommit func() replayBuffer []replayOp // operations to replay on retry replayBufferSize int // current size of replayBuffer + // nameResolutionDelay indicates if there was a delay in the name resolution. + // This field is only valid on client side, it's always false on server side. + nameResolutionDelay bool } type replayOp struct { @@ -987,7 +1001,7 @@ func (cs *clientStream) RecvMsg(m any) error { func (cs *clientStream) CloseSend() error { if cs.sentLast { - // TODO: return an error and finish the stream instead, due to API misuse? + // Return a nil error on repeated calls to this method. return nil } cs.sentLast = true @@ -1008,7 +1022,10 @@ func (cs *clientStream) CloseSend() error { binlog.Log(cs.ctx, chc) } } - // We never returned an error here for reasons. + // We don't return an error here as we expect users to read all messages + // from the stream and get the RPC status from RecvMsg(). Note that + // SendMsg() must return an error when one occurs so the application + // knows to stop sending messages, but that does not apply here. return nil } @@ -1129,11 +1146,16 @@ func (a *csAttempt) recvMsg(m any, payInfo *payloadInfo) (err error) { if statusErr := a.transportStream.Status().Err(); statusErr != nil { return statusErr } + // Received no msg and status OK for non-server streaming rpcs. + if !cs.desc.ServerStreams && !cs.receivedFirstMsg { + return status.Error(codes.Internal, "cardinality violation: received no response message from non-server-streaming RPC") + } return io.EOF // indicates successful end of stream. } return toRPCErr(err) } + cs.receivedFirstMsg = true if a.trInfo != nil { a.mu.Lock() if a.trInfo.tr != nil { @@ -1162,7 +1184,7 @@ func (a *csAttempt) recvMsg(m any, payInfo *payloadInfo) (err error) { } else if err != nil { return toRPCErr(err) } - return toRPCErr(errors.New("grpc: client streaming protocol violation: get , want ")) + return status.Error(codes.Internal, "cardinality violation: expected for non server-streaming RPCs, but received another message") } func (a *csAttempt) finish(err error) { @@ -1344,6 +1366,7 @@ type addrConnStream struct { transport transport.ClientTransport ctx context.Context sentLast bool + receivedFirstMsg bool desc *StreamDesc codec baseCodec sendCompressorV0 Compressor @@ -1372,7 +1395,7 @@ func (as *addrConnStream) Trailer() metadata.MD { func (as *addrConnStream) CloseSend() error { if as.sentLast { - // TODO: return an error and finish the stream instead, due to API misuse? + // Return a nil error on repeated calls to this method. return nil } as.sentLast = true @@ -1469,10 +1492,15 @@ func (as *addrConnStream) RecvMsg(m any) (err error) { if statusErr := as.transportStream.Status().Err(); statusErr != nil { return statusErr } + // Received no msg and status OK for non-server streaming rpcs. + if !as.desc.ServerStreams && !as.receivedFirstMsg { + return status.Error(codes.Internal, "cardinality violation: received no response message from non-server-streaming RPC") + } return io.EOF // indicates successful end of stream. } return toRPCErr(err) } + as.receivedFirstMsg = true if as.desc.ServerStreams { // Subsequent messages should be received by subsequent RecvMsg calls. @@ -1486,7 +1514,7 @@ func (as *addrConnStream) RecvMsg(m any) (err error) { } else if err != nil { return toRPCErr(err) } - return toRPCErr(errors.New("grpc: client streaming protocol violation: get , want ")) + return status.Error(codes.Internal, "cardinality violation: expected for non server-streaming RPCs, but received another message") } func (as *addrConnStream) finish(err error) { @@ -1571,6 +1599,7 @@ type serverStream struct { s *transport.ServerStream p *parser codec baseCodec + desc *StreamDesc compressorV0 Compressor compressorV1 encoding.Compressor @@ -1579,6 +1608,8 @@ type serverStream struct { sendCompressorName string + recvFirstMsg bool // set after the first message is received + maxReceiveMessageSize int maxSendMessageSize int trInfo *traceInfo @@ -1765,6 +1796,10 @@ func (ss *serverStream) RecvMsg(m any) (err error) { binlog.Log(ss.ctx, chc) } } + // Received no request msg for non-client streaming rpcs. + if !ss.desc.ClientStreams && !ss.recvFirstMsg { + return status.Error(codes.Internal, "cardinality violation: received no request message from non-client-streaming RPC") + } return err } if err == io.ErrUnexpectedEOF { @@ -1772,6 +1807,7 @@ func (ss *serverStream) RecvMsg(m any) (err error) { } return toRPCErr(err) } + ss.recvFirstMsg = true if len(ss.statsHandler) != 0 { for _, sh := range ss.statsHandler { sh.HandleRPC(ss.s.Context(), &stats.InPayload{ @@ -1791,7 +1827,19 @@ func (ss *serverStream) RecvMsg(m any) (err error) { binlog.Log(ss.ctx, cm) } } - return nil + + if ss.desc.ClientStreams { + // Subsequent messages should be received by subsequent RecvMsg calls. + return nil + } + // Special handling for non-client-stream rpcs. + // This recv expects EOF or errors, so we don't collect inPayload. + if err := recv(ss.p, ss.codec, ss.s, ss.decompressorV0, m, ss.maxReceiveMessageSize, nil, ss.decompressorV1, true); err == io.EOF { + return nil + } else if err != nil { + return err + } + return status.Error(codes.Internal, "cardinality violation: received multiple request messages for non-client-streaming RPC") } // MethodFromServerStream returns the method string for the input stream. diff --git a/vendor/google.golang.org/grpc/version.go b/vendor/google.golang.org/grpc/version.go index 51da8ed59..76f2e0d06 100644 --- a/vendor/google.golang.org/grpc/version.go +++ b/vendor/google.golang.org/grpc/version.go @@ -19,4 +19,4 @@ package grpc // Version is the current grpc version. -const Version = "1.72.1" +const Version = "1.76.0" diff --git a/vendor/modules.txt b/vendor/modules.txt index 70faecbd5..3e93dc5c5 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -122,7 +122,7 @@ github.com/AzureAD/microsoft-authentication-library-for-go/apps/public # github.com/MakeNowJust/heredoc v1.0.0 ## explicit; go 1.12 github.com/MakeNowJust/heredoc -# github.com/Masterminds/semver/v3 v3.3.1 +# github.com/Masterminds/semver/v3 v3.4.0 ## explicit; go 1.21 github.com/Masterminds/semver/v3 # github.com/aws/aws-sdk-go v1.55.5 @@ -228,8 +228,8 @@ github.com/ghodss/yaml # github.com/go-errors/errors v1.4.2 ## explicit; go 1.14 github.com/go-errors/errors -# github.com/go-jose/go-jose/v4 v4.0.5 -## explicit; go 1.21 +# github.com/go-jose/go-jose/v4 v4.1.2 +## explicit; go 1.23.0 github.com/go-jose/go-jose/v4 github.com/go-jose/go-jose/v4/cipher github.com/go-jose/go-jose/v4/json @@ -420,8 +420,8 @@ github.com/jmespath/go-jmespath # github.com/json-iterator/go v1.1.12 ## explicit; go 1.12 github.com/json-iterator/go -# github.com/klauspost/cpuid/v2 v2.0.9 -## explicit; go 1.13 +# github.com/klauspost/cpuid/v2 v2.2.5 +## explicit; go 1.15 github.com/klauspost/cpuid/v2 # github.com/kylelemons/godebug v1.1.0 ## explicit; go 1.11 @@ -536,7 +536,7 @@ github.com/russross/blackfriday/v2 # github.com/ryanuber/go-glob v1.0.0 ## explicit github.com/ryanuber/go-glob -# github.com/sergi/go-diff v1.2.0 +# github.com/sergi/go-diff v1.3.1 ## explicit; go 1.12 github.com/sergi/go-diff/diffmatchpatch # github.com/sirupsen/logrus v1.9.3 @@ -546,7 +546,7 @@ github.com/sirupsen/logrus ## explicit; go 1.15 github.com/spf13/cobra github.com/spf13/cobra/doc -# github.com/spf13/pflag v1.0.9 +# github.com/spf13/pflag v1.0.10 ## explicit; go 1.12 github.com/spf13/pflag # github.com/x448/float16 v0.8.4 @@ -588,8 +588,8 @@ go.opencensus.io/trace/tracestate ## explicit; go 1.22.0 go.opentelemetry.io/auto/sdk go.opentelemetry.io/auto/sdk/internal/telemetry -# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.60.0 -## explicit; go 1.22.0 +# go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc v0.61.0 +## explicit; go 1.23.0 go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc go.opentelemetry.io/contrib/instrumentation/google.golang.org/grpc/otelgrpc/internal # go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.61.0 @@ -598,7 +598,7 @@ go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/request go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconv go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconvutil -# go.opentelemetry.io/otel v1.36.0 +# go.opentelemetry.io/otel v1.37.0 ## explicit; go 1.23.0 go.opentelemetry.io/otel go.opentelemetry.io/otel/attribute @@ -608,15 +608,16 @@ go.opentelemetry.io/otel/codes go.opentelemetry.io/otel/internal/baggage go.opentelemetry.io/otel/internal/global go.opentelemetry.io/otel/propagation -go.opentelemetry.io/otel/semconv/v1.17.0 go.opentelemetry.io/otel/semconv/v1.20.0 go.opentelemetry.io/otel/semconv/v1.26.0 -# go.opentelemetry.io/otel/metric v1.36.0 +go.opentelemetry.io/otel/semconv/v1.30.0 +go.opentelemetry.io/otel/semconv/v1.34.0 +# go.opentelemetry.io/otel/metric v1.37.0 ## explicit; go 1.23.0 go.opentelemetry.io/otel/metric go.opentelemetry.io/otel/metric/embedded go.opentelemetry.io/otel/metric/noop -# go.opentelemetry.io/otel/trace v1.36.0 +# go.opentelemetry.io/otel/trace v1.37.0 ## explicit; go 1.23.0 go.opentelemetry.io/otel/trace go.opentelemetry.io/otel/trace/embedded @@ -705,7 +706,7 @@ golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi golang.org/x/text/unicode/norm -# golang.org/x/time v0.13.0 +# golang.org/x/time v0.14.0 ## explicit; go 1.24.0 golang.org/x/time/rate # golang.org/x/xerrors v0.0.0-20240716161551-93cc26a95ae9 @@ -767,17 +768,17 @@ google.golang.org/api/transport/http/internal/propagation google.golang.org/genproto/googleapis/cloud/location google.golang.org/genproto/googleapis/type/date google.golang.org/genproto/googleapis/type/expr -# google.golang.org/genproto/googleapis/api v0.0.0-20250303144028-a0af3efb3deb +# google.golang.org/genproto/googleapis/api v0.0.0-20250818200422-3122310a409c ## explicit; go 1.23.0 google.golang.org/genproto/googleapis/api google.golang.org/genproto/googleapis/api/annotations -# google.golang.org/genproto/googleapis/rpc v0.0.0-20250303144028-a0af3efb3deb -## explicit; go 1.23.0 +# google.golang.org/genproto/googleapis/rpc v0.0.0-20251029180050-ab9386a59fda +## explicit; go 1.24.0 google.golang.org/genproto/googleapis/rpc/code google.golang.org/genproto/googleapis/rpc/errdetails google.golang.org/genproto/googleapis/rpc/status -# google.golang.org/grpc v1.72.1 -## explicit; go 1.23 +# google.golang.org/grpc v1.76.0 +## explicit; go 1.24.0 google.golang.org/grpc google.golang.org/grpc/attributes google.golang.org/grpc/backoff @@ -841,6 +842,7 @@ google.golang.org/grpc/internal/syscall google.golang.org/grpc/internal/transport google.golang.org/grpc/internal/transport/networktype google.golang.org/grpc/internal/xds +google.golang.org/grpc/internal/xds/clients google.golang.org/grpc/keepalive google.golang.org/grpc/mem google.golang.org/grpc/metadata @@ -1430,8 +1432,8 @@ kmodules.xyz/monitoring-agent-api/api/v1 # kmodules.xyz/offshoot-api v0.34.0 ## explicit; go 1.24.0 kmodules.xyz/offshoot-api/api/v1 -# kubevault.dev/apimachinery v0.23.1-0.20251228040721-d7d9d09f278b -## explicit; go 1.24.0 +# kubevault.dev/apimachinery v0.24.0-rc.0 +## explicit; go 1.25.0 kubevault.dev/apimachinery/apis kubevault.dev/apimachinery/apis/catalog kubevault.dev/apimachinery/apis/catalog/v1alpha1