diff --git a/go.mod b/go.mod index 9f575f6a82..c97ff34e7c 100644 --- a/go.mod +++ b/go.mod @@ -21,7 +21,7 @@ require ( github.com/gogo/protobuf v1.2.0 // indirect github.com/golang/protobuf v1.3.1 // indirect github.com/google/btree v1.0.0 // indirect - github.com/google/go-cmp v0.2.0 + github.com/google/go-cmp v0.3.0 github.com/google/uuid v1.1.1 github.com/googleapis/gnostic v0.2.0 // indirect github.com/gregjones/httpcache v0.0.0-20190212212710-3befbb6ad0cc // indirect @@ -36,7 +36,6 @@ require ( github.com/mattn/go-isatty v0.0.10 // indirect github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b // indirect github.com/mitchellh/go-homedir v1.1.0 - github.com/modern-go/reflect2 v1.0.1 // indirect github.com/onsi/ginkgo v1.10.3 github.com/onsi/gomega v1.4.3 github.com/peterbourgon/diskv v2.0.1+incompatible // indirect @@ -57,10 +56,8 @@ require ( gopkg.in/go-playground/validator.v9 v9.25.0 gopkg.in/inf.v0 v0.9.1 // indirect gopkg.in/ini.v1 v1.41.0 - gopkg.in/yaml.v2 v2.2.2 // indirect k8s.io/api v0.0.0-20190222213804-5cb15d344471 - k8s.io/apimachinery v0.0.0-20190221213512-86fb29eff628 + k8s.io/apimachinery v0.15.7 k8s.io/client-go v10.0.0+incompatible k8s.io/klog v1.0.0 // indirect - sigs.k8s.io/yaml v1.1.0 // indirect ) diff --git a/go.sum b/go.sum index 51db7556a6..eb05501c8c 100644 --- a/go.sum +++ b/go.sum @@ -38,6 +38,9 @@ github.com/dimchansky/utfbom v1.1.0 h1:FcM3g+nofKgUteL8dm/UpdRXNC9KmADgTpLKsu0TR github.com/dimchansky/utfbom v1.1.0/go.mod h1:rO41eb7gLfo8SF1jd9F8HplJm1Fewwi4mQvIirEdv+8= github.com/dnaeon/go-vcr v1.0.1 h1:r8L/HqC0Hje5AXMu1ooW8oyQyOFv4GxqpL0nRP7SLLY= github.com/dnaeon/go-vcr v1.0.1/go.mod h1:aBB1+wY4s93YsC3HHjMBMrwTj2R9FHDzUr9KyGc8n1E= +github.com/docker/spdystream v0.0.0-20160310174837-449fdfce4d96/go.mod h1:Qh8CwZgvJUkLughtfhJv5dyTYa91l1fOUCrgjqmcifM= +github.com/elazarl/goproxy v0.0.0-20170405201442-c4fc26588b6e/go.mod h1:/Zj4wYkgs4iZTTu3o/KG3Itv/qCCa8VVMlb3i9OVuzc= +github.com/evanphx/json-patch v0.0.0-20190203023257-5858425f7550/go.mod h1:50XU6AFN0ol/bzJsmQLiYLvXMP4fmwYFNcr97nuDLSk= github.com/fatih/structs v1.1.0 h1:Q7juDM0QtcnhCpeyLGQKyg4TOIghuNXrkL32pHAUMxo= github.com/fatih/structs v1.1.0/go.mod h1:9NiDSp5zOcgEDl+j00MP/WkGVPOlPRLejGD8Ga6PJ7M= github.com/fsnotify/fsnotify v1.4.7 h1:IXs+QLmnXW2CcXuY+8Mzv/fWEsPGWxqefPtCP5CnV9I= @@ -49,25 +52,31 @@ github.com/go-playground/locales v0.12.1 h1:2FITxuFt/xuCNP1Acdhv62OzaCiviiE4kotf github.com/go-playground/locales v0.12.1/go.mod h1:IUMDtCfWo/w/mtMfIE/IG2K+Ey3ygWanZIBtBW0W2TM= github.com/go-playground/universal-translator v0.16.0 h1:X++omBR/4cE2MNg91AoC3rmGrCjJ8eAeUP/K/EKx4DM= github.com/go-playground/universal-translator v0.16.0/go.mod h1:1AnU7NaIRDWWzGEKwgtJRd2xk99HeFyHw3yid4rvQIY= +github.com/gogo/protobuf v0.0.0-20171007142547-342cbe0a0415/go.mod h1:r8qH/GZQm5c6nD/R0oafs1akxWv10x8SbQlK7atdtwQ= github.com/gogo/protobuf v1.2.0 h1:xU6/SpYbvkNYiptHJYEDRseDLvYE7wSqhYYNy0QSUzI= github.com/gogo/protobuf v1.2.0/go.mod h1:r8qH/GZQm5c6nD/R0oafs1akxWv10x8SbQlK7atdtwQ= +github.com/golang/groupcache v0.0.0-20160516000752-02826c3e7903/go.mod h1:cIg4eruTrX1D+g88fzRXU5OdNfaM+9IcxsU14FzY7Hc= github.com/golang/protobuf v1.2.0/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= github.com/golang/protobuf v1.3.1 h1:YF8+flBXS5eO826T4nzqPrxfhQThhXl0YzfuUPu4SBg= github.com/golang/protobuf v1.3.1/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= github.com/google/btree v1.0.0 h1:0udJVsspx3VBr5FwtLhQQtuAsVc79tTq0ocGIPAU6qo= github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ= -github.com/google/go-cmp v0.2.0 h1:+dTQ8DZQJz0Mb/HjFlkptS1FeQ4cWSnN941F8aEG4SQ= -github.com/google/go-cmp v0.2.0/go.mod h1:oXzfMopK8JAjlY9xF4vHSVASa0yLyX7SntLO5aqRK0M= +github.com/google/go-cmp v0.3.0 h1:crn/baboCvb5fXaQ0IJ1SGTsTVrWpDsCWC8EGETZijY= +github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= +github.com/google/gofuzz v0.0.0-20170612174753-24818f796faf/go.mod h1:HP5RmnzzSNb993RKQDq4+1A4ia9nllfqcQFTQJedwGI= github.com/google/gofuzz v1.0.0 h1:A8PeW59pxE9IoFRqBp37U+mSNaQoZ46F1f0f863XSXw= github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= +github.com/google/uuid v1.0.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.1.1 h1:Gkbcsh/GbpXz7lPftLA3P6TYMwjCLYm83jiFQZF/3gY= github.com/google/uuid v1.1.1/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= +github.com/googleapis/gnostic v0.0.0-20170729233727-0c5108395e2d/go.mod h1:sJBsCZ4ayReDTBIg8b9dl28c5xFWyhBTVRp3pOg5EKY= github.com/googleapis/gnostic v0.2.0 h1:l6N3VoaVzTncYYW+9yOz2LJJammFZGBO13sqgEhpy9g= github.com/googleapis/gnostic v0.2.0/go.mod h1:sJBsCZ4ayReDTBIg8b9dl28c5xFWyhBTVRp3pOg5EKY= github.com/gopherjs/gopherjs v0.0.0-20181017120253-0766667cb4d1 h1:EGx4pi6eqNxGaHF6qqu48+N2wcFQ5qg5FXgOdqsJ5d8= github.com/gopherjs/gopherjs v0.0.0-20181017120253-0766667cb4d1/go.mod h1:wJfORRmW1u3UXTncJ5qlYoELFm8eSnnEO6hX4iZ3EWY= github.com/gregjones/httpcache v0.0.0-20190212212710-3befbb6ad0cc h1:f8eY6cV/x1x+HLjOp4r72s/31/V2aTUtg5oKRRPf8/Q= github.com/gregjones/httpcache v0.0.0-20190212212710-3befbb6ad0cc/go.mod h1:FecbI9+v66THATjSRHfNgh1IVFe/9kFxbXtjV0ctIMA= +github.com/hashicorp/golang-lru v0.5.0/go.mod h1:/m3WP610KZHVQ1SGc6re/UDhFvYD7pJ4Ao+sR/qLZy8= github.com/hpcloud/tail v1.0.0 h1:nfCOvKYfkgYP8hkirhJocXT2+zOD8yUNjXaWfTlyFKI= github.com/hpcloud/tail v1.0.0/go.mod h1:ab1qPbhIpdTxEkNHXyeSf5vhxWSCs/tWer42PpOxQnU= github.com/imdario/mergo v0.3.6 h1:xTNEAn+kxVO7dTZGu0CegyqKZmoWFI0rF8UxjlB2d28= @@ -76,6 +85,7 @@ github.com/inconshreveable/mousetrap v1.0.0 h1:Z8tu5sraLXCXIcARxBp/8cbvlwVa7Z1NH github.com/inconshreveable/mousetrap v1.0.0/go.mod h1:PxqpIevigyE2G7u3NXJIT2ANytuPF1OarO4DADm73n8= github.com/jarcoal/httpmock v1.0.1 h1:OXIOrglWeSllwHQGJ5X4PX4hFZK1DPCXSJVhMSJacg8= github.com/jarcoal/httpmock v1.0.1/go.mod h1:ATjnClrvW/3tijVmpL/va5Z3aAyGvqU3gCT8nX0Txik= +github.com/json-iterator/go v0.0.0-20180701071628-ab8a2e0c74be/go.mod h1:+SdeFBvtyEkXs7REEP0seUULqWtbJapLOCVDaaPEHmU= github.com/json-iterator/go v1.1.7 h1:KfgG9LzI+pYjr4xvmz/5H4FXjokeP+rlHLhv3iH62Fo= github.com/json-iterator/go v1.1.7/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4= github.com/jtolds/gls v4.20.0+incompatible h1:xdiiI2gbIgH/gLH7ADydsJ1uDOEzR8yvV7C0MuV77Wo= @@ -99,14 +109,17 @@ github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b h1:j7+1HpAFS1zy5+Q4qx1f github.com/mgutz/ansi v0.0.0-20170206155736-9520e82c474b/go.mod h1:01TrycV0kFyexm33Z7vhZRXopbI8J3TDReVlkTgMUxE= github.com/mitchellh/go-homedir v1.1.0 h1:lukF9ziXFxDFPkA1vsr5zpc1XuPDn/wFntq5mG+4E0Y= github.com/mitchellh/go-homedir v1.1.0/go.mod h1:SfyaCUpYCn1Vlf4IUYiD9fPX4A5wJrkLzIz1N1q0pr0= -github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421 h1:ZqeYNhU3OHLH3mGKHDcjJRFFRrJa6eAM5H+CtDdOsPc= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= +github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd h1:TRLaZ9cD/w8PVh93nsPXa1VrQ6jlwL5oN8l14QlcNfg= +github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/reflect2 v0.0.0-20180701023420-4b7aa43c6742/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0= github.com/modern-go/reflect2 v1.0.1 h1:9f412s+6RmYXLWZSEzVVgPGK7C2PphHj5RJrvfx9AWI= github.com/modern-go/reflect2 v1.0.1/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0= +github.com/mxk/go-flowrate v0.0.0-20140419014527-cca7078d478f/go.mod h1:ZdcZmHo+o7JKHSa8/e818NopupXU1YMK5fe1lsApnBw= github.com/onsi/ginkgo v1.6.0/go.mod h1:lLunBs/Ym6LB5Z9jYTR76FiuTmxDTDusOGeTQH+WWjE= github.com/onsi/ginkgo v1.10.3 h1:OoxbjfXVZyod1fmWYhI7SEyaD8B00ynP3T+D5GiyHOY= github.com/onsi/ginkgo v1.10.3/go.mod h1:lLunBs/Ym6LB5Z9jYTR76FiuTmxDTDusOGeTQH+WWjE= +github.com/onsi/gomega v0.0.0-20190113212917-5533ce8a0da3/go.mod h1:ex+gbHU/CVuBBDIJjb2X0qEXbFg53c61hWP/1CpauHY= github.com/onsi/gomega v1.4.3 h1:RE1xgDvH7imwFD45h+u2SgIfERHlS2yNG4DObb5BSKU= github.com/onsi/gomega v1.4.3/go.mod h1:ex+gbHU/CVuBBDIJjb2X0qEXbFg53c61hWP/1CpauHY= github.com/peterbourgon/diskv v2.0.1+incompatible h1:UBdAOUP5p4RWqPBg048CAvpKN+vxiaj6gdUUzhl4XmI= @@ -125,6 +138,7 @@ github.com/smartystreets/goconvey v0.0.0-20190731233626-505e41936337 h1:WN9BUFbd github.com/smartystreets/goconvey v0.0.0-20190731233626-505e41936337/go.mod h1:syvi0/a8iFYH4r/RixwvyeAJjdLS9QV7WQ/tjFTllLA= github.com/spf13/cobra v0.0.3 h1:ZlrZ4XsMRm04Fr5pSFxBgfND2EBVa1nLpiy1stUsX/8= github.com/spf13/cobra v0.0.3/go.mod h1:1l0Ry5zgKvJasoi3XT1TypsSe7PqH0Sj9dhYf7v3XqQ= +github.com/spf13/pflag v1.0.1/go.mod h1:DYY7MBk1bdzusC3SYhjObp+wFpr4gzcvqqNjLnInEg4= github.com/spf13/pflag v1.0.3 h1:zPAT6CGy6wXeQ7NtTnaTerfKOsV6V6F8agHXFiazDkg= github.com/spf13/pflag v1.0.3/go.mod h1:DYY7MBk1bdzusC3SYhjObp+wFpr4gzcvqqNjLnInEg4= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= @@ -134,17 +148,16 @@ github.com/stretchr/testify v1.3.0 h1:TivCn/peBQ7UY8ooIcPgZFpTNSz0Q2U6UrFlUfqbe0 github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= github.com/x-cray/logrus-prefixed-formatter v0.5.2 h1:00txxvfBM9muc0jiLIEAkAcIMJzfthRT6usrui8uGmg= github.com/x-cray/logrus-prefixed-formatter v0.5.2/go.mod h1:2duySbKsL6M18s5GU7VPsoEPHyzalCE06qoARUCeBBE= -golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2 h1:VklqNMn3ovrHsnt90PveolxSbWFaJdECFbxSq0Mqo2M= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20191105034135-c7e5f84aec59 h1:PyXRxSVbvzDGuqYXjHndV7xDzJ7w2K8KD9Ef8GB7KOE= golang.org/x/crypto v0.0.0-20191105034135-c7e5f84aec59/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180906233101-161cd47e91fd/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20190108225652-1e06a53dbb7e/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= -golang.org/x/net v0.0.0-20190311183353-d8887717615a h1:oWX7TPOiFAMXLq8o0ikBYfCJVlRHBcsciT5bXOrH628= golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= -golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3 h1:0GoQqolDA55aaLxZyTzK/Y2ePZzZTUrRacwib7cNsYQ= golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= +golang.org/x/net v0.0.0-20190812203447-cdfb69ac37fc h1:gkKoSkUmnU6bpS/VhkuO27bzQeSA51uaEfbOW5dNb68= +golang.org/x/net v0.0.0-20190812203447-cdfb69ac37fc/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45 h1:SVwTIAaPC2U/AvvLNZ2a7OVsmBpC8L5BlwK1whH3hm0= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -153,15 +166,17 @@ golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJ golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180909124046-d0be0721c37e/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= +golang.org/x/sys v0.0.0-20190312061237-fead79001313/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/sys v0.0.0-20191008105621-543471e840be h1:QAcqgptGM8IQBC9K/RC4o+O9YmqEm0diQn9QmZw/0mU= golang.org/x/sys v0.0.0-20191008105621-543471e840be/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191104094858-e8c54fb511f6 h1:ZJUmhYTp8GbGC0ViZRc2U+MIYQ8xx9MscsdXnclfIhw= golang.org/x/sys v0.0.0-20191104094858-e8c54fb511f6/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/text v0.3.0 h1:g61tztE5qeGQ89tm6NTjjM9VPIm088od1l6aSorWRWg= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db h1:6/JqlYfC1CCaLnGceQTI+sDGhC9UBSPAsBqI0Gun6kU= +golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/time v0.0.0-20190921001708-c4c64cad1fd0 h1:xQwXv67TxFo9nC1GJFyab5eq/5B590r6RlnL/G8Sz7w= golang.org/x/time v0.0.0-20190921001708-c4c64cad1fd0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20190328211700-ab21143f2384/go.mod h1:LCzVGOaR6xXOjkQ3onu1FJEFr0SW1gC7cKk1uF8kGRs= google.golang.org/appengine v1.4.0 h1:/wp5JvzpHIxhs/dumFmF7BXTf3Z+dd4uXta4kVyO508= google.golang.org/appengine v1.4.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= @@ -174,23 +189,25 @@ gopkg.in/go-playground/assert.v1 v1.2.1 h1:xoYuJVE7KT85PYWrN730RguIQO0ePzVRfFMXa gopkg.in/go-playground/assert.v1 v1.2.1/go.mod h1:9RXL0bg/zibRAgZUYszZSwO/z8Y/a8bDuhia5mkpMnE= gopkg.in/go-playground/validator.v9 v9.25.0 h1:Q3c4LgUofOEtz0wCE18Q2qwDkATLHLBUOmTvqjNCWkM= gopkg.in/go-playground/validator.v9 v9.25.0/go.mod h1:+c9/zcJMFNgbLvly1L1V+PpxWdVbfP1avr/N00E2vyQ= +gopkg.in/inf.v0 v0.9.0/go.mod h1:cWUDdTG/fYaXco+Dcufb5Vnc6Gp2YChqWtbxRZE0mXw= gopkg.in/inf.v0 v0.9.1 h1:73M5CoZyi3ZLMOyDlQh031Cx6N9NDJ2Vvfl76EDAgDc= gopkg.in/inf.v0 v0.9.1/go.mod h1:cWUDdTG/fYaXco+Dcufb5Vnc6Gp2YChqWtbxRZE0mXw= gopkg.in/ini.v1 v1.41.0 h1:Ka3ViY6gNYSKiVy71zXBEqKplnV35ImDLVG+8uoIklE= gopkg.in/ini.v1 v1.41.0/go.mod h1:pNLf8WUiyNEtQjuu5G5vTm06TEv9tsIgeAvK8hOrP4k= gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 h1:uRGJdciOHaEIrze2W8Q3AKkepLTh2hOroT7a+7czfdQ= gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7/go.mod h1:dt/ZhP58zS4L8KSrWDmTeBkI65Dw0HsyUHuEVlX15mw= -gopkg.in/yaml.v2 v2.2.1 h1:mUhvW9EsL+naU5Q3cakzfE91YhliOondGd6ZrsDBHQE= gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= -gopkg.in/yaml.v2 v2.2.2 h1:ZCJp+EgiOT7lHqUV2J862kp8Qj64Jo6az82+3Td9dZw= -gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= +gopkg.in/yaml.v2 v2.2.4 h1:/eiJrUcujPVeJ3xlSWaiNi3uSVmDGBK1pDHUHAnao1I= +gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= k8s.io/api v0.0.0-20190222213804-5cb15d344471 h1:MzQGt8qWQCR+39kbYRd0uQqsvSidpYqJLFeWiJ9l4OE= k8s.io/api v0.0.0-20190222213804-5cb15d344471/go.mod h1:iuAfoD4hCxJ8Onx9kaTIt30j7jUFS00AXQi6QMi99vA= -k8s.io/apimachinery v0.0.0-20190221213512-86fb29eff628 h1:UYfHH+KEF88OTg+GojQUwFTNxbxwmoktLwutUzR0GPg= -k8s.io/apimachinery v0.0.0-20190221213512-86fb29eff628/go.mod h1:ccL7Eh7zubPUSh9A3USN90/OzHNSVN6zxzde07TDCL0= +k8s.io/apimachinery v0.15.7 h1:H6pN003RwDju/3BzRGuymY4ymvMjHNbD8MVWhtDeaOI= +k8s.io/apimachinery v0.15.7/go.mod h1:Xc10RHc1U+F/e9GCloJ8QAeCGevSVP5xhOhqlE+e1kM= k8s.io/client-go v10.0.0+incompatible h1:F1IqCqw7oMBzDkqlcBymRq1450wD0eNqLE9jzUrIi34= k8s.io/client-go v10.0.0+incompatible/go.mod h1:7vJpHMYJwNQCWgzmNV+VYUl1zCObLyodBc8nIyt8L5s= +k8s.io/klog v0.3.1/go.mod h1:Gq+BEi5rUBO/HRz0bTSXDUcqjScdoY3a9IHpCEIOOfk= k8s.io/klog v1.0.0 h1:Pt+yjF5aB1xDSVbau4VsWe+dQNzA0qv1LlXdC2dF6Q8= k8s.io/klog v1.0.0/go.mod h1:4Bi6QPql/J/LkTDqv7R/cd3hPo4k2DG6Ptcz060Ez5I= +k8s.io/kube-openapi v0.0.0-20190228160746-b3a7cee44a30/go.mod h1:BXM9ceUBTj2QnfH2MK1odQs778ajze1RxcmP6S8RVVc= sigs.k8s.io/yaml v1.1.0 h1:4A07+ZFc2wgJwo8YNlQpr1rVlgUDlxXHhPJciaPY5gs= sigs.k8s.io/yaml v1.1.0/go.mod h1:UJmg0vDUVViEyp3mgSv9WPwZCDxu4rQW1olrI1uml+o= diff --git a/vendor/github.com/google/go-cmp/cmp/compare.go b/vendor/github.com/google/go-cmp/cmp/compare.go index 7e215f2202..2133562b01 100644 --- a/vendor/github.com/google/go-cmp/cmp/compare.go +++ b/vendor/github.com/google/go-cmp/cmp/compare.go @@ -29,26 +29,17 @@ package cmp import ( "fmt" "reflect" + "strings" "github.com/google/go-cmp/cmp/internal/diff" + "github.com/google/go-cmp/cmp/internal/flags" "github.com/google/go-cmp/cmp/internal/function" "github.com/google/go-cmp/cmp/internal/value" ) -// BUG(dsnet): Maps with keys containing NaN values cannot be properly compared due to -// the reflection package's inability to retrieve such entries. Equal will panic -// anytime it comes across a NaN key, but this behavior may change. -// -// See https://golang.org/issue/11104 for more details. - -var nothing = reflect.Value{} - // Equal reports whether x and y are equal by recursively applying the // following rules in the given order to x and y and all of their sub-values: // -// • If two values are not of the same type, then they are never equal -// and the overall result is false. -// // • Let S be the set of all Ignore, Transformer, and Comparer options that // remain after applying all path filters, value filters, and type filters. // If at least one Ignore exists in S, then the comparison is ignored. @@ -61,43 +52,79 @@ var nothing = reflect.Value{} // // • If the values have an Equal method of the form "(T) Equal(T) bool" or // "(T) Equal(I) bool" where T is assignable to I, then use the result of -// x.Equal(y) even if x or y is nil. -// Otherwise, no such method exists and evaluation proceeds to the next rule. +// x.Equal(y) even if x or y is nil. Otherwise, no such method exists and +// evaluation proceeds to the next rule. // // • Lastly, try to compare x and y based on their basic kinds. // Simple kinds like booleans, integers, floats, complex numbers, strings, and // channels are compared using the equivalent of the == operator in Go. // Functions are only equal if they are both nil, otherwise they are unequal. -// Pointers are equal if the underlying values they point to are also equal. -// Interfaces are equal if their underlying concrete values are also equal. // -// Structs are equal if all of their fields are equal. If a struct contains -// unexported fields, Equal panics unless the AllowUnexported option is used or -// an Ignore option (e.g., cmpopts.IgnoreUnexported) ignores that field. +// Structs are equal if recursively calling Equal on all fields report equal. +// If a struct contains unexported fields, Equal panics unless an Ignore option +// (e.g., cmpopts.IgnoreUnexported) ignores that field or the AllowUnexported +// option explicitly permits comparing the unexported field. +// +// Slices are equal if they are both nil or both non-nil, where recursively +// calling Equal on all non-ignored slice or array elements report equal. +// Empty non-nil slices and nil slices are not equal; to equate empty slices, +// consider using cmpopts.EquateEmpty. // -// Arrays, slices, and maps are equal if they are both nil or both non-nil -// with the same length and the elements at each index or key are equal. -// Note that a non-nil empty slice and a nil slice are not equal. -// To equate empty slices and maps, consider using cmpopts.EquateEmpty. +// Maps are equal if they are both nil or both non-nil, where recursively +// calling Equal on all non-ignored map entries report equal. // Map keys are equal according to the == operator. // To use custom comparisons for map keys, consider using cmpopts.SortMaps. +// Empty non-nil maps and nil maps are not equal; to equate empty maps, +// consider using cmpopts.EquateEmpty. +// +// Pointers and interfaces are equal if they are both nil or both non-nil, +// where they have the same underlying concrete type and recursively +// calling Equal on the underlying values reports equal. func Equal(x, y interface{}, opts ...Option) bool { + vx := reflect.ValueOf(x) + vy := reflect.ValueOf(y) + + // If the inputs are different types, auto-wrap them in an empty interface + // so that they have the same parent type. + var t reflect.Type + if !vx.IsValid() || !vy.IsValid() || vx.Type() != vy.Type() { + t = reflect.TypeOf((*interface{})(nil)).Elem() + if vx.IsValid() { + vvx := reflect.New(t).Elem() + vvx.Set(vx) + vx = vvx + } + if vy.IsValid() { + vvy := reflect.New(t).Elem() + vvy.Set(vy) + vy = vvy + } + } else { + t = vx.Type() + } + s := newState(opts) - s.compareAny(reflect.ValueOf(x), reflect.ValueOf(y)) + s.compareAny(&pathStep{t, vx, vy}) return s.result.Equal() } // Diff returns a human-readable report of the differences between two values. // It returns an empty string if and only if Equal returns true for the same -// input values and options. The output string will use the "-" symbol to -// indicate elements removed from x, and the "+" symbol to indicate elements -// added to y. +// input values and options. +// +// The output is displayed as a literal in pseudo-Go syntax. +// At the start of each line, a "-" prefix indicates an element removed from x, +// a "+" prefix to indicates an element added to y, and the lack of a prefix +// indicates an element common to both x and y. If possible, the output +// uses fmt.Stringer.String or error.Error methods to produce more humanly +// readable outputs. In such cases, the string is prefixed with either an +// 's' or 'e' character, respectively, to indicate that the method was called. // -// Do not depend on this output being stable. +// Do not depend on this output being stable. If you need the ability to +// programmatically interpret the difference, consider using a custom Reporter. func Diff(x, y interface{}, opts ...Option) string { r := new(defaultReporter) - opts = Options{Options(opts), r} - eq := Equal(x, y, opts...) + eq := Equal(x, y, Options(opts), Reporter(r)) d := r.String() if (d == "") != eq { panic("inconsistent difference and equality results") @@ -108,9 +135,13 @@ func Diff(x, y interface{}, opts ...Option) string { type state struct { // These fields represent the "comparison state". // Calling statelessCompare must not result in observable changes to these. - result diff.Result // The current result of comparison - curPath Path // The current path in the value tree - reporter reporter // Optional reporter used for difference formatting + result diff.Result // The current result of comparison + curPath Path // The current path in the value tree + reporters []reporter // Optional reporters + + // recChecker checks for infinite cycles applying the same set of + // transformers upon the output of itself. + recChecker recChecker // dynChecker triggers pseudo-random checks for option correctness. // It is safe for statelessCompare to mutate this value. @@ -122,10 +153,9 @@ type state struct { } func newState(opts []Option) *state { - s := new(state) - for _, opt := range opts { - s.processOption(opt) - } + // Always ensure a validator option exists to validate the inputs. + s := &state{opts: Options{validator{}}} + s.processOption(Options(opts)) return s } @@ -152,10 +182,7 @@ func (s *state) processOption(opt Option) { s.exporters[t] = true } case reporter: - if s.reporter != nil { - panic("difference reporter already registered") - } - s.reporter = opt + s.reporters = append(s.reporters, opt) default: panic(fmt.Sprintf("unknown option %T", opt)) } @@ -164,153 +191,88 @@ func (s *state) processOption(opt Option) { // statelessCompare compares two values and returns the result. // This function is stateless in that it does not alter the current result, // or output to any registered reporters. -func (s *state) statelessCompare(vx, vy reflect.Value) diff.Result { +func (s *state) statelessCompare(step PathStep) diff.Result { // We do not save and restore the curPath because all of the compareX // methods should properly push and pop from the path. // It is an implementation bug if the contents of curPath differs from // when calling this function to when returning from it. - oldResult, oldReporter := s.result, s.reporter + oldResult, oldReporters := s.result, s.reporters s.result = diff.Result{} // Reset result - s.reporter = nil // Remove reporter to avoid spurious printouts - s.compareAny(vx, vy) + s.reporters = nil // Remove reporters to avoid spurious printouts + s.compareAny(step) res := s.result - s.result, s.reporter = oldResult, oldReporter + s.result, s.reporters = oldResult, oldReporters return res } -func (s *state) compareAny(vx, vy reflect.Value) { - // TODO: Support cyclic data structures. - - // Rule 0: Differing types are never equal. - if !vx.IsValid() || !vy.IsValid() { - s.report(vx.IsValid() == vy.IsValid(), vx, vy) - return - } - if vx.Type() != vy.Type() { - s.report(false, vx, vy) // Possible for path to be empty - return - } - t := vx.Type() - if len(s.curPath) == 0 { - s.curPath.push(&pathStep{typ: t}) - defer s.curPath.pop() +func (s *state) compareAny(step PathStep) { + // Update the path stack. + s.curPath.push(step) + defer s.curPath.pop() + for _, r := range s.reporters { + r.PushStep(step) + defer r.PopStep() } - vx, vy = s.tryExporting(vx, vy) + s.recChecker.Check(s.curPath) + + // Obtain the current type and values. + t := step.Type() + vx, vy := step.Values() // Rule 1: Check whether an option applies on this node in the value tree. - if s.tryOptions(vx, vy, t) { + if s.tryOptions(t, vx, vy) { return } // Rule 2: Check whether the type has a valid Equal method. - if s.tryMethod(vx, vy, t) { + if s.tryMethod(t, vx, vy) { return } - // Rule 3: Recursively descend into each value's underlying kind. + // Rule 3: Compare based on the underlying kind. switch t.Kind() { case reflect.Bool: - s.report(vx.Bool() == vy.Bool(), vx, vy) - return + s.report(vx.Bool() == vy.Bool(), 0) case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - s.report(vx.Int() == vy.Int(), vx, vy) - return + s.report(vx.Int() == vy.Int(), 0) case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: - s.report(vx.Uint() == vy.Uint(), vx, vy) - return + s.report(vx.Uint() == vy.Uint(), 0) case reflect.Float32, reflect.Float64: - s.report(vx.Float() == vy.Float(), vx, vy) - return + s.report(vx.Float() == vy.Float(), 0) case reflect.Complex64, reflect.Complex128: - s.report(vx.Complex() == vy.Complex(), vx, vy) - return + s.report(vx.Complex() == vy.Complex(), 0) case reflect.String: - s.report(vx.String() == vy.String(), vx, vy) - return + s.report(vx.String() == vy.String(), 0) case reflect.Chan, reflect.UnsafePointer: - s.report(vx.Pointer() == vy.Pointer(), vx, vy) - return + s.report(vx.Pointer() == vy.Pointer(), 0) case reflect.Func: - s.report(vx.IsNil() && vy.IsNil(), vx, vy) - return + s.report(vx.IsNil() && vy.IsNil(), 0) + case reflect.Struct: + s.compareStruct(t, vx, vy) + case reflect.Slice, reflect.Array: + s.compareSlice(t, vx, vy) + case reflect.Map: + s.compareMap(t, vx, vy) case reflect.Ptr: - if vx.IsNil() || vy.IsNil() { - s.report(vx.IsNil() && vy.IsNil(), vx, vy) - return - } - s.curPath.push(&indirect{pathStep{t.Elem()}}) - defer s.curPath.pop() - s.compareAny(vx.Elem(), vy.Elem()) - return + s.comparePtr(t, vx, vy) case reflect.Interface: - if vx.IsNil() || vy.IsNil() { - s.report(vx.IsNil() && vy.IsNil(), vx, vy) - return - } - if vx.Elem().Type() != vy.Elem().Type() { - s.report(false, vx.Elem(), vy.Elem()) - return - } - s.curPath.push(&typeAssertion{pathStep{vx.Elem().Type()}}) - defer s.curPath.pop() - s.compareAny(vx.Elem(), vy.Elem()) - return - case reflect.Slice: - if vx.IsNil() || vy.IsNil() { - s.report(vx.IsNil() && vy.IsNil(), vx, vy) - return - } - fallthrough - case reflect.Array: - s.compareArray(vx, vy, t) - return - case reflect.Map: - s.compareMap(vx, vy, t) - return - case reflect.Struct: - s.compareStruct(vx, vy, t) - return + s.compareInterface(t, vx, vy) default: panic(fmt.Sprintf("%v kind not handled", t.Kind())) } } -func (s *state) tryExporting(vx, vy reflect.Value) (reflect.Value, reflect.Value) { - if sf, ok := s.curPath[len(s.curPath)-1].(*structField); ok && sf.unexported { - if sf.force { - // Use unsafe pointer arithmetic to get read-write access to an - // unexported field in the struct. - vx = unsafeRetrieveField(sf.pvx, sf.field) - vy = unsafeRetrieveField(sf.pvy, sf.field) - } else { - // We are not allowed to export the value, so invalidate them - // so that tryOptions can panic later if not explicitly ignored. - vx = nothing - vy = nothing - } - } - return vx, vy -} - -func (s *state) tryOptions(vx, vy reflect.Value, t reflect.Type) bool { - // If there were no FilterValues, we will not detect invalid inputs, - // so manually check for them and append invalid if necessary. - // We still evaluate the options since an ignore can override invalid. - opts := s.opts - if !vx.IsValid() || !vy.IsValid() { - opts = Options{opts, invalid{}} - } - +func (s *state) tryOptions(t reflect.Type, vx, vy reflect.Value) bool { // Evaluate all filters and apply the remaining options. - if opt := opts.filter(s, vx, vy, t); opt != nil { + if opt := s.opts.filter(s, t, vx, vy); opt != nil { opt.apply(s, vx, vy) return true } return false } -func (s *state) tryMethod(vx, vy reflect.Value, t reflect.Type) bool { +func (s *state) tryMethod(t reflect.Type, vx, vy reflect.Value) bool { // Check if this type even has an Equal method. m, ok := t.MethodByName("Equal") if !ok || !function.IsType(m.Type, function.EqualAssignable) { @@ -318,11 +280,11 @@ func (s *state) tryMethod(vx, vy reflect.Value, t reflect.Type) bool { } eq := s.callTTBFunc(m.Func, vx, vy) - s.report(eq, vx, vy) + s.report(eq, reportByMethod) return true } -func (s *state) callTRFunc(f, v reflect.Value) reflect.Value { +func (s *state) callTRFunc(f, v reflect.Value, step Transform) reflect.Value { v = sanitizeValue(v, f.Type().In(0)) if !s.dynChecker.Next() { return f.Call([]reflect.Value{v})[0] @@ -333,15 +295,15 @@ func (s *state) callTRFunc(f, v reflect.Value) reflect.Value { // unsafe mutations to the input. c := make(chan reflect.Value) go detectRaces(c, f, v) + got := <-c want := f.Call([]reflect.Value{v})[0] - if got := <-c; !s.statelessCompare(got, want).Equal() { + if step.vx, step.vy = got, want; !s.statelessCompare(step).Equal() { // To avoid false-positives with non-reflexive equality operations, // we sanity check whether a value is equal to itself. - if !s.statelessCompare(want, want).Equal() { + if step.vx, step.vy = want, want; !s.statelessCompare(step).Equal() { return want } - fn := getFuncName(f.Pointer()) - panic(fmt.Sprintf("non-deterministic function detected: %s", fn)) + panic(fmt.Sprintf("non-deterministic function detected: %s", function.NameOf(f))) } return want } @@ -359,10 +321,10 @@ func (s *state) callTTBFunc(f, x, y reflect.Value) bool { // unsafe mutations to the input. c := make(chan reflect.Value) go detectRaces(c, f, y, x) + got := <-c want := f.Call([]reflect.Value{x, y})[0].Bool() - if got := <-c; !got.IsValid() || got.Bool() != want { - fn := getFuncName(f.Pointer()) - panic(fmt.Sprintf("non-deterministic or non-symmetric function detected: %s", fn)) + if !got.IsValid() || got.Bool() != want { + panic(fmt.Sprintf("non-deterministic or non-symmetric function detected: %s", function.NameOf(f))) } return want } @@ -380,140 +342,241 @@ func detectRaces(c chan<- reflect.Value, f reflect.Value, vs ...reflect.Value) { // assuming that T is assignable to R. // Otherwise, it returns the input value as is. func sanitizeValue(v reflect.Value, t reflect.Type) reflect.Value { - // TODO(dsnet): Remove this hacky workaround. - // See https://golang.org/issue/22143 - if v.Kind() == reflect.Interface && v.IsNil() && v.Type() != t { - return reflect.New(t).Elem() + // TODO(dsnet): Workaround for reflect bug (https://golang.org/issue/22143). + if !flags.AtLeastGo110 { + if v.Kind() == reflect.Interface && v.IsNil() && v.Type() != t { + return reflect.New(t).Elem() + } } return v } -func (s *state) compareArray(vx, vy reflect.Value, t reflect.Type) { - step := &sliceIndex{pathStep{t.Elem()}, 0, 0} - s.curPath.push(step) +func (s *state) compareStruct(t reflect.Type, vx, vy reflect.Value) { + var vax, vay reflect.Value // Addressable versions of vx and vy - // Compute an edit-script for slices vx and vy. - es := diff.Difference(vx.Len(), vy.Len(), func(ix, iy int) diff.Result { - step.xkey, step.ykey = ix, iy - return s.statelessCompare(vx.Index(ix), vy.Index(iy)) - }) + step := StructField{&structField{}} + for i := 0; i < t.NumField(); i++ { + step.typ = t.Field(i).Type + step.vx = vx.Field(i) + step.vy = vy.Field(i) + step.name = t.Field(i).Name + step.idx = i + step.unexported = !isExported(step.name) + if step.unexported { + if step.name == "_" { + continue + } + // Defer checking of unexported fields until later to give an + // Ignore a chance to ignore the field. + if !vax.IsValid() || !vay.IsValid() { + // For retrieveUnexportedField to work, the parent struct must + // be addressable. Create a new copy of the values if + // necessary to make them addressable. + vax = makeAddressable(vx) + vay = makeAddressable(vy) + } + step.mayForce = s.exporters[t] + step.pvx = vax + step.pvy = vay + step.field = t.Field(i) + } + s.compareAny(step) + } +} - // Report the entire slice as is if the arrays are of primitive kind, - // and the arrays are different enough. - isPrimitive := false - switch t.Elem().Kind() { - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, - reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, - reflect.Bool, reflect.Float32, reflect.Float64, reflect.Complex64, reflect.Complex128: - isPrimitive = true - } - if isPrimitive && es.Dist() > (vx.Len()+vy.Len())/4 { - s.curPath.pop() // Pop first since we are reporting the whole slice - s.report(false, vx, vy) +func (s *state) compareSlice(t reflect.Type, vx, vy reflect.Value) { + isSlice := t.Kind() == reflect.Slice + if isSlice && (vx.IsNil() || vy.IsNil()) { + s.report(vx.IsNil() && vy.IsNil(), 0) return } - // Replay the edit-script. + // TODO: Support cyclic data structures. + + step := SliceIndex{&sliceIndex{pathStep: pathStep{typ: t.Elem()}}} + withIndexes := func(ix, iy int) SliceIndex { + if ix >= 0 { + step.vx, step.xkey = vx.Index(ix), ix + } else { + step.vx, step.xkey = reflect.Value{}, -1 + } + if iy >= 0 { + step.vy, step.ykey = vy.Index(iy), iy + } else { + step.vy, step.ykey = reflect.Value{}, -1 + } + return step + } + + // Ignore options are able to ignore missing elements in a slice. + // However, detecting these reliably requires an optimal differencing + // algorithm, for which diff.Difference is not. + // + // Instead, we first iterate through both slices to detect which elements + // would be ignored if standing alone. The index of non-discarded elements + // are stored in a separate slice, which diffing is then performed on. + var indexesX, indexesY []int + var ignoredX, ignoredY []bool + for ix := 0; ix < vx.Len(); ix++ { + ignored := s.statelessCompare(withIndexes(ix, -1)).NumDiff == 0 + if !ignored { + indexesX = append(indexesX, ix) + } + ignoredX = append(ignoredX, ignored) + } + for iy := 0; iy < vy.Len(); iy++ { + ignored := s.statelessCompare(withIndexes(-1, iy)).NumDiff == 0 + if !ignored { + indexesY = append(indexesY, iy) + } + ignoredY = append(ignoredY, ignored) + } + + // Compute an edit-script for slices vx and vy (excluding ignored elements). + edits := diff.Difference(len(indexesX), len(indexesY), func(ix, iy int) diff.Result { + return s.statelessCompare(withIndexes(indexesX[ix], indexesY[iy])) + }) + + // Replay the ignore-scripts and the edit-script. var ix, iy int - for _, e := range es { + for ix < vx.Len() || iy < vy.Len() { + var e diff.EditType + switch { + case ix < len(ignoredX) && ignoredX[ix]: + e = diff.UniqueX + case iy < len(ignoredY) && ignoredY[iy]: + e = diff.UniqueY + default: + e, edits = edits[0], edits[1:] + } switch e { case diff.UniqueX: - step.xkey, step.ykey = ix, -1 - s.report(false, vx.Index(ix), nothing) + s.compareAny(withIndexes(ix, -1)) ix++ case diff.UniqueY: - step.xkey, step.ykey = -1, iy - s.report(false, nothing, vy.Index(iy)) + s.compareAny(withIndexes(-1, iy)) iy++ default: - step.xkey, step.ykey = ix, iy - if e == diff.Identity { - s.report(true, vx.Index(ix), vy.Index(iy)) - } else { - s.compareAny(vx.Index(ix), vy.Index(iy)) - } + s.compareAny(withIndexes(ix, iy)) ix++ iy++ } } - s.curPath.pop() - return } -func (s *state) compareMap(vx, vy reflect.Value, t reflect.Type) { +func (s *state) compareMap(t reflect.Type, vx, vy reflect.Value) { if vx.IsNil() || vy.IsNil() { - s.report(vx.IsNil() && vy.IsNil(), vx, vy) + s.report(vx.IsNil() && vy.IsNil(), 0) return } + // TODO: Support cyclic data structures. + // We combine and sort the two map keys so that we can perform the // comparisons in a deterministic order. - step := &mapIndex{pathStep: pathStep{t.Elem()}} - s.curPath.push(step) - defer s.curPath.pop() + step := MapIndex{&mapIndex{pathStep: pathStep{typ: t.Elem()}}} for _, k := range value.SortKeys(append(vx.MapKeys(), vy.MapKeys()...)) { + step.vx = vx.MapIndex(k) + step.vy = vy.MapIndex(k) step.key = k - vvx := vx.MapIndex(k) - vvy := vy.MapIndex(k) - switch { - case vvx.IsValid() && vvy.IsValid(): - s.compareAny(vvx, vvy) - case vvx.IsValid() && !vvy.IsValid(): - s.report(false, vvx, nothing) - case !vvx.IsValid() && vvy.IsValid(): - s.report(false, nothing, vvy) - default: - // It is possible for both vvx and vvy to be invalid if the - // key contained a NaN value in it. There is no way in - // reflection to be able to retrieve these values. - // See https://golang.org/issue/11104 - panic(fmt.Sprintf("%#v has map key with NaNs", s.curPath)) + if !step.vx.IsValid() && !step.vy.IsValid() { + // It is possible for both vx and vy to be invalid if the + // key contained a NaN value in it. + // + // Even with the ability to retrieve NaN keys in Go 1.12, + // there still isn't a sensible way to compare the values since + // a NaN key may map to multiple unordered values. + // The most reasonable way to compare NaNs would be to compare the + // set of values. However, this is impossible to do efficiently + // since set equality is provably an O(n^2) operation given only + // an Equal function. If we had a Less function or Hash function, + // this could be done in O(n*log(n)) or O(n), respectively. + // + // Rather than adding complex logic to deal with NaNs, make it + // the user's responsibility to compare such obscure maps. + const help = "consider providing a Comparer to compare the map" + panic(fmt.Sprintf("%#v has map key with NaNs\n%s", s.curPath, help)) } + s.compareAny(step) } } -func (s *state) compareStruct(vx, vy reflect.Value, t reflect.Type) { - var vax, vay reflect.Value // Addressable versions of vx and vy +func (s *state) comparePtr(t reflect.Type, vx, vy reflect.Value) { + if vx.IsNil() || vy.IsNil() { + s.report(vx.IsNil() && vy.IsNil(), 0) + return + } - step := &structField{} - s.curPath.push(step) - defer s.curPath.pop() - for i := 0; i < t.NumField(); i++ { - vvx := vx.Field(i) - vvy := vy.Field(i) - step.typ = t.Field(i).Type - step.name = t.Field(i).Name - step.idx = i - step.unexported = !isExported(step.name) - if step.unexported { - // Defer checking of unexported fields until later to give an - // Ignore a chance to ignore the field. - if !vax.IsValid() || !vay.IsValid() { - // For unsafeRetrieveField to work, the parent struct must - // be addressable. Create a new copy of the values if - // necessary to make them addressable. - vax = makeAddressable(vx) - vay = makeAddressable(vy) - } - step.force = s.exporters[t] - step.pvx = vax - step.pvy = vay - step.field = t.Field(i) + // TODO: Support cyclic data structures. + + vx, vy = vx.Elem(), vy.Elem() + s.compareAny(Indirect{&indirect{pathStep{t.Elem(), vx, vy}}}) +} + +func (s *state) compareInterface(t reflect.Type, vx, vy reflect.Value) { + if vx.IsNil() || vy.IsNil() { + s.report(vx.IsNil() && vy.IsNil(), 0) + return + } + vx, vy = vx.Elem(), vy.Elem() + if vx.Type() != vy.Type() { + s.report(false, 0) + return + } + s.compareAny(TypeAssertion{&typeAssertion{pathStep{vx.Type(), vx, vy}}}) +} + +func (s *state) report(eq bool, rf resultFlags) { + if rf&reportByIgnore == 0 { + if eq { + s.result.NumSame++ + rf |= reportEqual + } else { + s.result.NumDiff++ + rf |= reportUnequal } - s.compareAny(vvx, vvy) + } + for _, r := range s.reporters { + r.Report(Result{flags: rf}) } } -// report records the result of a single comparison. -// It also calls Report if any reporter is registered. -func (s *state) report(eq bool, vx, vy reflect.Value) { - if eq { - s.result.NSame++ - } else { - s.result.NDiff++ +// recChecker tracks the state needed to periodically perform checks that +// user provided transformers are not stuck in an infinitely recursive cycle. +type recChecker struct{ next int } + +// Check scans the Path for any recursive transformers and panics when any +// recursive transformers are detected. Note that the presence of a +// recursive Transformer does not necessarily imply an infinite cycle. +// As such, this check only activates after some minimal number of path steps. +func (rc *recChecker) Check(p Path) { + const minLen = 1 << 16 + if rc.next == 0 { + rc.next = minLen + } + if len(p) < rc.next { + return + } + rc.next <<= 1 + + // Check whether the same transformer has appeared at least twice. + var ss []string + m := map[Option]int{} + for _, ps := range p { + if t, ok := ps.(Transform); ok { + t := t.Option() + if m[t] == 1 { // Transformer was used exactly once before + tf := t.(*transformer).fnc.Type() + ss = append(ss, fmt.Sprintf("%v: %v => %v", t, tf.In(0), tf.Out(0))) + } + m[t]++ + } } - if s.reporter != nil { - s.reporter.Report(vx, vy, eq, s.curPath) + if len(ss) > 0 { + const warning = "recursive set of Transformers detected" + const help = "consider using cmpopts.AcyclicTransformer" + set := strings.Join(ss, "\n\t") + panic(fmt.Sprintf("%s:\n\t%s\n%s", warning, set, help)) } } diff --git a/vendor/github.com/google/go-cmp/cmp/unsafe_panic.go b/vendor/github.com/google/go-cmp/cmp/export_panic.go similarity index 60% rename from vendor/github.com/google/go-cmp/cmp/unsafe_panic.go rename to vendor/github.com/google/go-cmp/cmp/export_panic.go index d1518eb3a8..abc3a1c3e7 100644 --- a/vendor/github.com/google/go-cmp/cmp/unsafe_panic.go +++ b/vendor/github.com/google/go-cmp/cmp/export_panic.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE.md file. -// +build purego appengine js +// +build purego package cmp @@ -10,6 +10,6 @@ import "reflect" const supportAllowUnexported = false -func unsafeRetrieveField(reflect.Value, reflect.StructField) reflect.Value { - panic("unsafeRetrieveField is not implemented") +func retrieveUnexportedField(reflect.Value, reflect.StructField) reflect.Value { + panic("retrieveUnexportedField is not implemented") } diff --git a/vendor/github.com/google/go-cmp/cmp/unsafe_reflect.go b/vendor/github.com/google/go-cmp/cmp/export_unsafe.go similarity index 64% rename from vendor/github.com/google/go-cmp/cmp/unsafe_reflect.go rename to vendor/github.com/google/go-cmp/cmp/export_unsafe.go index 579b65507f..59d4ee91b4 100644 --- a/vendor/github.com/google/go-cmp/cmp/unsafe_reflect.go +++ b/vendor/github.com/google/go-cmp/cmp/export_unsafe.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE.md file. -// +build !purego,!appengine,!js +// +build !purego package cmp @@ -13,11 +13,11 @@ import ( const supportAllowUnexported = true -// unsafeRetrieveField uses unsafe to forcibly retrieve any field from a struct -// such that the value has read-write permissions. +// retrieveUnexportedField uses unsafe to forcibly retrieve any field from +// a struct such that the value has read-write permissions. // // The parent struct, v, must be addressable, while f must be a StructField // describing the field to retrieve. -func unsafeRetrieveField(v reflect.Value, f reflect.StructField) reflect.Value { +func retrieveUnexportedField(v reflect.Value, f reflect.StructField) reflect.Value { return reflect.NewAt(f.Type, unsafe.Pointer(v.UnsafeAddr()+f.Offset)).Elem() } diff --git a/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_disable.go b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_disable.go index 42afa4960e..fe98dcc677 100644 --- a/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_disable.go +++ b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_disable.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE.md file. -// +build !debug +// +build !cmp_debug package diff diff --git a/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_enable.go b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_enable.go index fd9f7f1773..597b6ae56b 100644 --- a/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_enable.go +++ b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_enable.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE.md file. -// +build debug +// +build cmp_debug package diff @@ -14,7 +14,7 @@ import ( ) // The algorithm can be seen running in real-time by enabling debugging: -// go test -tags=debug -v +// go test -tags=cmp_debug -v // // Example output: // === RUN TestDifference/#34 diff --git a/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go b/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go index 260befea2f..3d2e42662c 100644 --- a/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go +++ b/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go @@ -85,22 +85,31 @@ func (es EditScript) LenY() int { return len(es) - es.stats().NX } type EqualFunc func(ix int, iy int) Result // Result is the result of comparison. -// NSame is the number of sub-elements that are equal. -// NDiff is the number of sub-elements that are not equal. -type Result struct{ NSame, NDiff int } +// NumSame is the number of sub-elements that are equal. +// NumDiff is the number of sub-elements that are not equal. +type Result struct{ NumSame, NumDiff int } + +// BoolResult returns a Result that is either Equal or not Equal. +func BoolResult(b bool) Result { + if b { + return Result{NumSame: 1} // Equal, Similar + } else { + return Result{NumDiff: 2} // Not Equal, not Similar + } +} // Equal indicates whether the symbols are equal. Two symbols are equal -// if and only if NDiff == 0. If Equal, then they are also Similar. -func (r Result) Equal() bool { return r.NDiff == 0 } +// if and only if NumDiff == 0. If Equal, then they are also Similar. +func (r Result) Equal() bool { return r.NumDiff == 0 } // Similar indicates whether two symbols are similar and may be represented // by using the Modified type. As a special case, we consider binary comparisons // (i.e., those that return Result{1, 0} or Result{0, 1}) to be similar. // -// The exact ratio of NSame to NDiff to determine similarity may change. +// The exact ratio of NumSame to NumDiff to determine similarity may change. func (r Result) Similar() bool { - // Use NSame+1 to offset NSame so that binary comparisons are similar. - return r.NSame+1 >= r.NDiff + // Use NumSame+1 to offset NumSame so that binary comparisons are similar. + return r.NumSame+1 >= r.NumDiff } // Difference reports whether two lists of lengths nx and ny are equal @@ -191,9 +200,9 @@ func Difference(nx, ny int, f EqualFunc) (es EditScript) { // that two lists commonly differ because elements were added to the front // or end of the other list. // - // Running the tests with the "debug" build tag prints a visualization of - // the algorithm running in real-time. This is educational for understanding - // how the algorithm works. See debug_enable.go. + // Running the tests with the "cmp_debug" build tag prints a visualization + // of the algorithm running in real-time. This is educational for + // understanding how the algorithm works. See debug_enable.go. f = debug.Begin(nx, ny, f, &fwdPath.es, &revPath.es) for { // Forward search from the beginning. diff --git a/vendor/github.com/google/go-cmp/cmp/internal/flags/flags.go b/vendor/github.com/google/go-cmp/cmp/internal/flags/flags.go new file mode 100644 index 0000000000..a9e7fc0b5b --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/flags/flags.go @@ -0,0 +1,9 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package flags + +// Deterministic controls whether the output of Diff should be deterministic. +// This is only used for testing. +var Deterministic bool diff --git a/vendor/github.com/google/go-cmp/cmp/internal/flags/toolchain_legacy.go b/vendor/github.com/google/go-cmp/cmp/internal/flags/toolchain_legacy.go new file mode 100644 index 0000000000..01aed0a153 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/flags/toolchain_legacy.go @@ -0,0 +1,10 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +// +build !go1.10 + +package flags + +// AtLeastGo110 reports whether the Go toolchain is at least Go 1.10. +const AtLeastGo110 = false diff --git a/vendor/github.com/google/go-cmp/cmp/internal/flags/toolchain_recent.go b/vendor/github.com/google/go-cmp/cmp/internal/flags/toolchain_recent.go new file mode 100644 index 0000000000..c0b667f58b --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/flags/toolchain_recent.go @@ -0,0 +1,10 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +// +build go1.10 + +package flags + +// AtLeastGo110 reports whether the Go toolchain is at least Go 1.10. +const AtLeastGo110 = true diff --git a/vendor/github.com/google/go-cmp/cmp/internal/function/func.go b/vendor/github.com/google/go-cmp/cmp/internal/function/func.go index 4c35ff11ee..ace1dbe86e 100644 --- a/vendor/github.com/google/go-cmp/cmp/internal/function/func.go +++ b/vendor/github.com/google/go-cmp/cmp/internal/function/func.go @@ -2,25 +2,34 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE.md file. -// Package function identifies function types. +// Package function provides functionality for identifying function types. package function -import "reflect" +import ( + "reflect" + "regexp" + "runtime" + "strings" +) type funcType int const ( _ funcType = iota + tbFunc // func(T) bool ttbFunc // func(T, T) bool + trbFunc // func(T, R) bool tibFunc // func(T, I) bool trFunc // func(T) R - Equal = ttbFunc // func(T, T) bool - EqualAssignable = tibFunc // func(T, I) bool; encapsulates func(T, T) bool - Transformer = trFunc // func(T) R - ValueFilter = ttbFunc // func(T, T) bool - Less = ttbFunc // func(T, T) bool + Equal = ttbFunc // func(T, T) bool + EqualAssignable = tibFunc // func(T, I) bool; encapsulates func(T, T) bool + Transformer = trFunc // func(T) R + ValueFilter = ttbFunc // func(T, T) bool + Less = ttbFunc // func(T, T) bool + ValuePredicate = tbFunc // func(T) bool + KeyValuePredicate = trbFunc // func(T, R) bool ) var boolType = reflect.TypeOf(true) @@ -32,10 +41,18 @@ func IsType(t reflect.Type, ft funcType) bool { } ni, no := t.NumIn(), t.NumOut() switch ft { + case tbFunc: // func(T) bool + if ni == 1 && no == 1 && t.Out(0) == boolType { + return true + } case ttbFunc: // func(T, T) bool if ni == 2 && no == 1 && t.In(0) == t.In(1) && t.Out(0) == boolType { return true } + case trbFunc: // func(T, R) bool + if ni == 2 && no == 1 && t.Out(0) == boolType { + return true + } case tibFunc: // func(T, I) bool if ni == 2 && no == 1 && t.In(0).AssignableTo(t.In(1)) && t.Out(0) == boolType { return true @@ -47,3 +64,36 @@ func IsType(t reflect.Type, ft funcType) bool { } return false } + +var lastIdentRx = regexp.MustCompile(`[_\p{L}][_\p{L}\p{N}]*$`) + +// NameOf returns the name of the function value. +func NameOf(v reflect.Value) string { + fnc := runtime.FuncForPC(v.Pointer()) + if fnc == nil { + return "" + } + fullName := fnc.Name() // e.g., "long/path/name/mypkg.(*MyType).(long/path/name/mypkg.myMethod)-fm" + + // Method closures have a "-fm" suffix. + fullName = strings.TrimSuffix(fullName, "-fm") + + var name string + for len(fullName) > 0 { + inParen := strings.HasSuffix(fullName, ")") + fullName = strings.TrimSuffix(fullName, ")") + + s := lastIdentRx.FindString(fullName) + if s == "" { + break + } + name = s + "." + name + fullName = strings.TrimSuffix(fullName, s) + + if i := strings.LastIndexByte(fullName, '('); inParen && i >= 0 { + fullName = fullName[:i] + } + fullName = strings.TrimSuffix(fullName, ".") + } + return strings.TrimSuffix(name, ".") +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/format.go b/vendor/github.com/google/go-cmp/cmp/internal/value/format.go deleted file mode 100644 index 657e508779..0000000000 --- a/vendor/github.com/google/go-cmp/cmp/internal/value/format.go +++ /dev/null @@ -1,277 +0,0 @@ -// Copyright 2017, The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE.md file. - -// Package value provides functionality for reflect.Value types. -package value - -import ( - "fmt" - "reflect" - "strconv" - "strings" - "unicode" -) - -var stringerIface = reflect.TypeOf((*fmt.Stringer)(nil)).Elem() - -// Format formats the value v as a string. -// -// This is similar to fmt.Sprintf("%+v", v) except this: -// * Prints the type unless it can be elided -// * Avoids printing struct fields that are zero -// * Prints a nil-slice as being nil, not empty -// * Prints map entries in deterministic order -func Format(v reflect.Value, conf FormatConfig) string { - conf.printType = true - conf.followPointers = true - conf.realPointers = true - return formatAny(v, conf, nil) -} - -type FormatConfig struct { - UseStringer bool // Should the String method be used if available? - printType bool // Should we print the type before the value? - PrintPrimitiveType bool // Should we print the type of primitives? - followPointers bool // Should we recursively follow pointers? - realPointers bool // Should we print the real address of pointers? -} - -func formatAny(v reflect.Value, conf FormatConfig, visited map[uintptr]bool) string { - // TODO: Should this be a multi-line printout in certain situations? - - if !v.IsValid() { - return "" - } - if conf.UseStringer && v.Type().Implements(stringerIface) && v.CanInterface() { - if (v.Kind() == reflect.Ptr || v.Kind() == reflect.Interface) && v.IsNil() { - return "" - } - - const stringerPrefix = "s" // Indicates that the String method was used - s := v.Interface().(fmt.Stringer).String() - return stringerPrefix + formatString(s) - } - - switch v.Kind() { - case reflect.Bool: - return formatPrimitive(v.Type(), v.Bool(), conf) - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - return formatPrimitive(v.Type(), v.Int(), conf) - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: - if v.Type().PkgPath() == "" || v.Kind() == reflect.Uintptr { - // Unnamed uints are usually bytes or words, so use hexadecimal. - return formatPrimitive(v.Type(), formatHex(v.Uint()), conf) - } - return formatPrimitive(v.Type(), v.Uint(), conf) - case reflect.Float32, reflect.Float64: - return formatPrimitive(v.Type(), v.Float(), conf) - case reflect.Complex64, reflect.Complex128: - return formatPrimitive(v.Type(), v.Complex(), conf) - case reflect.String: - return formatPrimitive(v.Type(), formatString(v.String()), conf) - case reflect.UnsafePointer, reflect.Chan, reflect.Func: - return formatPointer(v, conf) - case reflect.Ptr: - if v.IsNil() { - if conf.printType { - return fmt.Sprintf("(%v)(nil)", v.Type()) - } - return "" - } - if visited[v.Pointer()] || !conf.followPointers { - return formatPointer(v, conf) - } - visited = insertPointer(visited, v.Pointer()) - return "&" + formatAny(v.Elem(), conf, visited) - case reflect.Interface: - if v.IsNil() { - if conf.printType { - return fmt.Sprintf("%v(nil)", v.Type()) - } - return "" - } - return formatAny(v.Elem(), conf, visited) - case reflect.Slice: - if v.IsNil() { - if conf.printType { - return fmt.Sprintf("%v(nil)", v.Type()) - } - return "" - } - if visited[v.Pointer()] { - return formatPointer(v, conf) - } - visited = insertPointer(visited, v.Pointer()) - fallthrough - case reflect.Array: - var ss []string - subConf := conf - subConf.printType = v.Type().Elem().Kind() == reflect.Interface - for i := 0; i < v.Len(); i++ { - s := formatAny(v.Index(i), subConf, visited) - ss = append(ss, s) - } - s := fmt.Sprintf("{%s}", strings.Join(ss, ", ")) - if conf.printType { - return v.Type().String() + s - } - return s - case reflect.Map: - if v.IsNil() { - if conf.printType { - return fmt.Sprintf("%v(nil)", v.Type()) - } - return "" - } - if visited[v.Pointer()] { - return formatPointer(v, conf) - } - visited = insertPointer(visited, v.Pointer()) - - var ss []string - keyConf, valConf := conf, conf - keyConf.printType = v.Type().Key().Kind() == reflect.Interface - keyConf.followPointers = false - valConf.printType = v.Type().Elem().Kind() == reflect.Interface - for _, k := range SortKeys(v.MapKeys()) { - sk := formatAny(k, keyConf, visited) - sv := formatAny(v.MapIndex(k), valConf, visited) - ss = append(ss, fmt.Sprintf("%s: %s", sk, sv)) - } - s := fmt.Sprintf("{%s}", strings.Join(ss, ", ")) - if conf.printType { - return v.Type().String() + s - } - return s - case reflect.Struct: - var ss []string - subConf := conf - subConf.printType = true - for i := 0; i < v.NumField(); i++ { - vv := v.Field(i) - if isZero(vv) { - continue // Elide zero value fields - } - name := v.Type().Field(i).Name - subConf.UseStringer = conf.UseStringer - s := formatAny(vv, subConf, visited) - ss = append(ss, fmt.Sprintf("%s: %s", name, s)) - } - s := fmt.Sprintf("{%s}", strings.Join(ss, ", ")) - if conf.printType { - return v.Type().String() + s - } - return s - default: - panic(fmt.Sprintf("%v kind not handled", v.Kind())) - } -} - -func formatString(s string) string { - // Use quoted string if it the same length as a raw string literal. - // Otherwise, attempt to use the raw string form. - qs := strconv.Quote(s) - if len(qs) == 1+len(s)+1 { - return qs - } - - // Disallow newlines to ensure output is a single line. - // Only allow printable runes for readability purposes. - rawInvalid := func(r rune) bool { - return r == '`' || r == '\n' || !unicode.IsPrint(r) - } - if strings.IndexFunc(s, rawInvalid) < 0 { - return "`" + s + "`" - } - return qs -} - -func formatPrimitive(t reflect.Type, v interface{}, conf FormatConfig) string { - if conf.printType && (conf.PrintPrimitiveType || t.PkgPath() != "") { - return fmt.Sprintf("%v(%v)", t, v) - } - return fmt.Sprintf("%v", v) -} - -func formatPointer(v reflect.Value, conf FormatConfig) string { - p := v.Pointer() - if !conf.realPointers { - p = 0 // For deterministic printing purposes - } - s := formatHex(uint64(p)) - if conf.printType { - return fmt.Sprintf("(%v)(%s)", v.Type(), s) - } - return s -} - -func formatHex(u uint64) string { - var f string - switch { - case u <= 0xff: - f = "0x%02x" - case u <= 0xffff: - f = "0x%04x" - case u <= 0xffffff: - f = "0x%06x" - case u <= 0xffffffff: - f = "0x%08x" - case u <= 0xffffffffff: - f = "0x%010x" - case u <= 0xffffffffffff: - f = "0x%012x" - case u <= 0xffffffffffffff: - f = "0x%014x" - case u <= 0xffffffffffffffff: - f = "0x%016x" - } - return fmt.Sprintf(f, u) -} - -// insertPointer insert p into m, allocating m if necessary. -func insertPointer(m map[uintptr]bool, p uintptr) map[uintptr]bool { - if m == nil { - m = make(map[uintptr]bool) - } - m[p] = true - return m -} - -// isZero reports whether v is the zero value. -// This does not rely on Interface and so can be used on unexported fields. -func isZero(v reflect.Value) bool { - switch v.Kind() { - case reflect.Bool: - return v.Bool() == false - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - return v.Int() == 0 - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: - return v.Uint() == 0 - case reflect.Float32, reflect.Float64: - return v.Float() == 0 - case reflect.Complex64, reflect.Complex128: - return v.Complex() == 0 - case reflect.String: - return v.String() == "" - case reflect.UnsafePointer: - return v.Pointer() == 0 - case reflect.Chan, reflect.Func, reflect.Interface, reflect.Ptr, reflect.Map, reflect.Slice: - return v.IsNil() - case reflect.Array: - for i := 0; i < v.Len(); i++ { - if !isZero(v.Index(i)) { - return false - } - } - return true - case reflect.Struct: - for i := 0; i < v.NumField(); i++ { - if !isZero(v.Field(i)) { - return false - } - } - return true - } - return false -} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_purego.go b/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_purego.go new file mode 100644 index 0000000000..0a01c4796f --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_purego.go @@ -0,0 +1,23 @@ +// Copyright 2018, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +// +build purego + +package value + +import "reflect" + +// Pointer is an opaque typed pointer and is guaranteed to be comparable. +type Pointer struct { + p uintptr + t reflect.Type +} + +// PointerOf returns a Pointer from v, which must be a +// reflect.Ptr, reflect.Slice, or reflect.Map. +func PointerOf(v reflect.Value) Pointer { + // NOTE: Storing a pointer as an uintptr is technically incorrect as it + // assumes that the GC implementation does not use a moving collector. + return Pointer{v.Pointer(), v.Type()} +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_unsafe.go b/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_unsafe.go new file mode 100644 index 0000000000..da134ae2a8 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/value/pointer_unsafe.go @@ -0,0 +1,26 @@ +// Copyright 2018, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +// +build !purego + +package value + +import ( + "reflect" + "unsafe" +) + +// Pointer is an opaque typed pointer and is guaranteed to be comparable. +type Pointer struct { + p unsafe.Pointer + t reflect.Type +} + +// PointerOf returns a Pointer from v, which must be a +// reflect.Ptr, reflect.Slice, or reflect.Map. +func PointerOf(v reflect.Value) Pointer { + // The proper representation of a pointer is unsafe.Pointer, + // which is necessary if the GC ever uses a moving collector. + return Pointer{unsafe.Pointer(v.Pointer()), v.Type()} +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/sort.go b/vendor/github.com/google/go-cmp/cmp/internal/value/sort.go index fe8aa27a07..938f646f00 100644 --- a/vendor/github.com/google/go-cmp/cmp/internal/value/sort.go +++ b/vendor/github.com/google/go-cmp/cmp/internal/value/sort.go @@ -19,7 +19,7 @@ func SortKeys(vs []reflect.Value) []reflect.Value { } // Sort the map keys. - sort.Sort(valueSorter(vs)) + sort.Slice(vs, func(i, j int) bool { return isLess(vs[i], vs[j]) }) // Deduplicate keys (fails for NaNs). vs2 := vs[:1] @@ -31,13 +31,6 @@ func SortKeys(vs []reflect.Value) []reflect.Value { return vs2 } -// TODO: Use sort.Slice once Google AppEngine is on Go1.8 or above. -type valueSorter []reflect.Value - -func (vs valueSorter) Len() int { return len(vs) } -func (vs valueSorter) Less(i, j int) bool { return isLess(vs[i], vs[j]) } -func (vs valueSorter) Swap(i, j int) { vs[i], vs[j] = vs[j], vs[i] } - // isLess is a generic function for sorting arbitrary map keys. // The inputs must be of the same type and must be comparable. func isLess(x, y reflect.Value) bool { diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/zero.go b/vendor/github.com/google/go-cmp/cmp/internal/value/zero.go new file mode 100644 index 0000000000..d13a12ccfc --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/value/zero.go @@ -0,0 +1,45 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package value + +import "reflect" + +// IsZero reports whether v is the zero value. +// This does not rely on Interface and so can be used on unexported fields. +func IsZero(v reflect.Value) bool { + switch v.Kind() { + case reflect.Bool: + return v.Bool() == false + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return v.Int() == 0 + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return v.Uint() == 0 + case reflect.Float32, reflect.Float64: + return v.Float() == 0 + case reflect.Complex64, reflect.Complex128: + return v.Complex() == 0 + case reflect.String: + return v.String() == "" + case reflect.UnsafePointer: + return v.Pointer() == 0 + case reflect.Chan, reflect.Func, reflect.Interface, reflect.Ptr, reflect.Map, reflect.Slice: + return v.IsNil() + case reflect.Array: + for i := 0; i < v.Len(); i++ { + if !IsZero(v.Index(i)) { + return false + } + } + return true + case reflect.Struct: + for i := 0; i < v.NumField(); i++ { + if !IsZero(v.Field(i)) { + return false + } + } + return true + } + return false +} diff --git a/vendor/github.com/google/go-cmp/cmp/options.go b/vendor/github.com/google/go-cmp/cmp/options.go index 91d4b066e0..793448160e 100644 --- a/vendor/github.com/google/go-cmp/cmp/options.go +++ b/vendor/github.com/google/go-cmp/cmp/options.go @@ -7,7 +7,7 @@ package cmp import ( "fmt" "reflect" - "runtime" + "regexp" "strings" "github.com/google/go-cmp/cmp/internal/function" @@ -29,11 +29,11 @@ type Option interface { // An Options is returned only if multiple comparers or transformers // can apply simultaneously and will only contain values of those types // or sub-Options containing values of those types. - filter(s *state, vx, vy reflect.Value, t reflect.Type) applicableOption + filter(s *state, t reflect.Type, vx, vy reflect.Value) applicableOption } // applicableOption represents the following types: -// Fundamental: ignore | invalid | *comparer | *transformer +// Fundamental: ignore | validator | *comparer | *transformer // Grouping: Options type applicableOption interface { Option @@ -43,7 +43,7 @@ type applicableOption interface { } // coreOption represents the following types: -// Fundamental: ignore | invalid | *comparer | *transformer +// Fundamental: ignore | validator | *comparer | *transformer // Filters: *pathFilter | *valuesFilter type coreOption interface { Option @@ -63,19 +63,19 @@ func (core) isCore() {} // on all individual options held within. type Options []Option -func (opts Options) filter(s *state, vx, vy reflect.Value, t reflect.Type) (out applicableOption) { +func (opts Options) filter(s *state, t reflect.Type, vx, vy reflect.Value) (out applicableOption) { for _, opt := range opts { - switch opt := opt.filter(s, vx, vy, t); opt.(type) { + switch opt := opt.filter(s, t, vx, vy); opt.(type) { case ignore: return ignore{} // Only ignore can short-circuit evaluation - case invalid: - out = invalid{} // Takes precedence over comparer or transformer + case validator: + out = validator{} // Takes precedence over comparer or transformer case *comparer, *transformer, Options: switch out.(type) { case nil: out = opt - case invalid: - // Keep invalid + case validator: + // Keep validator case *comparer, *transformer, Options: out = Options{out, opt} // Conflicting comparers or transformers } @@ -106,6 +106,11 @@ func (opts Options) String() string { // FilterPath returns a new Option where opt is only evaluated if filter f // returns true for the current Path in the value tree. // +// This filter is called even if a slice element or map entry is missing and +// provides an opportunity to ignore such cases. The filter function must be +// symmetric such that the filter result is identical regardless of whether the +// missing value is from x or y. +// // The option passed in may be an Ignore, Transformer, Comparer, Options, or // a previously filtered Option. func FilterPath(f func(Path) bool, opt Option) Option { @@ -124,22 +129,22 @@ type pathFilter struct { opt Option } -func (f pathFilter) filter(s *state, vx, vy reflect.Value, t reflect.Type) applicableOption { +func (f pathFilter) filter(s *state, t reflect.Type, vx, vy reflect.Value) applicableOption { if f.fnc(s.curPath) { - return f.opt.filter(s, vx, vy, t) + return f.opt.filter(s, t, vx, vy) } return nil } func (f pathFilter) String() string { - fn := getFuncName(reflect.ValueOf(f.fnc).Pointer()) - return fmt.Sprintf("FilterPath(%s, %v)", fn, f.opt) + return fmt.Sprintf("FilterPath(%s, %v)", function.NameOf(reflect.ValueOf(f.fnc)), f.opt) } // FilterValues returns a new Option where opt is only evaluated if filter f, // which is a function of the form "func(T, T) bool", returns true for the -// current pair of values being compared. If the type of the values is not -// assignable to T, then this filter implicitly returns false. +// current pair of values being compared. If either value is invalid or +// the type of the values is not assignable to T, then this filter implicitly +// returns false. // // The filter function must be // symmetric (i.e., agnostic to the order of the inputs) and @@ -171,19 +176,18 @@ type valuesFilter struct { opt Option } -func (f valuesFilter) filter(s *state, vx, vy reflect.Value, t reflect.Type) applicableOption { - if !vx.IsValid() || !vy.IsValid() { - return invalid{} +func (f valuesFilter) filter(s *state, t reflect.Type, vx, vy reflect.Value) applicableOption { + if !vx.IsValid() || !vx.CanInterface() || !vy.IsValid() || !vy.CanInterface() { + return nil } if (f.typ == nil || t.AssignableTo(f.typ)) && s.callTTBFunc(f.fnc, vx, vy) { - return f.opt.filter(s, vx, vy, t) + return f.opt.filter(s, t, vx, vy) } return nil } func (f valuesFilter) String() string { - fn := getFuncName(f.fnc.Pointer()) - return fmt.Sprintf("FilterValues(%s, %v)", fn, f.opt) + return fmt.Sprintf("FilterValues(%s, %v)", function.NameOf(f.fnc), f.opt) } // Ignore is an Option that causes all comparisons to be ignored. @@ -194,20 +198,45 @@ func Ignore() Option { return ignore{} } type ignore struct{ core } func (ignore) isFiltered() bool { return false } -func (ignore) filter(_ *state, _, _ reflect.Value, _ reflect.Type) applicableOption { return ignore{} } -func (ignore) apply(_ *state, _, _ reflect.Value) { return } +func (ignore) filter(_ *state, _ reflect.Type, _, _ reflect.Value) applicableOption { return ignore{} } +func (ignore) apply(s *state, _, _ reflect.Value) { s.report(true, reportByIgnore) } func (ignore) String() string { return "Ignore()" } -// invalid is a sentinel Option type to indicate that some options could not -// be evaluated due to unexported fields. -type invalid struct{ core } +// validator is a sentinel Option type to indicate that some options could not +// be evaluated due to unexported fields, missing slice elements, or +// missing map entries. Both values are validator only for unexported fields. +type validator struct{ core } + +func (validator) filter(_ *state, _ reflect.Type, vx, vy reflect.Value) applicableOption { + if !vx.IsValid() || !vy.IsValid() { + return validator{} + } + if !vx.CanInterface() || !vy.CanInterface() { + return validator{} + } + return nil +} +func (validator) apply(s *state, vx, vy reflect.Value) { + // Implies missing slice element or map entry. + if !vx.IsValid() || !vy.IsValid() { + s.report(vx.IsValid() == vy.IsValid(), 0) + return + } + + // Unable to Interface implies unexported field without visibility access. + if !vx.CanInterface() || !vy.CanInterface() { + const help = "consider using a custom Comparer; if you control the implementation of type, you can also consider AllowUnexported or cmpopts.IgnoreUnexported" + panic(fmt.Sprintf("cannot handle unexported field: %#v\n%s", s.curPath, help)) + } -func (invalid) filter(_ *state, _, _ reflect.Value, _ reflect.Type) applicableOption { return invalid{} } -func (invalid) apply(s *state, _, _ reflect.Value) { - const help = "consider using AllowUnexported or cmpopts.IgnoreUnexported" - panic(fmt.Sprintf("cannot handle unexported field: %#v\n%s", s.curPath, help)) + panic("not reachable") } +// identRx represents a valid identifier according to the Go specification. +const identRx = `[_\p{L}][_\p{L}\p{N}]*` + +var identsRx = regexp.MustCompile(`^` + identRx + `(\.` + identRx + `)*$`) + // Transformer returns an Option that applies a transformation function that // converts values of a certain type into that of another. // @@ -220,18 +249,25 @@ func (invalid) apply(s *state, _, _ reflect.Value) { // input and output types are the same), an implicit filter is added such that // a transformer is applicable only if that exact transformer is not already // in the tail of the Path since the last non-Transform step. +// For situations where the implicit filter is still insufficient, +// consider using cmpopts.AcyclicTransformer, which adds a filter +// to prevent the transformer from being recursively applied upon itself. // // The name is a user provided label that is used as the Transform.Name in the -// transformation PathStep. If empty, an arbitrary name is used. +// transformation PathStep (and eventually shown in the Diff output). +// The name must be a valid identifier or qualified identifier in Go syntax. +// If empty, an arbitrary name is used. func Transformer(name string, f interface{}) Option { v := reflect.ValueOf(f) if !function.IsType(v.Type(), function.Transformer) || v.IsNil() { panic(fmt.Sprintf("invalid transformer function: %T", f)) } if name == "" { - name = "λ" // Lambda-symbol as place-holder for anonymous transformer - } - if !isValid(name) { + name = function.NameOf(v) + if !identsRx.MatchString(name) { + name = "λ" // Lambda-symbol as placeholder name + } + } else if !identsRx.MatchString(name) { panic(fmt.Sprintf("invalid name: %q", name)) } tr := &transformer{name: name, fnc: reflect.ValueOf(f)} @@ -250,9 +286,9 @@ type transformer struct { func (tr *transformer) isFiltered() bool { return tr.typ != nil } -func (tr *transformer) filter(s *state, _, _ reflect.Value, t reflect.Type) applicableOption { +func (tr *transformer) filter(s *state, t reflect.Type, _, _ reflect.Value) applicableOption { for i := len(s.curPath) - 1; i >= 0; i-- { - if t, ok := s.curPath[i].(*transform); !ok { + if t, ok := s.curPath[i].(Transform); !ok { break // Hit most recent non-Transform step } else if tr == t.trans { return nil // Cannot directly use same Transform @@ -265,18 +301,15 @@ func (tr *transformer) filter(s *state, _, _ reflect.Value, t reflect.Type) appl } func (tr *transformer) apply(s *state, vx, vy reflect.Value) { - // Update path before calling the Transformer so that dynamic checks - // will use the updated path. - s.curPath.push(&transform{pathStep{tr.fnc.Type().Out(0)}, tr}) - defer s.curPath.pop() - - vx = s.callTRFunc(tr.fnc, vx) - vy = s.callTRFunc(tr.fnc, vy) - s.compareAny(vx, vy) + step := Transform{&transform{pathStep{typ: tr.fnc.Type().Out(0)}, tr}} + vvx := s.callTRFunc(tr.fnc, vx, step) + vvy := s.callTRFunc(tr.fnc, vy, step) + step.vx, step.vy = vvx, vvy + s.compareAny(step) } func (tr transformer) String() string { - return fmt.Sprintf("Transformer(%s, %s)", tr.name, getFuncName(tr.fnc.Pointer())) + return fmt.Sprintf("Transformer(%s, %s)", tr.name, function.NameOf(tr.fnc)) } // Comparer returns an Option that determines whether two values are equal @@ -311,7 +344,7 @@ type comparer struct { func (cm *comparer) isFiltered() bool { return cm.typ != nil } -func (cm *comparer) filter(_ *state, _, _ reflect.Value, t reflect.Type) applicableOption { +func (cm *comparer) filter(_ *state, t reflect.Type, _, _ reflect.Value) applicableOption { if cm.typ == nil || t.AssignableTo(cm.typ) { return cm } @@ -320,11 +353,11 @@ func (cm *comparer) filter(_ *state, _, _ reflect.Value, t reflect.Type) applica func (cm *comparer) apply(s *state, vx, vy reflect.Value) { eq := s.callTTBFunc(cm.fnc, vx, vy) - s.report(eq, vx, vy) + s.report(eq, reportByFunc) } func (cm comparer) String() string { - return fmt.Sprintf("Comparer(%s)", getFuncName(cm.fnc.Pointer())) + return fmt.Sprintf("Comparer(%s)", function.NameOf(cm.fnc)) } // AllowUnexported returns an Option that forcibly allows operations on @@ -338,7 +371,7 @@ func (cm comparer) String() string { // defined in an internal package where the semantic meaning of an unexported // field is in the control of the user. // -// For some cases, a custom Comparer should be used instead that defines +// In many cases, a custom Comparer should be used instead that defines // equality as a function of the public API of a type rather than the underlying // unexported implementation. // @@ -370,27 +403,92 @@ func AllowUnexported(types ...interface{}) Option { type visibleStructs map[reflect.Type]bool -func (visibleStructs) filter(_ *state, _, _ reflect.Value, _ reflect.Type) applicableOption { +func (visibleStructs) filter(_ *state, _ reflect.Type, _, _ reflect.Value) applicableOption { panic("not implemented") } -// reporter is an Option that configures how differences are reported. -type reporter interface { - // TODO: Not exported yet. +// Result represents the comparison result for a single node and +// is provided by cmp when calling Result (see Reporter). +type Result struct { + _ [0]func() // Make Result incomparable + flags resultFlags +} + +// Equal reports whether the node was determined to be equal or not. +// As a special case, ignored nodes are considered equal. +func (r Result) Equal() bool { + return r.flags&(reportEqual|reportByIgnore) != 0 +} + +// ByIgnore reports whether the node is equal because it was ignored. +// This never reports true if Equal reports false. +func (r Result) ByIgnore() bool { + return r.flags&reportByIgnore != 0 +} + +// ByMethod reports whether the Equal method determined equality. +func (r Result) ByMethod() bool { + return r.flags&reportByMethod != 0 +} + +// ByFunc reports whether a Comparer function determined equality. +func (r Result) ByFunc() bool { + return r.flags&reportByFunc != 0 +} + +type resultFlags uint + +const ( + _ resultFlags = (1 << iota) / 2 + + reportEqual + reportUnequal + reportByIgnore + reportByMethod + reportByFunc +) + +// Reporter is an Option that can be passed to Equal. When Equal traverses +// the value trees, it calls PushStep as it descends into each node in the +// tree and PopStep as it ascend out of the node. The leaves of the tree are +// either compared (determined to be equal or not equal) or ignored and reported +// as such by calling the Report method. +func Reporter(r interface { + // PushStep is called when a tree-traversal operation is performed. + // The PathStep itself is only valid until the step is popped. + // The PathStep.Values are valid for the duration of the entire traversal + // and must not be mutated. + // + // Equal always calls PushStep at the start to provide an operation-less + // PathStep used to report the root values. // - // Perhaps add PushStep and PopStep and change Report to only accept - // a PathStep instead of the full-path? Adding a PushStep and PopStep makes - // it clear that we are traversing the value tree in a depth-first-search - // manner, which has an effect on how values are printed. + // Within a slice, the exact set of inserted, removed, or modified elements + // is unspecified and may change in future implementations. + // The entries of a map are iterated through in an unspecified order. + PushStep(PathStep) + + // Report is called exactly once on leaf nodes to report whether the + // comparison identified the node as equal, unequal, or ignored. + // A leaf node is one that is immediately preceded by and followed by + // a pair of PushStep and PopStep calls. + Report(Result) + + // PopStep ascends back up the value tree. + // There is always a matching pop call for every push call. + PopStep() +}) Option { + return reporter{r} +} - Option +type reporter struct{ reporterIface } +type reporterIface interface { + PushStep(PathStep) + Report(Result) + PopStep() +} - // Report is called for every comparison made and will be provided with - // the two values being compared, the equality result, and the - // current path in the value tree. It is possible for x or y to be an - // invalid reflect.Value if one of the values is non-existent; - // which is possible with maps and slices. - Report(x, y reflect.Value, eq bool, p Path) +func (reporter) filter(_ *state, _ reflect.Type, _, _ reflect.Value) applicableOption { + panic("not implemented") } // normalizeOption normalizes the input options such that all Options groups @@ -424,30 +522,3 @@ func flattenOptions(dst, src Options) Options { } return dst } - -// getFuncName returns a short function name from the pointer. -// The string parsing logic works up until Go1.9. -func getFuncName(p uintptr) string { - fnc := runtime.FuncForPC(p) - if fnc == nil { - return "" - } - name := fnc.Name() // E.g., "long/path/name/mypkg.(mytype).(long/path/name/mypkg.myfunc)-fm" - if strings.HasSuffix(name, ")-fm") || strings.HasSuffix(name, ")·fm") { - // Strip the package name from method name. - name = strings.TrimSuffix(name, ")-fm") - name = strings.TrimSuffix(name, ")·fm") - if i := strings.LastIndexByte(name, '('); i >= 0 { - methodName := name[i+1:] // E.g., "long/path/name/mypkg.myfunc" - if j := strings.LastIndexByte(methodName, '.'); j >= 0 { - methodName = methodName[j+1:] // E.g., "myfunc" - } - name = name[:i] + methodName // E.g., "long/path/name/mypkg.(mytype)." + "myfunc" - } - } - if i := strings.LastIndexByte(name, '/'); i >= 0 { - // Strip the package name. - name = name[i+1:] // E.g., "mypkg.(mytype).myfunc" - } - return name -} diff --git a/vendor/github.com/google/go-cmp/cmp/path.go b/vendor/github.com/google/go-cmp/cmp/path.go index c08a3cf80d..96fffd291f 100644 --- a/vendor/github.com/google/go-cmp/cmp/path.go +++ b/vendor/github.com/google/go-cmp/cmp/path.go @@ -12,80 +12,52 @@ import ( "unicode/utf8" ) -type ( - // Path is a list of PathSteps describing the sequence of operations to get - // from some root type to the current position in the value tree. - // The first Path element is always an operation-less PathStep that exists - // simply to identify the initial type. - // - // When traversing structs with embedded structs, the embedded struct will - // always be accessed as a field before traversing the fields of the - // embedded struct themselves. That is, an exported field from the - // embedded struct will never be accessed directly from the parent struct. - Path []PathStep - - // PathStep is a union-type for specific operations to traverse - // a value's tree structure. Users of this package never need to implement - // these types as values of this type will be returned by this package. - PathStep interface { - String() string - Type() reflect.Type // Resulting type after performing the path step - isPathStep() - } +// Path is a list of PathSteps describing the sequence of operations to get +// from some root type to the current position in the value tree. +// The first Path element is always an operation-less PathStep that exists +// simply to identify the initial type. +// +// When traversing structs with embedded structs, the embedded struct will +// always be accessed as a field before traversing the fields of the +// embedded struct themselves. That is, an exported field from the +// embedded struct will never be accessed directly from the parent struct. +type Path []PathStep - // SliceIndex is an index operation on a slice or array at some index Key. - SliceIndex interface { - PathStep - Key() int // May return -1 if in a split state - - // SplitKeys returns the indexes for indexing into slices in the - // x and y values, respectively. These indexes may differ due to the - // insertion or removal of an element in one of the slices, causing - // all of the indexes to be shifted. If an index is -1, then that - // indicates that the element does not exist in the associated slice. - // - // Key is guaranteed to return -1 if and only if the indexes returned - // by SplitKeys are not the same. SplitKeys will never return -1 for - // both indexes. - SplitKeys() (x int, y int) - - isSliceIndex() - } - // MapIndex is an index operation on a map at some index Key. - MapIndex interface { - PathStep - Key() reflect.Value - isMapIndex() - } - // TypeAssertion represents a type assertion on an interface. - TypeAssertion interface { - PathStep - isTypeAssertion() - } - // StructField represents a struct field access on a field called Name. - StructField interface { - PathStep - Name() string - Index() int - isStructField() - } - // Indirect represents pointer indirection on the parent type. - Indirect interface { - PathStep - isIndirect() - } - // Transform is a transformation from the parent type to the current type. - Transform interface { - PathStep - Name() string - Func() reflect.Value +// PathStep is a union-type for specific operations to traverse +// a value's tree structure. Users of this package never need to implement +// these types as values of this type will be returned by this package. +// +// Implementations of this interface are +// StructField, SliceIndex, MapIndex, Indirect, TypeAssertion, and Transform. +type PathStep interface { + String() string - // Option returns the originally constructed Transformer option. - // The == operator can be used to detect the exact option used. - Option() Option + // Type is the resulting type after performing the path step. + Type() reflect.Type - isTransform() - } + // Values is the resulting values after performing the path step. + // The type of each valid value is guaranteed to be identical to Type. + // + // In some cases, one or both may be invalid or have restrictions: + // • For StructField, both are not interface-able if the current field + // is unexported and the struct type is not explicitly permitted by + // AllowUnexported to traverse unexported fields. + // • For SliceIndex, one may be invalid if an element is missing from + // either the x or y slice. + // • For MapIndex, one may be invalid if an entry is missing from + // either the x or y map. + // + // The provided values must not be mutated. + Values() (vx, vy reflect.Value) +} + +var ( + _ PathStep = StructField{} + _ PathStep = SliceIndex{} + _ PathStep = MapIndex{} + _ PathStep = Indirect{} + _ PathStep = TypeAssertion{} + _ PathStep = Transform{} ) func (pa *Path) push(s PathStep) { @@ -124,7 +96,7 @@ func (pa Path) Index(i int) PathStep { func (pa Path) String() string { var ss []string for _, s := range pa { - if _, ok := s.(*structField); ok { + if _, ok := s.(StructField); ok { ss = append(ss, s.String()) } } @@ -144,13 +116,13 @@ func (pa Path) GoString() string { nextStep = pa[i+1] } switch s := s.(type) { - case *indirect: + case Indirect: numIndirect++ pPre, pPost := "(", ")" switch nextStep.(type) { - case *indirect: + case Indirect: continue // Next step is indirection, so let them batch up - case *structField: + case StructField: numIndirect-- // Automatic indirection on struct fields case nil: pPre, pPost = "", "" // Last step; no need for parenthesis @@ -161,19 +133,10 @@ func (pa Path) GoString() string { } numIndirect = 0 continue - case *transform: + case Transform: ssPre = append(ssPre, s.trans.name+"(") ssPost = append(ssPost, ")") continue - case *typeAssertion: - // As a special-case, elide type assertions on anonymous types - // since they are typically generated dynamically and can be very - // verbose. For example, some transforms return interface{} because - // of Go's lack of generics, but typically take in and return the - // exact same concrete type. - if s.Type().PkgPath() == "" { - continue - } } ssPost = append(ssPost, s.String()) } @@ -183,44 +146,13 @@ func (pa Path) GoString() string { return strings.Join(ssPre, "") + strings.Join(ssPost, "") } -type ( - pathStep struct { - typ reflect.Type - } - - sliceIndex struct { - pathStep - xkey, ykey int - } - mapIndex struct { - pathStep - key reflect.Value - } - typeAssertion struct { - pathStep - } - structField struct { - pathStep - name string - idx int - - // These fields are used for forcibly accessing an unexported field. - // pvx, pvy, and field are only valid if unexported is true. - unexported bool - force bool // Forcibly allow visibility - pvx, pvy reflect.Value // Parent values - field reflect.StructField // Field information - } - indirect struct { - pathStep - } - transform struct { - pathStep - trans *transformer - } -) +type pathStep struct { + typ reflect.Type + vx, vy reflect.Value +} -func (ps pathStep) Type() reflect.Type { return ps.typ } +func (ps pathStep) Type() reflect.Type { return ps.typ } +func (ps pathStep) Values() (vx, vy reflect.Value) { return ps.vx, ps.vy } func (ps pathStep) String() string { if ps.typ == nil { return "" @@ -232,7 +164,54 @@ func (ps pathStep) String() string { return fmt.Sprintf("{%s}", s) } -func (si sliceIndex) String() string { +// StructField represents a struct field access on a field called Name. +type StructField struct{ *structField } +type structField struct { + pathStep + name string + idx int + + // These fields are used for forcibly accessing an unexported field. + // pvx, pvy, and field are only valid if unexported is true. + unexported bool + mayForce bool // Forcibly allow visibility + pvx, pvy reflect.Value // Parent values + field reflect.StructField // Field information +} + +func (sf StructField) Type() reflect.Type { return sf.typ } +func (sf StructField) Values() (vx, vy reflect.Value) { + if !sf.unexported { + return sf.vx, sf.vy // CanInterface reports true + } + + // Forcibly obtain read-write access to an unexported struct field. + if sf.mayForce { + vx = retrieveUnexportedField(sf.pvx, sf.field) + vy = retrieveUnexportedField(sf.pvy, sf.field) + return vx, vy // CanInterface reports true + } + return sf.vx, sf.vy // CanInterface reports false +} +func (sf StructField) String() string { return fmt.Sprintf(".%s", sf.name) } + +// Name is the field name. +func (sf StructField) Name() string { return sf.name } + +// Index is the index of the field in the parent struct type. +// See reflect.Type.Field. +func (sf StructField) Index() int { return sf.idx } + +// SliceIndex is an index operation on a slice or array at some index Key. +type SliceIndex struct{ *sliceIndex } +type sliceIndex struct { + pathStep + xkey, ykey int +} + +func (si SliceIndex) Type() reflect.Type { return si.typ } +func (si SliceIndex) Values() (vx, vy reflect.Value) { return si.vx, si.vy } +func (si SliceIndex) String() string { switch { case si.xkey == si.ykey: return fmt.Sprintf("[%d]", si.xkey) @@ -247,63 +226,83 @@ func (si sliceIndex) String() string { return fmt.Sprintf("[%d->%d]", si.xkey, si.ykey) } } -func (mi mapIndex) String() string { return fmt.Sprintf("[%#v]", mi.key) } -func (ta typeAssertion) String() string { return fmt.Sprintf(".(%v)", ta.typ) } -func (sf structField) String() string { return fmt.Sprintf(".%s", sf.name) } -func (in indirect) String() string { return "*" } -func (tf transform) String() string { return fmt.Sprintf("%s()", tf.trans.name) } -func (si sliceIndex) Key() int { +// Key is the index key; it may return -1 if in a split state +func (si SliceIndex) Key() int { if si.xkey != si.ykey { return -1 } return si.xkey } -func (si sliceIndex) SplitKeys() (x, y int) { return si.xkey, si.ykey } -func (mi mapIndex) Key() reflect.Value { return mi.key } -func (sf structField) Name() string { return sf.name } -func (sf structField) Index() int { return sf.idx } -func (tf transform) Name() string { return tf.trans.name } -func (tf transform) Func() reflect.Value { return tf.trans.fnc } -func (tf transform) Option() Option { return tf.trans } - -func (pathStep) isPathStep() {} -func (sliceIndex) isSliceIndex() {} -func (mapIndex) isMapIndex() {} -func (typeAssertion) isTypeAssertion() {} -func (structField) isStructField() {} -func (indirect) isIndirect() {} -func (transform) isTransform() {} -var ( - _ SliceIndex = sliceIndex{} - _ MapIndex = mapIndex{} - _ TypeAssertion = typeAssertion{} - _ StructField = structField{} - _ Indirect = indirect{} - _ Transform = transform{} - - _ PathStep = sliceIndex{} - _ PathStep = mapIndex{} - _ PathStep = typeAssertion{} - _ PathStep = structField{} - _ PathStep = indirect{} - _ PathStep = transform{} -) +// SplitKeys are the indexes for indexing into slices in the +// x and y values, respectively. These indexes may differ due to the +// insertion or removal of an element in one of the slices, causing +// all of the indexes to be shifted. If an index is -1, then that +// indicates that the element does not exist in the associated slice. +// +// Key is guaranteed to return -1 if and only if the indexes returned +// by SplitKeys are not the same. SplitKeys will never return -1 for +// both indexes. +func (si SliceIndex) SplitKeys() (ix, iy int) { return si.xkey, si.ykey } + +// MapIndex is an index operation on a map at some index Key. +type MapIndex struct{ *mapIndex } +type mapIndex struct { + pathStep + key reflect.Value +} + +func (mi MapIndex) Type() reflect.Type { return mi.typ } +func (mi MapIndex) Values() (vx, vy reflect.Value) { return mi.vx, mi.vy } +func (mi MapIndex) String() string { return fmt.Sprintf("[%#v]", mi.key) } + +// Key is the value of the map key. +func (mi MapIndex) Key() reflect.Value { return mi.key } + +// Indirect represents pointer indirection on the parent type. +type Indirect struct{ *indirect } +type indirect struct { + pathStep +} + +func (in Indirect) Type() reflect.Type { return in.typ } +func (in Indirect) Values() (vx, vy reflect.Value) { return in.vx, in.vy } +func (in Indirect) String() string { return "*" } + +// TypeAssertion represents a type assertion on an interface. +type TypeAssertion struct{ *typeAssertion } +type typeAssertion struct { + pathStep +} + +func (ta TypeAssertion) Type() reflect.Type { return ta.typ } +func (ta TypeAssertion) Values() (vx, vy reflect.Value) { return ta.vx, ta.vy } +func (ta TypeAssertion) String() string { return fmt.Sprintf(".(%v)", ta.typ) } + +// Transform is a transformation from the parent type to the current type. +type Transform struct{ *transform } +type transform struct { + pathStep + trans *transformer +} + +func (tf Transform) Type() reflect.Type { return tf.typ } +func (tf Transform) Values() (vx, vy reflect.Value) { return tf.vx, tf.vy } +func (tf Transform) String() string { return fmt.Sprintf("%s()", tf.trans.name) } + +// Name is the name of the Transformer. +func (tf Transform) Name() string { return tf.trans.name } + +// Func is the function pointer to the transformer function. +func (tf Transform) Func() reflect.Value { return tf.trans.fnc } + +// Option returns the originally constructed Transformer option. +// The == operator can be used to detect the exact option used. +func (tf Transform) Option() Option { return tf.trans } // isExported reports whether the identifier is exported. func isExported(id string) bool { r, _ := utf8.DecodeRuneInString(id) return unicode.IsUpper(r) } - -// isValid reports whether the identifier is valid. -// Empty and underscore-only strings are not valid. -func isValid(id string) bool { - ok := id != "" && id != "_" - for j, c := range id { - ok = ok && (j > 0 || !unicode.IsDigit(c)) - ok = ok && (c == '_' || unicode.IsLetter(c) || unicode.IsDigit(c)) - } - return ok -} diff --git a/vendor/github.com/google/go-cmp/cmp/report.go b/vendor/github.com/google/go-cmp/cmp/report.go new file mode 100644 index 0000000000..6ddf29993e --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report.go @@ -0,0 +1,51 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package cmp + +// defaultReporter implements the reporter interface. +// +// As Equal serially calls the PushStep, Report, and PopStep methods, the +// defaultReporter constructs a tree-based representation of the compared value +// and the result of each comparison (see valueNode). +// +// When the String method is called, the FormatDiff method transforms the +// valueNode tree into a textNode tree, which is a tree-based representation +// of the textual output (see textNode). +// +// Lastly, the textNode.String method produces the final report as a string. +type defaultReporter struct { + root *valueNode + curr *valueNode +} + +func (r *defaultReporter) PushStep(ps PathStep) { + r.curr = r.curr.PushStep(ps) + if r.root == nil { + r.root = r.curr + } +} +func (r *defaultReporter) Report(rs Result) { + r.curr.Report(rs) +} +func (r *defaultReporter) PopStep() { + r.curr = r.curr.PopStep() +} + +// String provides a full report of the differences detected as a structured +// literal in pseudo-Go syntax. String may only be called after the entire tree +// has been traversed. +func (r *defaultReporter) String() string { + assert(r.root != nil && r.curr == nil) + if r.root.NumDiff == 0 { + return "" + } + return formatOptions{}.FormatDiff(r.root).String() +} + +func assert(ok bool) { + if !ok { + panic("assertion failure") + } +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_compare.go b/vendor/github.com/google/go-cmp/cmp/report_compare.go new file mode 100644 index 0000000000..05efb992c5 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_compare.go @@ -0,0 +1,296 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package cmp + +import ( + "fmt" + "reflect" + + "github.com/google/go-cmp/cmp/internal/value" +) + +// TODO: Enforce limits? +// * Enforce maximum number of records to print per node? +// * Enforce maximum size in bytes allowed? +// * As a heuristic, use less verbosity for equal nodes than unequal nodes. +// TODO: Enforce unique outputs? +// * Avoid Stringer methods if it results in same output? +// * Print pointer address if outputs still equal? + +// numContextRecords is the number of surrounding equal records to print. +const numContextRecords = 2 + +type diffMode byte + +const ( + diffUnknown diffMode = 0 + diffIdentical diffMode = ' ' + diffRemoved diffMode = '-' + diffInserted diffMode = '+' +) + +type typeMode int + +const ( + // emitType always prints the type. + emitType typeMode = iota + // elideType never prints the type. + elideType + // autoType prints the type only for composite kinds + // (i.e., structs, slices, arrays, and maps). + autoType +) + +type formatOptions struct { + // DiffMode controls the output mode of FormatDiff. + // + // If diffUnknown, then produce a diff of the x and y values. + // If diffIdentical, then emit values as if they were equal. + // If diffRemoved, then only emit x values (ignoring y values). + // If diffInserted, then only emit y values (ignoring x values). + DiffMode diffMode + + // TypeMode controls whether to print the type for the current node. + // + // As a general rule of thumb, we always print the type of the next node + // after an interface, and always elide the type of the next node after + // a slice or map node. + TypeMode typeMode + + // formatValueOptions are options specific to printing reflect.Values. + formatValueOptions +} + +func (opts formatOptions) WithDiffMode(d diffMode) formatOptions { + opts.DiffMode = d + return opts +} +func (opts formatOptions) WithTypeMode(t typeMode) formatOptions { + opts.TypeMode = t + return opts +} + +// FormatDiff converts a valueNode tree into a textNode tree, where the later +// is a textual representation of the differences detected in the former. +func (opts formatOptions) FormatDiff(v *valueNode) textNode { + // Check whether we have specialized formatting for this node. + // This is not necessary, but helpful for producing more readable outputs. + if opts.CanFormatDiffSlice(v) { + return opts.FormatDiffSlice(v) + } + + // For leaf nodes, format the value based on the reflect.Values alone. + if v.MaxDepth == 0 { + switch opts.DiffMode { + case diffUnknown, diffIdentical: + // Format Equal. + if v.NumDiff == 0 { + outx := opts.FormatValue(v.ValueX, visitedPointers{}) + outy := opts.FormatValue(v.ValueY, visitedPointers{}) + if v.NumIgnored > 0 && v.NumSame == 0 { + return textEllipsis + } else if outx.Len() < outy.Len() { + return outx + } else { + return outy + } + } + + // Format unequal. + assert(opts.DiffMode == diffUnknown) + var list textList + outx := opts.WithTypeMode(elideType).FormatValue(v.ValueX, visitedPointers{}) + outy := opts.WithTypeMode(elideType).FormatValue(v.ValueY, visitedPointers{}) + if outx != nil { + list = append(list, textRecord{Diff: '-', Value: outx}) + } + if outy != nil { + list = append(list, textRecord{Diff: '+', Value: outy}) + } + return opts.WithTypeMode(emitType).FormatType(v.Type, list) + case diffRemoved: + return opts.FormatValue(v.ValueX, visitedPointers{}) + case diffInserted: + return opts.FormatValue(v.ValueY, visitedPointers{}) + default: + panic("invalid diff mode") + } + } + + // Descend into the child value node. + if v.TransformerName != "" { + out := opts.WithTypeMode(emitType).FormatDiff(v.Value) + out = textWrap{"Inverse(" + v.TransformerName + ", ", out, ")"} + return opts.FormatType(v.Type, out) + } else { + switch k := v.Type.Kind(); k { + case reflect.Struct, reflect.Array, reflect.Slice, reflect.Map: + return opts.FormatType(v.Type, opts.formatDiffList(v.Records, k)) + case reflect.Ptr: + return textWrap{"&", opts.FormatDiff(v.Value), ""} + case reflect.Interface: + return opts.WithTypeMode(emitType).FormatDiff(v.Value) + default: + panic(fmt.Sprintf("%v cannot have children", k)) + } + } +} + +func (opts formatOptions) formatDiffList(recs []reportRecord, k reflect.Kind) textNode { + // Derive record name based on the data structure kind. + var name string + var formatKey func(reflect.Value) string + switch k { + case reflect.Struct: + name = "field" + opts = opts.WithTypeMode(autoType) + formatKey = func(v reflect.Value) string { return v.String() } + case reflect.Slice, reflect.Array: + name = "element" + opts = opts.WithTypeMode(elideType) + formatKey = func(reflect.Value) string { return "" } + case reflect.Map: + name = "entry" + opts = opts.WithTypeMode(elideType) + formatKey = formatMapKey + } + + // Handle unification. + switch opts.DiffMode { + case diffIdentical, diffRemoved, diffInserted: + var list textList + var deferredEllipsis bool // Add final "..." to indicate records were dropped + for _, r := range recs { + // Elide struct fields that are zero value. + if k == reflect.Struct { + var isZero bool + switch opts.DiffMode { + case diffIdentical: + isZero = value.IsZero(r.Value.ValueX) || value.IsZero(r.Value.ValueX) + case diffRemoved: + isZero = value.IsZero(r.Value.ValueX) + case diffInserted: + isZero = value.IsZero(r.Value.ValueY) + } + if isZero { + continue + } + } + // Elide ignored nodes. + if r.Value.NumIgnored > 0 && r.Value.NumSame+r.Value.NumDiff == 0 { + deferredEllipsis = !(k == reflect.Slice || k == reflect.Array) + if !deferredEllipsis { + list.AppendEllipsis(diffStats{}) + } + continue + } + if out := opts.FormatDiff(r.Value); out != nil { + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + } + } + if deferredEllipsis { + list.AppendEllipsis(diffStats{}) + } + return textWrap{"{", list, "}"} + case diffUnknown: + default: + panic("invalid diff mode") + } + + // Handle differencing. + var list textList + groups := coalesceAdjacentRecords(name, recs) + for i, ds := range groups { + // Handle equal records. + if ds.NumDiff() == 0 { + // Compute the number of leading and trailing records to print. + var numLo, numHi int + numEqual := ds.NumIgnored + ds.NumIdentical + for numLo < numContextRecords && numLo+numHi < numEqual && i != 0 { + if r := recs[numLo].Value; r.NumIgnored > 0 && r.NumSame+r.NumDiff == 0 { + break + } + numLo++ + } + for numHi < numContextRecords && numLo+numHi < numEqual && i != len(groups)-1 { + if r := recs[numEqual-numHi-1].Value; r.NumIgnored > 0 && r.NumSame+r.NumDiff == 0 { + break + } + numHi++ + } + if numEqual-(numLo+numHi) == 1 && ds.NumIgnored == 0 { + numHi++ // Avoid pointless coalescing of a single equal record + } + + // Format the equal values. + for _, r := range recs[:numLo] { + out := opts.WithDiffMode(diffIdentical).FormatDiff(r.Value) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + } + if numEqual > numLo+numHi { + ds.NumIdentical -= numLo + numHi + list.AppendEllipsis(ds) + } + for _, r := range recs[numEqual-numHi : numEqual] { + out := opts.WithDiffMode(diffIdentical).FormatDiff(r.Value) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + } + recs = recs[numEqual:] + continue + } + + // Handle unequal records. + for _, r := range recs[:ds.NumDiff()] { + switch { + case opts.CanFormatDiffSlice(r.Value): + out := opts.FormatDiffSlice(r.Value) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + case r.Value.NumChildren == r.Value.MaxDepth: + outx := opts.WithDiffMode(diffRemoved).FormatDiff(r.Value) + outy := opts.WithDiffMode(diffInserted).FormatDiff(r.Value) + if outx != nil { + list = append(list, textRecord{Diff: diffRemoved, Key: formatKey(r.Key), Value: outx}) + } + if outy != nil { + list = append(list, textRecord{Diff: diffInserted, Key: formatKey(r.Key), Value: outy}) + } + default: + out := opts.FormatDiff(r.Value) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + } + } + recs = recs[ds.NumDiff():] + } + assert(len(recs) == 0) + return textWrap{"{", list, "}"} +} + +// coalesceAdjacentRecords coalesces the list of records into groups of +// adjacent equal, or unequal counts. +func coalesceAdjacentRecords(name string, recs []reportRecord) (groups []diffStats) { + var prevCase int // Arbitrary index into which case last occurred + lastStats := func(i int) *diffStats { + if prevCase != i { + groups = append(groups, diffStats{Name: name}) + prevCase = i + } + return &groups[len(groups)-1] + } + for _, r := range recs { + switch rv := r.Value; { + case rv.NumIgnored > 0 && rv.NumSame+rv.NumDiff == 0: + lastStats(1).NumIgnored++ + case rv.NumDiff == 0: + lastStats(1).NumIdentical++ + case rv.NumDiff > 0 && !rv.ValueY.IsValid(): + lastStats(2).NumRemoved++ + case rv.NumDiff > 0 && !rv.ValueX.IsValid(): + lastStats(2).NumInserted++ + default: + lastStats(2).NumModified++ + } + } + return groups +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_reflect.go b/vendor/github.com/google/go-cmp/cmp/report_reflect.go new file mode 100644 index 0000000000..5521c604c5 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_reflect.go @@ -0,0 +1,279 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package cmp + +import ( + "fmt" + "reflect" + "strconv" + "strings" + "unicode" + + "github.com/google/go-cmp/cmp/internal/flags" + "github.com/google/go-cmp/cmp/internal/value" +) + +type formatValueOptions struct { + // AvoidStringer controls whether to avoid calling custom stringer + // methods like error.Error or fmt.Stringer.String. + AvoidStringer bool + + // ShallowPointers controls whether to avoid descending into pointers. + // Useful when printing map keys, where pointer comparison is performed + // on the pointer address rather than the pointed-at value. + ShallowPointers bool + + // PrintAddresses controls whether to print the address of all pointers, + // slice elements, and maps. + PrintAddresses bool +} + +// FormatType prints the type as if it were wrapping s. +// This may return s as-is depending on the current type and TypeMode mode. +func (opts formatOptions) FormatType(t reflect.Type, s textNode) textNode { + // Check whether to emit the type or not. + switch opts.TypeMode { + case autoType: + switch t.Kind() { + case reflect.Struct, reflect.Slice, reflect.Array, reflect.Map: + if s.Equal(textNil) { + return s + } + default: + return s + } + case elideType: + return s + } + + // Determine the type label, applying special handling for unnamed types. + typeName := t.String() + if t.Name() == "" { + // According to Go grammar, certain type literals contain symbols that + // do not strongly bind to the next lexicographical token (e.g., *T). + switch t.Kind() { + case reflect.Chan, reflect.Func, reflect.Ptr: + typeName = "(" + typeName + ")" + } + typeName = strings.Replace(typeName, "struct {", "struct{", -1) + typeName = strings.Replace(typeName, "interface {", "interface{", -1) + } + + // Avoid wrap the value in parenthesis if unnecessary. + if s, ok := s.(textWrap); ok { + hasParens := strings.HasPrefix(s.Prefix, "(") && strings.HasSuffix(s.Suffix, ")") + hasBraces := strings.HasPrefix(s.Prefix, "{") && strings.HasSuffix(s.Suffix, "}") + if hasParens || hasBraces { + return textWrap{typeName, s, ""} + } + } + return textWrap{typeName + "(", s, ")"} +} + +// FormatValue prints the reflect.Value, taking extra care to avoid descending +// into pointers already in m. As pointers are visited, m is also updated. +func (opts formatOptions) FormatValue(v reflect.Value, m visitedPointers) (out textNode) { + if !v.IsValid() { + return nil + } + t := v.Type() + + // Check whether there is an Error or String method to call. + if !opts.AvoidStringer && v.CanInterface() { + // Avoid calling Error or String methods on nil receivers since many + // implementations crash when doing so. + if (t.Kind() != reflect.Ptr && t.Kind() != reflect.Interface) || !v.IsNil() { + switch v := v.Interface().(type) { + case error: + return textLine("e" + formatString(v.Error())) + case fmt.Stringer: + return textLine("s" + formatString(v.String())) + } + } + } + + // Check whether to explicitly wrap the result with the type. + var skipType bool + defer func() { + if !skipType { + out = opts.FormatType(t, out) + } + }() + + var ptr string + switch t.Kind() { + case reflect.Bool: + return textLine(fmt.Sprint(v.Bool())) + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return textLine(fmt.Sprint(v.Int())) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + // Unnamed uints are usually bytes or words, so use hexadecimal. + if t.PkgPath() == "" || t.Kind() == reflect.Uintptr { + return textLine(formatHex(v.Uint())) + } + return textLine(fmt.Sprint(v.Uint())) + case reflect.Float32, reflect.Float64: + return textLine(fmt.Sprint(v.Float())) + case reflect.Complex64, reflect.Complex128: + return textLine(fmt.Sprint(v.Complex())) + case reflect.String: + return textLine(formatString(v.String())) + case reflect.UnsafePointer, reflect.Chan, reflect.Func: + return textLine(formatPointer(v)) + case reflect.Struct: + var list textList + for i := 0; i < v.NumField(); i++ { + vv := v.Field(i) + if value.IsZero(vv) { + continue // Elide fields with zero values + } + s := opts.WithTypeMode(autoType).FormatValue(vv, m) + list = append(list, textRecord{Key: t.Field(i).Name, Value: s}) + } + return textWrap{"{", list, "}"} + case reflect.Slice: + if v.IsNil() { + return textNil + } + if opts.PrintAddresses { + ptr = formatPointer(v) + } + fallthrough + case reflect.Array: + var list textList + for i := 0; i < v.Len(); i++ { + vi := v.Index(i) + if vi.CanAddr() { // Check for cyclic elements + p := vi.Addr() + if m.Visit(p) { + var out textNode + out = textLine(formatPointer(p)) + out = opts.WithTypeMode(emitType).FormatType(p.Type(), out) + out = textWrap{"*", out, ""} + list = append(list, textRecord{Value: out}) + continue + } + } + s := opts.WithTypeMode(elideType).FormatValue(vi, m) + list = append(list, textRecord{Value: s}) + } + return textWrap{ptr + "{", list, "}"} + case reflect.Map: + if v.IsNil() { + return textNil + } + if m.Visit(v) { + return textLine(formatPointer(v)) + } + + var list textList + for _, k := range value.SortKeys(v.MapKeys()) { + sk := formatMapKey(k) + sv := opts.WithTypeMode(elideType).FormatValue(v.MapIndex(k), m) + list = append(list, textRecord{Key: sk, Value: sv}) + } + if opts.PrintAddresses { + ptr = formatPointer(v) + } + return textWrap{ptr + "{", list, "}"} + case reflect.Ptr: + if v.IsNil() { + return textNil + } + if m.Visit(v) || opts.ShallowPointers { + return textLine(formatPointer(v)) + } + if opts.PrintAddresses { + ptr = formatPointer(v) + } + skipType = true // Let the underlying value print the type instead + return textWrap{"&" + ptr, opts.FormatValue(v.Elem(), m), ""} + case reflect.Interface: + if v.IsNil() { + return textNil + } + // Interfaces accept different concrete types, + // so configure the underlying value to explicitly print the type. + skipType = true // Print the concrete type instead + return opts.WithTypeMode(emitType).FormatValue(v.Elem(), m) + default: + panic(fmt.Sprintf("%v kind not handled", v.Kind())) + } +} + +// formatMapKey formats v as if it were a map key. +// The result is guaranteed to be a single line. +func formatMapKey(v reflect.Value) string { + var opts formatOptions + opts.TypeMode = elideType + opts.AvoidStringer = true + opts.ShallowPointers = true + s := opts.FormatValue(v, visitedPointers{}).String() + return strings.TrimSpace(s) +} + +// formatString prints s as a double-quoted or backtick-quoted string. +func formatString(s string) string { + // Use quoted string if it the same length as a raw string literal. + // Otherwise, attempt to use the raw string form. + qs := strconv.Quote(s) + if len(qs) == 1+len(s)+1 { + return qs + } + + // Disallow newlines to ensure output is a single line. + // Only allow printable runes for readability purposes. + rawInvalid := func(r rune) bool { + return r == '`' || r == '\n' || !(unicode.IsPrint(r) || r == '\t') + } + if strings.IndexFunc(s, rawInvalid) < 0 { + return "`" + s + "`" + } + return qs +} + +// formatHex prints u as a hexadecimal integer in Go notation. +func formatHex(u uint64) string { + var f string + switch { + case u <= 0xff: + f = "0x%02x" + case u <= 0xffff: + f = "0x%04x" + case u <= 0xffffff: + f = "0x%06x" + case u <= 0xffffffff: + f = "0x%08x" + case u <= 0xffffffffff: + f = "0x%010x" + case u <= 0xffffffffffff: + f = "0x%012x" + case u <= 0xffffffffffffff: + f = "0x%014x" + case u <= 0xffffffffffffffff: + f = "0x%016x" + } + return fmt.Sprintf(f, u) +} + +// formatPointer prints the address of the pointer. +func formatPointer(v reflect.Value) string { + p := v.Pointer() + if flags.Deterministic { + p = 0xdeadf00f // Only used for stable testing purposes + } + return fmt.Sprintf("⟪0x%x⟫", p) +} + +type visitedPointers map[value.Pointer]struct{} + +// Visit inserts pointer v into the visited map and reports whether it had +// already been visited before. +func (m visitedPointers) Visit(v reflect.Value) bool { + p := value.PointerOf(v) + _, visited := m[p] + m[p] = struct{}{} + return visited +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_slices.go b/vendor/github.com/google/go-cmp/cmp/report_slices.go new file mode 100644 index 0000000000..8cb3265e76 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_slices.go @@ -0,0 +1,333 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package cmp + +import ( + "bytes" + "fmt" + "reflect" + "strings" + "unicode" + "unicode/utf8" + + "github.com/google/go-cmp/cmp/internal/diff" +) + +// CanFormatDiffSlice reports whether we support custom formatting for nodes +// that are slices of primitive kinds or strings. +func (opts formatOptions) CanFormatDiffSlice(v *valueNode) bool { + switch { + case opts.DiffMode != diffUnknown: + return false // Must be formatting in diff mode + case v.NumDiff == 0: + return false // No differences detected + case v.NumIgnored+v.NumCompared+v.NumTransformed > 0: + // TODO: Handle the case where someone uses bytes.Equal on a large slice. + return false // Some custom option was used to determined equality + case !v.ValueX.IsValid() || !v.ValueY.IsValid(): + return false // Both values must be valid + } + + switch t := v.Type; t.Kind() { + case reflect.String: + case reflect.Array, reflect.Slice: + // Only slices of primitive types have specialized handling. + switch t.Elem().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, + reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, + reflect.Bool, reflect.Float32, reflect.Float64, reflect.Complex64, reflect.Complex128: + default: + return false + } + + // If a sufficient number of elements already differ, + // use specialized formatting even if length requirement is not met. + if v.NumDiff > v.NumSame { + return true + } + default: + return false + } + + // Use specialized string diffing for longer slices or strings. + const minLength = 64 + return v.ValueX.Len() >= minLength && v.ValueY.Len() >= minLength +} + +// FormatDiffSlice prints a diff for the slices (or strings) represented by v. +// This provides custom-tailored logic to make printing of differences in +// textual strings and slices of primitive kinds more readable. +func (opts formatOptions) FormatDiffSlice(v *valueNode) textNode { + assert(opts.DiffMode == diffUnknown) + t, vx, vy := v.Type, v.ValueX, v.ValueY + + // Auto-detect the type of the data. + var isLinedText, isText, isBinary bool + var sx, sy string + switch { + case t.Kind() == reflect.String: + sx, sy = vx.String(), vy.String() + isText = true // Initial estimate, verify later + case t.Kind() == reflect.Slice && t.Elem() == reflect.TypeOf(byte(0)): + sx, sy = string(vx.Bytes()), string(vy.Bytes()) + isBinary = true // Initial estimate, verify later + case t.Kind() == reflect.Array: + // Arrays need to be addressable for slice operations to work. + vx2, vy2 := reflect.New(t).Elem(), reflect.New(t).Elem() + vx2.Set(vx) + vy2.Set(vy) + vx, vy = vx2, vy2 + } + if isText || isBinary { + var numLines, lastLineIdx, maxLineLen int + isBinary = false + for i, r := range sx + sy { + if !(unicode.IsPrint(r) || unicode.IsSpace(r)) || r == utf8.RuneError { + isBinary = true + break + } + if r == '\n' { + if maxLineLen < i-lastLineIdx { + lastLineIdx = i - lastLineIdx + } + lastLineIdx = i + 1 + numLines++ + } + } + isText = !isBinary + isLinedText = isText && numLines >= 4 && maxLineLen <= 256 + } + + // Format the string into printable records. + var list textList + var delim string + switch { + // If the text appears to be multi-lined text, + // then perform differencing across individual lines. + case isLinedText: + ssx := strings.Split(sx, "\n") + ssy := strings.Split(sy, "\n") + list = opts.formatDiffSlice( + reflect.ValueOf(ssx), reflect.ValueOf(ssy), 1, "line", + func(v reflect.Value, d diffMode) textRecord { + s := formatString(v.Index(0).String()) + return textRecord{Diff: d, Value: textLine(s)} + }, + ) + delim = "\n" + // If the text appears to be single-lined text, + // then perform differencing in approximately fixed-sized chunks. + // The output is printed as quoted strings. + case isText: + list = opts.formatDiffSlice( + reflect.ValueOf(sx), reflect.ValueOf(sy), 64, "byte", + func(v reflect.Value, d diffMode) textRecord { + s := formatString(v.String()) + return textRecord{Diff: d, Value: textLine(s)} + }, + ) + delim = "" + // If the text appears to be binary data, + // then perform differencing in approximately fixed-sized chunks. + // The output is inspired by hexdump. + case isBinary: + list = opts.formatDiffSlice( + reflect.ValueOf(sx), reflect.ValueOf(sy), 16, "byte", + func(v reflect.Value, d diffMode) textRecord { + var ss []string + for i := 0; i < v.Len(); i++ { + ss = append(ss, formatHex(v.Index(i).Uint())) + } + s := strings.Join(ss, ", ") + comment := commentString(fmt.Sprintf("%c|%v|", d, formatASCII(v.String()))) + return textRecord{Diff: d, Value: textLine(s), Comment: comment} + }, + ) + // For all other slices of primitive types, + // then perform differencing in approximately fixed-sized chunks. + // The size of each chunk depends on the width of the element kind. + default: + var chunkSize int + if t.Elem().Kind() == reflect.Bool { + chunkSize = 16 + } else { + switch t.Elem().Bits() { + case 8: + chunkSize = 16 + case 16: + chunkSize = 12 + case 32: + chunkSize = 8 + default: + chunkSize = 8 + } + } + list = opts.formatDiffSlice( + vx, vy, chunkSize, t.Elem().Kind().String(), + func(v reflect.Value, d diffMode) textRecord { + var ss []string + for i := 0; i < v.Len(); i++ { + switch t.Elem().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + ss = append(ss, fmt.Sprint(v.Index(i).Int())) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + ss = append(ss, formatHex(v.Index(i).Uint())) + case reflect.Bool, reflect.Float32, reflect.Float64, reflect.Complex64, reflect.Complex128: + ss = append(ss, fmt.Sprint(v.Index(i).Interface())) + } + } + s := strings.Join(ss, ", ") + return textRecord{Diff: d, Value: textLine(s)} + }, + ) + } + + // Wrap the output with appropriate type information. + var out textNode = textWrap{"{", list, "}"} + if !isText { + // The "{...}" byte-sequence literal is not valid Go syntax for strings. + // Emit the type for extra clarity (e.g. "string{...}"). + if t.Kind() == reflect.String { + opts = opts.WithTypeMode(emitType) + } + return opts.FormatType(t, out) + } + switch t.Kind() { + case reflect.String: + out = textWrap{"strings.Join(", out, fmt.Sprintf(", %q)", delim)} + if t != reflect.TypeOf(string("")) { + out = opts.FormatType(t, out) + } + case reflect.Slice: + out = textWrap{"bytes.Join(", out, fmt.Sprintf(", %q)", delim)} + if t != reflect.TypeOf([]byte(nil)) { + out = opts.FormatType(t, out) + } + } + return out +} + +// formatASCII formats s as an ASCII string. +// This is useful for printing binary strings in a semi-legible way. +func formatASCII(s string) string { + b := bytes.Repeat([]byte{'.'}, len(s)) + for i := 0; i < len(s); i++ { + if ' ' <= s[i] && s[i] <= '~' { + b[i] = s[i] + } + } + return string(b) +} + +func (opts formatOptions) formatDiffSlice( + vx, vy reflect.Value, chunkSize int, name string, + makeRec func(reflect.Value, diffMode) textRecord, +) (list textList) { + es := diff.Difference(vx.Len(), vy.Len(), func(ix int, iy int) diff.Result { + return diff.BoolResult(vx.Index(ix).Interface() == vy.Index(iy).Interface()) + }) + + appendChunks := func(v reflect.Value, d diffMode) int { + n0 := v.Len() + for v.Len() > 0 { + n := chunkSize + if n > v.Len() { + n = v.Len() + } + list = append(list, makeRec(v.Slice(0, n), d)) + v = v.Slice(n, v.Len()) + } + return n0 - v.Len() + } + + groups := coalesceAdjacentEdits(name, es) + groups = coalesceInterveningIdentical(groups, chunkSize/4) + for i, ds := range groups { + // Print equal. + if ds.NumDiff() == 0 { + // Compute the number of leading and trailing equal bytes to print. + var numLo, numHi int + numEqual := ds.NumIgnored + ds.NumIdentical + for numLo < chunkSize*numContextRecords && numLo+numHi < numEqual && i != 0 { + numLo++ + } + for numHi < chunkSize*numContextRecords && numLo+numHi < numEqual && i != len(groups)-1 { + numHi++ + } + if numEqual-(numLo+numHi) <= chunkSize && ds.NumIgnored == 0 { + numHi = numEqual - numLo // Avoid pointless coalescing of single equal row + } + + // Print the equal bytes. + appendChunks(vx.Slice(0, numLo), diffIdentical) + if numEqual > numLo+numHi { + ds.NumIdentical -= numLo + numHi + list.AppendEllipsis(ds) + } + appendChunks(vx.Slice(numEqual-numHi, numEqual), diffIdentical) + vx = vx.Slice(numEqual, vx.Len()) + vy = vy.Slice(numEqual, vy.Len()) + continue + } + + // Print unequal. + nx := appendChunks(vx.Slice(0, ds.NumIdentical+ds.NumRemoved+ds.NumModified), diffRemoved) + vx = vx.Slice(nx, vx.Len()) + ny := appendChunks(vy.Slice(0, ds.NumIdentical+ds.NumInserted+ds.NumModified), diffInserted) + vy = vy.Slice(ny, vy.Len()) + } + assert(vx.Len() == 0 && vy.Len() == 0) + return list +} + +// coalesceAdjacentEdits coalesces the list of edits into groups of adjacent +// equal or unequal counts. +func coalesceAdjacentEdits(name string, es diff.EditScript) (groups []diffStats) { + var prevCase int // Arbitrary index into which case last occurred + lastStats := func(i int) *diffStats { + if prevCase != i { + groups = append(groups, diffStats{Name: name}) + prevCase = i + } + return &groups[len(groups)-1] + } + for _, e := range es { + switch e { + case diff.Identity: + lastStats(1).NumIdentical++ + case diff.UniqueX: + lastStats(2).NumRemoved++ + case diff.UniqueY: + lastStats(2).NumInserted++ + case diff.Modified: + lastStats(2).NumModified++ + } + } + return groups +} + +// coalesceInterveningIdentical coalesces sufficiently short (<= windowSize) +// equal groups into adjacent unequal groups that currently result in a +// dual inserted/removed printout. This acts as a high-pass filter to smooth +// out high-frequency changes within the windowSize. +func coalesceInterveningIdentical(groups []diffStats, windowSize int) []diffStats { + groups, groupsOrig := groups[:0], groups + for i, ds := range groupsOrig { + if len(groups) >= 2 && ds.NumDiff() > 0 { + prev := &groups[len(groups)-2] // Unequal group + curr := &groups[len(groups)-1] // Equal group + next := &groupsOrig[i] // Unequal group + hadX, hadY := prev.NumRemoved > 0, prev.NumInserted > 0 + hasX, hasY := next.NumRemoved > 0, next.NumInserted > 0 + if ((hadX || hasX) && (hadY || hasY)) && curr.NumIdentical <= windowSize { + *prev = (*prev).Append(*curr).Append(*next) + groups = groups[:len(groups)-1] // Truncate off equal group + continue + } + } + groups = append(groups, ds) + } + return groups +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_text.go b/vendor/github.com/google/go-cmp/cmp/report_text.go new file mode 100644 index 0000000000..80605d0e44 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_text.go @@ -0,0 +1,382 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package cmp + +import ( + "bytes" + "fmt" + "math/rand" + "strings" + "time" + + "github.com/google/go-cmp/cmp/internal/flags" +) + +var randBool = rand.New(rand.NewSource(time.Now().Unix())).Intn(2) == 0 + +type indentMode int + +func (n indentMode) appendIndent(b []byte, d diffMode) []byte { + if flags.Deterministic || randBool { + // Use regular spaces (U+0020). + switch d { + case diffUnknown, diffIdentical: + b = append(b, " "...) + case diffRemoved: + b = append(b, "- "...) + case diffInserted: + b = append(b, "+ "...) + } + } else { + // Use non-breaking spaces (U+00a0). + switch d { + case diffUnknown, diffIdentical: + b = append(b, "  "...) + case diffRemoved: + b = append(b, "- "...) + case diffInserted: + b = append(b, "+ "...) + } + } + return repeatCount(n).appendChar(b, '\t') +} + +type repeatCount int + +func (n repeatCount) appendChar(b []byte, c byte) []byte { + for ; n > 0; n-- { + b = append(b, c) + } + return b +} + +// textNode is a simplified tree-based representation of structured text. +// Possible node types are textWrap, textList, or textLine. +type textNode interface { + // Len reports the length in bytes of a single-line version of the tree. + // Nested textRecord.Diff and textRecord.Comment fields are ignored. + Len() int + // Equal reports whether the two trees are structurally identical. + // Nested textRecord.Diff and textRecord.Comment fields are compared. + Equal(textNode) bool + // String returns the string representation of the text tree. + // It is not guaranteed that len(x.String()) == x.Len(), + // nor that x.String() == y.String() implies that x.Equal(y). + String() string + + // formatCompactTo formats the contents of the tree as a single-line string + // to the provided buffer. Any nested textRecord.Diff and textRecord.Comment + // fields are ignored. + // + // However, not all nodes in the tree should be collapsed as a single-line. + // If a node can be collapsed as a single-line, it is replaced by a textLine + // node. Since the top-level node cannot replace itself, this also returns + // the current node itself. + // + // This does not mutate the receiver. + formatCompactTo([]byte, diffMode) ([]byte, textNode) + // formatExpandedTo formats the contents of the tree as a multi-line string + // to the provided buffer. In order for column alignment to operate well, + // formatCompactTo must be called before calling formatExpandedTo. + formatExpandedTo([]byte, diffMode, indentMode) []byte +} + +// textWrap is a wrapper that concatenates a prefix and/or a suffix +// to the underlying node. +type textWrap struct { + Prefix string // e.g., "bytes.Buffer{" + Value textNode // textWrap | textList | textLine + Suffix string // e.g., "}" +} + +func (s textWrap) Len() int { + return len(s.Prefix) + s.Value.Len() + len(s.Suffix) +} +func (s1 textWrap) Equal(s2 textNode) bool { + if s2, ok := s2.(textWrap); ok { + return s1.Prefix == s2.Prefix && s1.Value.Equal(s2.Value) && s1.Suffix == s2.Suffix + } + return false +} +func (s textWrap) String() string { + var d diffMode + var n indentMode + _, s2 := s.formatCompactTo(nil, d) + b := n.appendIndent(nil, d) // Leading indent + b = s2.formatExpandedTo(b, d, n) // Main body + b = append(b, '\n') // Trailing newline + return string(b) +} +func (s textWrap) formatCompactTo(b []byte, d diffMode) ([]byte, textNode) { + n0 := len(b) // Original buffer length + b = append(b, s.Prefix...) + b, s.Value = s.Value.formatCompactTo(b, d) + b = append(b, s.Suffix...) + if _, ok := s.Value.(textLine); ok { + return b, textLine(b[n0:]) + } + return b, s +} +func (s textWrap) formatExpandedTo(b []byte, d diffMode, n indentMode) []byte { + b = append(b, s.Prefix...) + b = s.Value.formatExpandedTo(b, d, n) + b = append(b, s.Suffix...) + return b +} + +// textList is a comma-separated list of textWrap or textLine nodes. +// The list may be formatted as multi-lines or single-line at the discretion +// of the textList.formatCompactTo method. +type textList []textRecord +type textRecord struct { + Diff diffMode // e.g., 0 or '-' or '+' + Key string // e.g., "MyField" + Value textNode // textWrap | textLine + Comment fmt.Stringer // e.g., "6 identical fields" +} + +// AppendEllipsis appends a new ellipsis node to the list if none already +// exists at the end. If cs is non-zero it coalesces the statistics with the +// previous diffStats. +func (s *textList) AppendEllipsis(ds diffStats) { + hasStats := ds != diffStats{} + if len(*s) == 0 || !(*s)[len(*s)-1].Value.Equal(textEllipsis) { + if hasStats { + *s = append(*s, textRecord{Value: textEllipsis, Comment: ds}) + } else { + *s = append(*s, textRecord{Value: textEllipsis}) + } + return + } + if hasStats { + (*s)[len(*s)-1].Comment = (*s)[len(*s)-1].Comment.(diffStats).Append(ds) + } +} + +func (s textList) Len() (n int) { + for i, r := range s { + n += len(r.Key) + if r.Key != "" { + n += len(": ") + } + n += r.Value.Len() + if i < len(s)-1 { + n += len(", ") + } + } + return n +} + +func (s1 textList) Equal(s2 textNode) bool { + if s2, ok := s2.(textList); ok { + if len(s1) != len(s2) { + return false + } + for i := range s1 { + r1, r2 := s1[i], s2[i] + if !(r1.Diff == r2.Diff && r1.Key == r2.Key && r1.Value.Equal(r2.Value) && r1.Comment == r2.Comment) { + return false + } + } + return true + } + return false +} + +func (s textList) String() string { + return textWrap{"{", s, "}"}.String() +} + +func (s textList) formatCompactTo(b []byte, d diffMode) ([]byte, textNode) { + s = append(textList(nil), s...) // Avoid mutating original + + // Determine whether we can collapse this list as a single line. + n0 := len(b) // Original buffer length + var multiLine bool + for i, r := range s { + if r.Diff == diffInserted || r.Diff == diffRemoved { + multiLine = true + } + b = append(b, r.Key...) + if r.Key != "" { + b = append(b, ": "...) + } + b, s[i].Value = r.Value.formatCompactTo(b, d|r.Diff) + if _, ok := s[i].Value.(textLine); !ok { + multiLine = true + } + if r.Comment != nil { + multiLine = true + } + if i < len(s)-1 { + b = append(b, ", "...) + } + } + // Force multi-lined output when printing a removed/inserted node that + // is sufficiently long. + if (d == diffInserted || d == diffRemoved) && len(b[n0:]) > 80 { + multiLine = true + } + if !multiLine { + return b, textLine(b[n0:]) + } + return b, s +} + +func (s textList) formatExpandedTo(b []byte, d diffMode, n indentMode) []byte { + alignKeyLens := s.alignLens( + func(r textRecord) bool { + _, isLine := r.Value.(textLine) + return r.Key == "" || !isLine + }, + func(r textRecord) int { return len(r.Key) }, + ) + alignValueLens := s.alignLens( + func(r textRecord) bool { + _, isLine := r.Value.(textLine) + return !isLine || r.Value.Equal(textEllipsis) || r.Comment == nil + }, + func(r textRecord) int { return len(r.Value.(textLine)) }, + ) + + // Format the list as a multi-lined output. + n++ + for i, r := range s { + b = n.appendIndent(append(b, '\n'), d|r.Diff) + if r.Key != "" { + b = append(b, r.Key+": "...) + } + b = alignKeyLens[i].appendChar(b, ' ') + + b = r.Value.formatExpandedTo(b, d|r.Diff, n) + if !r.Value.Equal(textEllipsis) { + b = append(b, ',') + } + b = alignValueLens[i].appendChar(b, ' ') + + if r.Comment != nil { + b = append(b, " // "+r.Comment.String()...) + } + } + n-- + + return n.appendIndent(append(b, '\n'), d) +} + +func (s textList) alignLens( + skipFunc func(textRecord) bool, + lenFunc func(textRecord) int, +) []repeatCount { + var startIdx, endIdx, maxLen int + lens := make([]repeatCount, len(s)) + for i, r := range s { + if skipFunc(r) { + for j := startIdx; j < endIdx && j < len(s); j++ { + lens[j] = repeatCount(maxLen - lenFunc(s[j])) + } + startIdx, endIdx, maxLen = i+1, i+1, 0 + } else { + if maxLen < lenFunc(r) { + maxLen = lenFunc(r) + } + endIdx = i + 1 + } + } + for j := startIdx; j < endIdx && j < len(s); j++ { + lens[j] = repeatCount(maxLen - lenFunc(s[j])) + } + return lens +} + +// textLine is a single-line segment of text and is always a leaf node +// in the textNode tree. +type textLine []byte + +var ( + textNil = textLine("nil") + textEllipsis = textLine("...") +) + +func (s textLine) Len() int { + return len(s) +} +func (s1 textLine) Equal(s2 textNode) bool { + if s2, ok := s2.(textLine); ok { + return bytes.Equal([]byte(s1), []byte(s2)) + } + return false +} +func (s textLine) String() string { + return string(s) +} +func (s textLine) formatCompactTo(b []byte, d diffMode) ([]byte, textNode) { + return append(b, s...), s +} +func (s textLine) formatExpandedTo(b []byte, _ diffMode, _ indentMode) []byte { + return append(b, s...) +} + +type diffStats struct { + Name string + NumIgnored int + NumIdentical int + NumRemoved int + NumInserted int + NumModified int +} + +func (s diffStats) NumDiff() int { + return s.NumRemoved + s.NumInserted + s.NumModified +} + +func (s diffStats) Append(ds diffStats) diffStats { + assert(s.Name == ds.Name) + s.NumIgnored += ds.NumIgnored + s.NumIdentical += ds.NumIdentical + s.NumRemoved += ds.NumRemoved + s.NumInserted += ds.NumInserted + s.NumModified += ds.NumModified + return s +} + +// String prints a humanly-readable summary of coalesced records. +// +// Example: +// diffStats{Name: "Field", NumIgnored: 5}.String() => "5 ignored fields" +func (s diffStats) String() string { + var ss []string + var sum int + labels := [...]string{"ignored", "identical", "removed", "inserted", "modified"} + counts := [...]int{s.NumIgnored, s.NumIdentical, s.NumRemoved, s.NumInserted, s.NumModified} + for i, n := range counts { + if n > 0 { + ss = append(ss, fmt.Sprintf("%d %v", n, labels[i])) + } + sum += n + } + + // Pluralize the name (adjusting for some obscure English grammar rules). + name := s.Name + if sum > 1 { + name = name + "s" + if strings.HasSuffix(name, "ys") { + name = name[:len(name)-2] + "ies" // e.g., "entrys" => "entries" + } + } + + // Format the list according to English grammar (with Oxford comma). + switch n := len(ss); n { + case 0: + return "" + case 1, 2: + return strings.Join(ss, " and ") + " " + name + default: + return strings.Join(ss[:n-1], ", ") + ", and " + ss[n-1] + " " + name + } +} + +type commentString string + +func (s commentString) String() string { return string(s) } diff --git a/vendor/github.com/google/go-cmp/cmp/report_value.go b/vendor/github.com/google/go-cmp/cmp/report_value.go new file mode 100644 index 0000000000..83031a7f50 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_value.go @@ -0,0 +1,121 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE.md file. + +package cmp + +import "reflect" + +// valueNode represents a single node within a report, which is a +// structured representation of the value tree, containing information +// regarding which nodes are equal or not. +type valueNode struct { + parent *valueNode + + Type reflect.Type + ValueX reflect.Value + ValueY reflect.Value + + // NumSame is the number of leaf nodes that are equal. + // All descendants are equal only if NumDiff is 0. + NumSame int + // NumDiff is the number of leaf nodes that are not equal. + NumDiff int + // NumIgnored is the number of leaf nodes that are ignored. + NumIgnored int + // NumCompared is the number of leaf nodes that were compared + // using an Equal method or Comparer function. + NumCompared int + // NumTransformed is the number of non-leaf nodes that were transformed. + NumTransformed int + // NumChildren is the number of transitive descendants of this node. + // This counts from zero; thus, leaf nodes have no descendants. + NumChildren int + // MaxDepth is the maximum depth of the tree. This counts from zero; + // thus, leaf nodes have a depth of zero. + MaxDepth int + + // Records is a list of struct fields, slice elements, or map entries. + Records []reportRecord // If populated, implies Value is not populated + + // Value is the result of a transformation, pointer indirect, of + // type assertion. + Value *valueNode // If populated, implies Records is not populated + + // TransformerName is the name of the transformer. + TransformerName string // If non-empty, implies Value is populated +} +type reportRecord struct { + Key reflect.Value // Invalid for slice element + Value *valueNode +} + +func (parent *valueNode) PushStep(ps PathStep) (child *valueNode) { + vx, vy := ps.Values() + child = &valueNode{parent: parent, Type: ps.Type(), ValueX: vx, ValueY: vy} + switch s := ps.(type) { + case StructField: + assert(parent.Value == nil) + parent.Records = append(parent.Records, reportRecord{Key: reflect.ValueOf(s.Name()), Value: child}) + case SliceIndex: + assert(parent.Value == nil) + parent.Records = append(parent.Records, reportRecord{Value: child}) + case MapIndex: + assert(parent.Value == nil) + parent.Records = append(parent.Records, reportRecord{Key: s.Key(), Value: child}) + case Indirect: + assert(parent.Value == nil && parent.Records == nil) + parent.Value = child + case TypeAssertion: + assert(parent.Value == nil && parent.Records == nil) + parent.Value = child + case Transform: + assert(parent.Value == nil && parent.Records == nil) + parent.Value = child + parent.TransformerName = s.Name() + parent.NumTransformed++ + default: + assert(parent == nil) // Must be the root step + } + return child +} + +func (r *valueNode) Report(rs Result) { + assert(r.MaxDepth == 0) // May only be called on leaf nodes + + if rs.ByIgnore() { + r.NumIgnored++ + } else { + if rs.Equal() { + r.NumSame++ + } else { + r.NumDiff++ + } + } + assert(r.NumSame+r.NumDiff+r.NumIgnored == 1) + + if rs.ByMethod() { + r.NumCompared++ + } + if rs.ByFunc() { + r.NumCompared++ + } + assert(r.NumCompared <= 1) +} + +func (child *valueNode) PopStep() (parent *valueNode) { + if child.parent == nil { + return nil + } + parent = child.parent + parent.NumSame += child.NumSame + parent.NumDiff += child.NumDiff + parent.NumIgnored += child.NumIgnored + parent.NumCompared += child.NumCompared + parent.NumTransformed += child.NumTransformed + parent.NumChildren += child.NumChildren + 1 + if parent.MaxDepth < child.MaxDepth+1 { + parent.MaxDepth = child.MaxDepth + 1 + } + return parent +} diff --git a/vendor/github.com/google/go-cmp/cmp/reporter.go b/vendor/github.com/google/go-cmp/cmp/reporter.go deleted file mode 100644 index 20e9f18e0d..0000000000 --- a/vendor/github.com/google/go-cmp/cmp/reporter.go +++ /dev/null @@ -1,53 +0,0 @@ -// Copyright 2017, The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE.md file. - -package cmp - -import ( - "fmt" - "reflect" - "strings" - - "github.com/google/go-cmp/cmp/internal/value" -) - -type defaultReporter struct { - Option - diffs []string // List of differences, possibly truncated - ndiffs int // Total number of differences - nbytes int // Number of bytes in diffs - nlines int // Number of lines in diffs -} - -var _ reporter = (*defaultReporter)(nil) - -func (r *defaultReporter) Report(x, y reflect.Value, eq bool, p Path) { - if eq { - return // Ignore equal results - } - const maxBytes = 4096 - const maxLines = 256 - r.ndiffs++ - if r.nbytes < maxBytes && r.nlines < maxLines { - sx := value.Format(x, value.FormatConfig{UseStringer: true}) - sy := value.Format(y, value.FormatConfig{UseStringer: true}) - if sx == sy { - // Unhelpful output, so use more exact formatting. - sx = value.Format(x, value.FormatConfig{PrintPrimitiveType: true}) - sy = value.Format(y, value.FormatConfig{PrintPrimitiveType: true}) - } - s := fmt.Sprintf("%#v:\n\t-: %s\n\t+: %s\n", p, sx, sy) - r.diffs = append(r.diffs, s) - r.nbytes += len(s) - r.nlines += strings.Count(s, "\n") - } -} - -func (r *defaultReporter) String() string { - s := strings.Join(r.diffs, "") - if r.ndiffs == len(r.diffs) { - return s - } - return fmt.Sprintf("%s... %d more differences ...", s, r.ndiffs-len(r.diffs)) -} diff --git a/vendor/github.com/modern-go/concurrent/.gitignore b/vendor/github.com/modern-go/concurrent/.gitignore new file mode 100644 index 0000000000..3f2bc47416 --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/.gitignore @@ -0,0 +1 @@ +/coverage.txt diff --git a/vendor/github.com/modern-go/concurrent/.travis.yml b/vendor/github.com/modern-go/concurrent/.travis.yml new file mode 100644 index 0000000000..449e67cd01 --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/.travis.yml @@ -0,0 +1,14 @@ +language: go + +go: + - 1.8.x + - 1.x + +before_install: + - go get -t -v ./... + +script: + - ./test.sh + +after_success: + - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/github.com/modern-go/concurrent/README.md b/vendor/github.com/modern-go/concurrent/README.md index 91d6adb3fa..acab3200aa 100644 --- a/vendor/github.com/modern-go/concurrent/README.md +++ b/vendor/github.com/modern-go/concurrent/README.md @@ -1,2 +1,49 @@ # concurrent -concurrency utilities + +[![Sourcegraph](https://sourcegraph.com/github.com/modern-go/concurrent/-/badge.svg)](https://sourcegraph.com/github.com/modern-go/concurrent?badge) +[![GoDoc](http://img.shields.io/badge/go-documentation-blue.svg?style=flat-square)](http://godoc.org/github.com/modern-go/concurrent) +[![Build Status](https://travis-ci.org/modern-go/concurrent.svg?branch=master)](https://travis-ci.org/modern-go/concurrent) +[![codecov](https://codecov.io/gh/modern-go/concurrent/branch/master/graph/badge.svg)](https://codecov.io/gh/modern-go/concurrent) +[![rcard](https://goreportcard.com/badge/github.com/modern-go/concurrent)](https://goreportcard.com/report/github.com/modern-go/concurrent) +[![License](https://img.shields.io/badge/License-Apache%202.0-blue.svg)](https://raw.githubusercontent.com/modern-go/concurrent/master/LICENSE) + +* concurrent.Map: backport sync.Map for go below 1.9 +* concurrent.Executor: goroutine with explicit ownership and cancellable + +# concurrent.Map + +because sync.Map is only available in go 1.9, we can use concurrent.Map to make code portable + +```go +m := concurrent.NewMap() +m.Store("hello", "world") +elem, found := m.Load("hello") +// elem will be "world" +// found will be true +``` + +# concurrent.Executor + +```go +executor := concurrent.NewUnboundedExecutor() +executor.Go(func(ctx context.Context) { + everyMillisecond := time.NewTicker(time.Millisecond) + for { + select { + case <-ctx.Done(): + fmt.Println("goroutine exited") + return + case <-everyMillisecond.C: + // do something + } + } +}) +time.Sleep(time.Second) +executor.StopAndWaitForever() +fmt.Println("executor stopped") +``` + +attach goroutine to executor instance, so that we can + +* cancel it by stop the executor with Stop/StopAndWait/StopAndWaitForever +* handle panic by callback: the default behavior will no longer crash your application \ No newline at end of file diff --git a/vendor/github.com/modern-go/concurrent/executor.go b/vendor/github.com/modern-go/concurrent/executor.go index 56e5d22bf9..623dba1ac0 100644 --- a/vendor/github.com/modern-go/concurrent/executor.go +++ b/vendor/github.com/modern-go/concurrent/executor.go @@ -2,6 +2,13 @@ package concurrent import "context" +// Executor replace go keyword to start a new goroutine +// the goroutine should cancel itself if the context passed in has been cancelled +// the goroutine started by the executor, is owned by the executor +// we can cancel all executors owned by the executor just by stop the executor itself +// however Executor interface does not Stop method, the one starting and owning executor +// should use the concrete type of executor, instead of this interface. type Executor interface { + // Go starts a new goroutine controlled by the context Go(handler func(ctx context.Context)) -} \ No newline at end of file +} diff --git a/vendor/github.com/modern-go/concurrent/go_above_19.go b/vendor/github.com/modern-go/concurrent/go_above_19.go index a9f2593478..aeabf8c4f9 100644 --- a/vendor/github.com/modern-go/concurrent/go_above_19.go +++ b/vendor/github.com/modern-go/concurrent/go_above_19.go @@ -4,10 +4,12 @@ package concurrent import "sync" +// Map is a wrapper for sync.Map introduced in go1.9 type Map struct { sync.Map } +// NewMap creates a thread safe Map func NewMap() *Map { return &Map{} -} \ No newline at end of file +} diff --git a/vendor/github.com/modern-go/concurrent/go_below_19.go b/vendor/github.com/modern-go/concurrent/go_below_19.go index 3f79f4fe48..b9c8df7f41 100644 --- a/vendor/github.com/modern-go/concurrent/go_below_19.go +++ b/vendor/github.com/modern-go/concurrent/go_below_19.go @@ -4,17 +4,20 @@ package concurrent import "sync" +// Map implements a thread safe map for go version below 1.9 using mutex type Map struct { lock sync.RWMutex data map[interface{}]interface{} } +// NewMap creates a thread safe map func NewMap() *Map { return &Map{ data: make(map[interface{}]interface{}, 32), } } +// Load is same as sync.Map Load func (m *Map) Load(key interface{}) (elem interface{}, found bool) { m.lock.RLock() elem, found = m.data[key] @@ -22,9 +25,9 @@ func (m *Map) Load(key interface{}) (elem interface{}, found bool) { return } +// Load is same as sync.Map Store func (m *Map) Store(key interface{}, elem interface{}) { m.lock.Lock() m.data[key] = elem m.lock.Unlock() } - diff --git a/vendor/github.com/modern-go/concurrent/log.go b/vendor/github.com/modern-go/concurrent/log.go new file mode 100644 index 0000000000..9756fcc75a --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/log.go @@ -0,0 +1,13 @@ +package concurrent + +import ( + "os" + "log" + "io/ioutil" +) + +// ErrorLogger is used to print out error, can be set to writer other than stderr +var ErrorLogger = log.New(os.Stderr, "", 0) + +// InfoLogger is used to print informational message, default to off +var InfoLogger = log.New(ioutil.Discard, "", 0) \ No newline at end of file diff --git a/vendor/github.com/modern-go/concurrent/test.sh b/vendor/github.com/modern-go/concurrent/test.sh new file mode 100644 index 0000000000..d1e6b2ec55 --- /dev/null +++ b/vendor/github.com/modern-go/concurrent/test.sh @@ -0,0 +1,12 @@ +#!/usr/bin/env bash + +set -e +echo "" > coverage.txt + +for d in $(go list ./... | grep -v vendor); do + go test -coverprofile=profile.out -coverpkg=github.com/modern-go/concurrent $d + if [ -f profile.out ]; then + cat profile.out >> coverage.txt + rm profile.out + fi +done diff --git a/vendor/github.com/modern-go/concurrent/unbounded_executor.go b/vendor/github.com/modern-go/concurrent/unbounded_executor.go index 70a1cf0f18..05a77dceb1 100644 --- a/vendor/github.com/modern-go/concurrent/unbounded_executor.go +++ b/vendor/github.com/modern-go/concurrent/unbounded_executor.go @@ -4,33 +4,37 @@ import ( "context" "fmt" "runtime" + "runtime/debug" "sync" "time" - "runtime/debug" + "reflect" ) -var LogInfo = func(event string, properties ...interface{}) { -} - -var LogPanic = func(recovered interface{}, properties ...interface{}) interface{} { - fmt.Println(fmt.Sprintf("paniced: %v", recovered)) - debug.PrintStack() - return recovered +// HandlePanic logs goroutine panic by default +var HandlePanic = func(recovered interface{}, funcName string) { + ErrorLogger.Println(fmt.Sprintf("%s panic: %v", funcName, recovered)) + ErrorLogger.Println(string(debug.Stack())) } -const StopSignal = "STOP!" - +// UnboundedExecutor is a executor without limits on counts of alive goroutines +// it tracks the goroutine started by it, and can cancel them when shutdown type UnboundedExecutor struct { ctx context.Context cancel context.CancelFunc activeGoroutinesMutex *sync.Mutex activeGoroutines map[string]int + HandlePanic func(recovered interface{}, funcName string) } // GlobalUnboundedExecutor has the life cycle of the program itself // any goroutine want to be shutdown before main exit can be started from this executor +// GlobalUnboundedExecutor expects the main function to call stop +// it does not magically knows the main function exits var GlobalUnboundedExecutor = NewUnboundedExecutor() +// NewUnboundedExecutor creates a new UnboundedExecutor, +// UnboundedExecutor can not be created by &UnboundedExecutor{} +// HandlePanic can be set with a callback to override global HandlePanic func NewUnboundedExecutor() *UnboundedExecutor { ctx, cancel := context.WithCancel(context.TODO()) return &UnboundedExecutor{ @@ -41,8 +45,13 @@ func NewUnboundedExecutor() *UnboundedExecutor { } } +// Go starts a new goroutine and tracks its lifecycle. +// Panic will be recovered and logged automatically, except for StopSignal func (executor *UnboundedExecutor) Go(handler func(ctx context.Context)) { - _, file, line, _ := runtime.Caller(1) + pc := reflect.ValueOf(handler).Pointer() + f := runtime.FuncForPC(pc) + funcName := f.Name() + file, line := f.FileLine(pc) executor.activeGoroutinesMutex.Lock() defer executor.activeGoroutinesMutex.Unlock() startFrom := fmt.Sprintf("%s:%d", file, line) @@ -50,46 +59,57 @@ func (executor *UnboundedExecutor) Go(handler func(ctx context.Context)) { go func() { defer func() { recovered := recover() - if recovered != nil && recovered != StopSignal { - LogPanic(recovered) + // if you want to quit a goroutine without trigger HandlePanic + // use runtime.Goexit() to quit + if recovered != nil { + if executor.HandlePanic == nil { + HandlePanic(recovered, funcName) + } else { + executor.HandlePanic(recovered, funcName) + } } executor.activeGoroutinesMutex.Lock() - defer executor.activeGoroutinesMutex.Unlock() executor.activeGoroutines[startFrom] -= 1 + executor.activeGoroutinesMutex.Unlock() }() handler(executor.ctx) }() } +// Stop cancel all goroutines started by this executor without wait func (executor *UnboundedExecutor) Stop() { executor.cancel() } +// StopAndWaitForever cancel all goroutines started by this executor and +// wait until all goroutines exited func (executor *UnboundedExecutor) StopAndWaitForever() { executor.StopAndWait(context.Background()) } +// StopAndWait cancel all goroutines started by this executor and wait. +// Wait can be cancelled by the context passed in. func (executor *UnboundedExecutor) StopAndWait(ctx context.Context) { executor.cancel() for { - fiveSeconds := time.NewTimer(time.Millisecond * 100) + oneHundredMilliseconds := time.NewTimer(time.Millisecond * 100) select { - case <-fiveSeconds.C: + case <-oneHundredMilliseconds.C: + if executor.checkNoActiveGoroutines() { + return + } case <-ctx.Done(): return } - if executor.checkGoroutines() { - return - } } } -func (executor *UnboundedExecutor) checkGoroutines() bool { +func (executor *UnboundedExecutor) checkNoActiveGoroutines() bool { executor.activeGoroutinesMutex.Lock() defer executor.activeGoroutinesMutex.Unlock() for startFrom, count := range executor.activeGoroutines { if count > 0 { - LogInfo("event!unbounded_executor.still waiting goroutines to quit", + InfoLogger.Println("UnboundedExecutor is still waiting goroutines to quit", "startFrom", startFrom, "count", count) return false diff --git a/vendor/golang.org/x/net/html/parse.go b/vendor/golang.org/x/net/html/parse.go index 1d3c198ae7..488e8d3cd6 100644 --- a/vendor/golang.org/x/net/html/parse.go +++ b/vendor/golang.org/x/net/html/parse.go @@ -439,6 +439,9 @@ func (p *parser) resetInsertionMode() { case a.Select: if !last { for ancestor, first := n, p.oe[0]; ancestor != first; { + if ancestor == first { + break + } ancestor = p.oe[p.oe.index(ancestor)-1] switch ancestor.DataAtom { case a.Template: @@ -901,7 +904,7 @@ func inBodyIM(p *parser) bool { case a.A: for i := len(p.afe) - 1; i >= 0 && p.afe[i].Type != scopeMarkerNode; i-- { if n := p.afe[i]; n.Type == ElementNode && n.DataAtom == a.A { - p.inBodyEndTagFormatting(a.A, "a") + p.inBodyEndTagFormatting(a.A) p.oe.remove(n) p.afe.remove(n) break @@ -915,7 +918,7 @@ func inBodyIM(p *parser) bool { case a.Nobr: p.reconstructActiveFormattingElements() if p.elementInScope(defaultScope, a.Nobr) { - p.inBodyEndTagFormatting(a.Nobr, "nobr") + p.inBodyEndTagFormatting(a.Nobr) p.reconstructActiveFormattingElements() } p.addFormattingElement() @@ -1123,7 +1126,7 @@ func inBodyIM(p *parser) bool { case a.H1, a.H2, a.H3, a.H4, a.H5, a.H6: p.popUntil(defaultScope, a.H1, a.H2, a.H3, a.H4, a.H5, a.H6) case a.A, a.B, a.Big, a.Code, a.Em, a.Font, a.I, a.Nobr, a.S, a.Small, a.Strike, a.Strong, a.Tt, a.U: - p.inBodyEndTagFormatting(p.tok.DataAtom, p.tok.Data) + p.inBodyEndTagFormatting(p.tok.DataAtom) case a.Applet, a.Marquee, a.Object: if p.popUntil(defaultScope, p.tok.DataAtom) { p.clearActiveFormattingElements() @@ -1134,7 +1137,7 @@ func inBodyIM(p *parser) bool { case a.Template: return inHeadIM(p) default: - p.inBodyEndTagOther(p.tok.DataAtom, p.tok.Data) + p.inBodyEndTagOther(p.tok.DataAtom) } case CommentToken: p.addChild(&Node{ @@ -1161,7 +1164,7 @@ func inBodyIM(p *parser) bool { return true } -func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom, tagName string) { +func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom) { // This is the "adoption agency" algorithm, described at // https://html.spec.whatwg.org/multipage/syntax.html#adoptionAgency @@ -1183,7 +1186,7 @@ func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom, tagName string) { } } if formattingElement == nil { - p.inBodyEndTagOther(tagAtom, tagName) + p.inBodyEndTagOther(tagAtom) return } feIndex := p.oe.index(formattingElement) @@ -1288,17 +1291,9 @@ func (p *parser) inBodyEndTagFormatting(tagAtom a.Atom, tagName string) { // inBodyEndTagOther performs the "any other end tag" algorithm for inBodyIM. // "Any other end tag" handling from 12.2.6.5 The rules for parsing tokens in foreign content // https://html.spec.whatwg.org/multipage/syntax.html#parsing-main-inforeign -func (p *parser) inBodyEndTagOther(tagAtom a.Atom, tagName string) { +func (p *parser) inBodyEndTagOther(tagAtom a.Atom) { for i := len(p.oe) - 1; i >= 0; i-- { - // Two element nodes have the same tag if they have the same Data (a - // string-typed field). As an optimization, for common HTML tags, each - // Data string is assigned a unique, non-zero DataAtom (a uint32-typed - // field), since integer comparison is faster than string comparison. - // Uncommon (custom) tags get a zero DataAtom. - // - // The if condition here is equivalent to (p.oe[i].Data == tagName). - if (p.oe[i].DataAtom == tagAtom) && - ((tagAtom != 0) || (p.oe[i].Data == tagName)) { + if p.oe[i].DataAtom == tagAtom { p.oe = p.oe[:i] break } diff --git a/vendor/golang.org/x/net/http2/frame.go b/vendor/golang.org/x/net/http2/frame.go index 514c126c5f..b46791d1da 100644 --- a/vendor/golang.org/x/net/http2/frame.go +++ b/vendor/golang.org/x/net/http2/frame.go @@ -643,7 +643,7 @@ func (f *Framer) WriteData(streamID uint32, endStream bool, data []byte) error { return f.WriteDataPadded(streamID, endStream, data, nil) } -// WriteDataPadded writes a DATA frame with optional padding. +// WriteData writes a DATA frame with optional padding. // // If pad is nil, the padding bit is not sent. // The length of pad must not exceed 255 bytes. diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index 8f1701914c..6f8e8b0d98 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -52,10 +52,11 @@ import ( ) const ( - prefaceTimeout = 10 * time.Second - firstSettingsTimeout = 2 * time.Second // should be in-flight with preface anyway - handlerChunkWriteSize = 4 << 10 - defaultMaxStreams = 250 // TODO: make this 100 as the GFE seems to? + prefaceTimeout = 10 * time.Second + firstSettingsTimeout = 2 * time.Second // should be in-flight with preface anyway + handlerChunkWriteSize = 4 << 10 + defaultMaxStreams = 250 // TODO: make this 100 as the GFE seems to? + maxQueuedControlFrames = 10000 ) var ( @@ -163,6 +164,15 @@ func (s *Server) maxConcurrentStreams() uint32 { return defaultMaxStreams } +// maxQueuedControlFrames is the maximum number of control frames like +// SETTINGS, PING and RST_STREAM that will be queued for writing before +// the connection is closed to prevent memory exhaustion attacks. +func (s *Server) maxQueuedControlFrames() int { + // TODO: if anybody asks, add a Server field, and remember to define the + // behavior of negative values. + return maxQueuedControlFrames +} + type serverInternalState struct { mu sync.Mutex activeConns map[*serverConn]struct{} @@ -482,6 +492,7 @@ type serverConn struct { sawFirstSettings bool // got the initial SETTINGS frame after the preface needToSendSettingsAck bool unackedSettings int // how many SETTINGS have we sent without ACKs? + queuedControlFrames int // control frames in the writeSched queue clientMaxStreams uint32 // SETTINGS_MAX_CONCURRENT_STREAMS from client (our PUSH_PROMISE limit) advMaxStreams uint32 // our SETTINGS_MAX_CONCURRENT_STREAMS advertised the client curClientStreams uint32 // number of open streams initiated by the client @@ -870,6 +881,14 @@ func (sc *serverConn) serve() { } } + // If the peer is causing us to generate a lot of control frames, + // but not reading them from us, assume they are trying to make us + // run out of memory. + if sc.queuedControlFrames > sc.srv.maxQueuedControlFrames() { + sc.vlogf("http2: too many control frames in send queue, closing connection") + return + } + // Start the shutdown timer after sending a GOAWAY. When sending GOAWAY // with no error code (graceful shutdown), don't start the timer until // all open streams have been completed. @@ -1069,6 +1088,14 @@ func (sc *serverConn) writeFrame(wr FrameWriteRequest) { } if !ignoreWrite { + if wr.isControl() { + sc.queuedControlFrames++ + // For extra safety, detect wraparounds, which should not happen, + // and pull the plug. + if sc.queuedControlFrames < 0 { + sc.conn.Close() + } + } sc.writeSched.Push(wr) } sc.scheduleFrameWrite() @@ -1186,10 +1213,8 @@ func (sc *serverConn) wroteFrame(res frameWriteResult) { // If a frame is already being written, nothing happens. This will be called again // when the frame is done being written. // -// If a frame isn't being written we need to send one, the best frame -// to send is selected, preferring first things that aren't -// stream-specific (e.g. ACKing settings), and then finding the -// highest priority stream. +// If a frame isn't being written and we need to send one, the best frame +// to send is selected by writeSched. // // If a frame isn't being written and there's nothing else to send, we // flush the write buffer. @@ -1217,6 +1242,9 @@ func (sc *serverConn) scheduleFrameWrite() { } if !sc.inGoAway || sc.goAwayCode == ErrCodeNo { if wr, ok := sc.writeSched.Pop(); ok { + if wr.isControl() { + sc.queuedControlFrames-- + } sc.startFrameWrite(wr) continue } @@ -1509,6 +1537,8 @@ func (sc *serverConn) processSettings(f *SettingsFrame) error { if err := f.ForeachSetting(sc.processSetting); err != nil { return err } + // TODO: judging by RFC 7540, Section 6.5.3 each SETTINGS frame should be + // acknowledged individually, even if multiple are received before the ACK. sc.needToSendSettingsAck = true sc.scheduleFrameWrite() return nil diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index 4ec0792eb5..f272e8f9fa 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -1411,11 +1411,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail // followed by the query production (see Sections 3.3 and 3.4 of // [RFC3986]). f(":authority", host) - m := req.Method - if m == "" { - m = http.MethodGet - } - f(":method", m) + f(":method", req.Method) if req.Method != "CONNECT" { f(":path", path) f(":scheme", req.URL.Scheme) diff --git a/vendor/golang.org/x/net/http2/writesched.go b/vendor/golang.org/x/net/http2/writesched.go index 4fe3073073..f24d2b1e7d 100644 --- a/vendor/golang.org/x/net/http2/writesched.go +++ b/vendor/golang.org/x/net/http2/writesched.go @@ -32,7 +32,7 @@ type WriteScheduler interface { // Pop dequeues the next frame to write. Returns false if no frames can // be written. Frames with a given wr.StreamID() are Pop'd in the same - // order they are Push'd. + // order they are Push'd. No frames should be discarded except by CloseStream. Pop() (wr FrameWriteRequest, ok bool) } @@ -76,6 +76,12 @@ func (wr FrameWriteRequest) StreamID() uint32 { return wr.stream.id } +// isControl reports whether wr is a control frame for MaxQueuedControlFrames +// purposes. That includes non-stream frames and RST_STREAM frames. +func (wr FrameWriteRequest) isControl() bool { + return wr.stream == nil +} + // DataSize returns the number of flow control bytes that must be consumed // to write this entire frame. This is 0 for non-DATA frames. func (wr FrameWriteRequest) DataSize() int { diff --git a/vendor/golang.org/x/text/encoding/encoding.go b/vendor/golang.org/x/text/encoding/encoding.go index 221f175c01..a0bd7cd4d0 100644 --- a/vendor/golang.org/x/text/encoding/encoding.go +++ b/vendor/golang.org/x/text/encoding/encoding.go @@ -124,7 +124,7 @@ func (e *Encoder) Writer(w io.Writer) io.Writer { } // ASCIISub is the ASCII substitute character, as recommended by -// http://unicode.org/reports/tr36/#Text_Comparison +// https://unicode.org/reports/tr36/#Text_Comparison const ASCIISub = '\x1a' // Nop is the nop encoding. Its transformed bytes are the same as the source diff --git a/vendor/golang.org/x/text/encoding/htmlindex/tables.go b/vendor/golang.org/x/text/encoding/htmlindex/tables.go index 9d6b4315c2..f074e2c6da 100644 --- a/vendor/golang.org/x/text/encoding/htmlindex/tables.go +++ b/vendor/golang.org/x/text/encoding/htmlindex/tables.go @@ -306,6 +306,7 @@ var nameMap = map[string]htmlEncoding{ "iso-2022-cn": replacement, "iso-2022-cn-ext": replacement, "iso-2022-kr": replacement, + "replacement": replacement, "utf-16be": utf16be, "utf-16": utf16le, "utf-16le": utf16le, diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go index 7351b4ef8a..5c9b85c280 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go @@ -34,7 +34,7 @@ package identifier // - http://www.iana.org/assignments/character-sets/character-sets.xhtml // - http://www.iana.org/assignments/ianacharset-mib/ianacharset-mib // - http://www.ietf.org/rfc/rfc2978.txt -// - http://www.unicode.org/reports/tr22/ +// - https://www.unicode.org/reports/tr22/ // - http://www.w3.org/TR/encoding/ // - https://encoding.spec.whatwg.org/ // - https://encoding.spec.whatwg.org/encodings.json diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go index 768842b0a5..8cc29021c8 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go @@ -884,27 +884,27 @@ const ( // CESU8 is the MIB identifier with IANA name CESU-8. // - // http://www.unicode.org/unicode/reports/tr26 + // https://www.unicode.org/unicode/reports/tr26 CESU8 MIB = 1016 // UTF32 is the MIB identifier with IANA name UTF-32. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/unicode/reports/tr19/ UTF32 MIB = 1017 // UTF32BE is the MIB identifier with IANA name UTF-32BE. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/unicode/reports/tr19/ UTF32BE MIB = 1018 // UTF32LE is the MIB identifier with IANA name UTF-32LE. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/unicode/reports/tr19/ UTF32LE MIB = 1019 // BOCU1 is the MIB identifier with IANA name BOCU-1. // - // http://www.unicode.org/notes/tn6/ + // https://www.unicode.org/notes/tn6/ BOCU1 MIB = 1020 // Windows30Latin1 is the MIB identifier with IANA name ISO-8859-1-Windows-3.0-Latin-1. diff --git a/vendor/golang.org/x/text/encoding/unicode/unicode.go b/vendor/golang.org/x/text/encoding/unicode/unicode.go index 579cadfb12..4850ff365b 100644 --- a/vendor/golang.org/x/text/encoding/unicode/unicode.go +++ b/vendor/golang.org/x/text/encoding/unicode/unicode.go @@ -145,7 +145,7 @@ func (utf8Decoder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err e // and consumed in a greater context that implies a certain endianness, use // IgnoreBOM. Otherwise, use ExpectBOM and always produce and consume a BOM. // -// In the language of http://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM +// In the language of https://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM // corresponds to "Where the precise type of the data stream is known... the // BOM should not be used" and ExpectBOM corresponds to "A particular // protocol... may require use of the BOM". diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/internal/language/common.go similarity index 50% rename from vendor/golang.org/x/text/language/common.go rename to vendor/golang.org/x/text/internal/language/common.go index 9d86e18554..cdfdb74971 100644 --- a/vendor/golang.org/x/text/language/common.go +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -4,13 +4,13 @@ package language // This file contains code common to the maketables.go and the package code. -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 +// AliasType is the type of an alias in AliasMap. +type AliasType int8 const ( - langDeprecated langAliasType = iota - langMacro - langLegacy + Deprecated AliasType = iota + Macro + Legacy - langAliasTypeUnknown langAliasType = -1 + AliasTypeUnknown AliasType = -1 ) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 0000000000..46a0015074 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000000..1b36935ef7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000000..83816a72a8 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000000..8d810723c7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000000..554ca354b6 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x0581f000, + 0x0581f032, 0x05857000, 0x05857032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000, + 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105, + 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd, + 0x43257105, 0x4325714d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000, + 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000, + 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000, + 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000, + 0x528000ba, 0x52900000, 0x52938000, 0x52938053, + 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000, + // Entry 300 - 31F + 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: F4E57D15 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000000..ca135d295a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000000..4ae78e0fa5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000000..9b20b88feb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 0000000000..1e74d1affd --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,596 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +func (t Tag) TypeForKey(key string) string { + if start, end, _ := t.findTypeForKey(key); end != start { + return t.str[start:end] + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, end, _ := t.findTypeForKey(key) + if start != end { + // Remove key tag and leading '-'. + start -= 4 + + // Remove a possible empty extension. + if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, end, hasExt := t.findTypeForKey(key) + if start == end { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + // p points to the hyphen preceding the current token. + if p3 := p + 3; s[p3] == '-' { + // Found a key. + // Check whether we just processed the key that was requested. + if curKey == key { + return start, p, true + } + // Set to the next key and continue scanning type tokens. + curKey = s[p+1 : p3] + if curKey > key { + return p, p, true + } + // Start of the type token sequence. + start = p + 4 + // A type is at least 3 characters long. + p += 7 // 4 + 3 + } else { + // Attribute or type, which is at least 3 characters long. + p += 4 + } + // p points past the third character of a type or attribute. + max := p + 5 // maximum length of token plus hyphen. + if len(s) < max { + max = len(s) + } + for ; p < max && s[p] != '-'; p++ { + } + // Bail if we have exhausted all tokens or if the next token starts + // a new extension. + if p == len(s) || s[p+2] == '-' { + if curKey == key { + return start, p, true + } + return p, p, true + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Language, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go similarity index 80% rename from vendor/golang.org/x/text/language/lookup.go rename to vendor/golang.org/x/text/internal/language/lookup.go index 1d80ac3708..6294b81524 100644 --- a/vendor/golang.org/x/text/language/lookup.go +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -17,11 +17,11 @@ import ( // if it could not be found. func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { if !tag.FixCase(form, key) { - return 0, errSyntax + return 0, ErrSyntax } i := idx.Index(key) if i == -1 { - return 0, mkErrInvalid(key) + return 0, NewValueError(key) } return i, nil } @@ -32,38 +32,45 @@ func searchUint(imap []uint16, key uint16) int { }) } -type langID uint16 +type Language uint16 // getLangID returns the langID of s if s is a canonical subtag // or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (langID, error) { +func getLangID(s []byte) (Language, error) { if len(s) == 2 { return getLangISO2(s) } return getLangISO3(s) } +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + // mapLang returns the mapped langID of id according to mapping m. -func normLang(id langID) (langID, langAliasType) { - k := sort.Search(len(langAliasMap), func(i int) bool { - return langAliasMap[i].from >= uint16(id) +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) }) - if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) { - return langID(langAliasMap[k].to), langAliasTypes[k] + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] } - return id, langAliasTypeUnknown + return id, AliasTypeUnknown } // getLangISO2 returns the langID for the given 2-letter ISO language code // or unknownLang if this does not exist. -func getLangISO2(s []byte) (langID, error) { +func getLangISO2(s []byte) (Language, error) { if !tag.FixCase("zz", s) { - return 0, errSyntax + return 0, ErrSyntax } if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return langID(i), nil + return Language(i), nil } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } const base = 'z' - 'a' + 1 @@ -88,7 +95,7 @@ func intToStr(v uint, s []byte) { // getLangISO3 returns the langID for the given 3-letter ISO language code // or unknownLang if this does not exist. -func getLangISO3(s []byte) (langID, error) { +func getLangISO3(s []byte) (Language, error) { if tag.FixCase("und", s) { // first try to match canonical 3-letter entries for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { @@ -96,7 +103,7 @@ func getLangISO3(s []byte) (langID, error) { // We treat "und" as special and always translate it to "unspecified". // Note that ZZ and Zzzz are private use and are not treated as // unspecified by default. - id := langID(i) + id := Language(i) if id == nonCanonicalUnd { return 0, nil } @@ -104,26 +111,26 @@ func getLangISO3(s []byte) (langID, error) { } } if i := altLangISO3.Index(s); i != -1 { - return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil } n := strToInt(s) if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return langID(n) + langNoIndexOffset, nil + return Language(n) + langNoIndexOffset, nil } // Check for non-canonical uses of ISO3. for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return langID(i), nil + return Language(i), nil } } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } - return 0, errSyntax + return 0, ErrSyntax } -// stringToBuf writes the string to b and returns the number of bytes +// StringToBuf writes the string to b and returns the number of bytes // written. cap(b) must be >= 3. -func (id langID) stringToBuf(b []byte) int { +func (id Language) StringToBuf(b []byte) int { if id >= langNoIndexOffset { intToStr(uint(id)-langNoIndexOffset, b[:3]) return 3 @@ -140,7 +147,7 @@ func (id langID) stringToBuf(b []byte) int { // String returns the BCP 47 representation of the langID. // Use b as variable name, instead of id, to ensure the variable // used is consistent with that of Base in which this type is embedded. -func (b langID) String() string { +func (b Language) String() string { if b == 0 { return "und" } else if b >= langNoIndexOffset { @@ -157,7 +164,7 @@ func (b langID) String() string { } // ISO3 returns the ISO 639-3 language code. -func (b langID) ISO3() string { +func (b Language) ISO3() string { if b == 0 || b >= langNoIndexOffset { return b.String() } @@ -173,15 +180,24 @@ func (b langID) ISO3() string { } // IsPrivateUse reports whether this language code is reserved for private use. -func (b langID) IsPrivateUse() bool { +func (b Language) IsPrivateUse() bool { return langPrivateStart <= b && b <= langPrivateEnd } -type regionID uint16 +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 // getRegionID returns the region id for s if s is a valid 2-letter region code // or unknownRegion. -func getRegionID(s []byte) (regionID, error) { +func getRegionID(s []byte) (Region, error) { if len(s) == 3 { if isAlpha(s[0]) { return getRegionISO3(s) @@ -195,34 +211,34 @@ func getRegionID(s []byte) (regionID, error) { // getRegionISO2 returns the regionID for the given 2-letter ISO country code // or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (regionID, error) { +func getRegionISO2(s []byte) (Region, error) { i, err := findIndex(regionISO, s, "ZZ") if err != nil { return 0, err } - return regionID(i) + isoRegionOffset, nil + return Region(i) + isoRegionOffset, nil } // getRegionISO3 returns the regionID for the given 3-letter ISO country code // or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (regionID, error) { +func getRegionISO3(s []byte) (Region, error) { if tag.FixCase("ZZZ", s) { for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return regionID(i) + isoRegionOffset, nil + return Region(i) + isoRegionOffset, nil } } for i := 0; i < len(altRegionISO3); i += 3 { if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return regionID(altRegionIDs[i/3]), nil + return Region(altRegionIDs[i/3]), nil } } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } - return 0, errSyntax + return 0, ErrSyntax } -func getRegionM49(n int) (regionID, error) { +func getRegionM49(n int) (Region, error) { if 0 < n && n <= 999 { const ( searchBits = 7 @@ -236,7 +252,7 @@ func getRegionM49(n int) (regionID, error) { return buf[i] >= val }) if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return regionID(r & regionMask), nil + return Region(r & regionMask), nil } } var e ValueError @@ -247,13 +263,13 @@ func getRegionM49(n int) (regionID, error) { // normRegion returns a region if r is deprecated or 0 otherwise. // TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). // TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r regionID) regionID { +func normRegion(r Region) Region { m := regionOldMap k := sort.Search(len(m), func(i int) bool { - return m[i].from >= uint16(r) + return m[i].From >= uint16(r) }) - if k < len(m) && m[k].from == uint16(r) { - return regionID(m[k].to) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) } return 0 } @@ -264,13 +280,13 @@ const ( bcp47Region ) -func (r regionID) typ() byte { +func (r Region) typ() byte { return regionTypes[r] } // String returns the BCP 47 representation for the region. // It returns "ZZ" for an unspecified region. -func (r regionID) String() string { +func (r Region) String() string { if r < isoRegionOffset { if r == 0 { return "ZZ" @@ -284,7 +300,7 @@ func (r regionID) String() string { // ISO3 returns the 3-letter ISO code of r. // Note that not all regions have a 3-letter ISO code. // In such cases this method returns "ZZZ". -func (r regionID) ISO3() string { +func (r Region) ISO3() string { if r < isoRegionOffset { return "ZZZ" } @@ -301,29 +317,29 @@ func (r regionID) ISO3() string { // M49 returns the UN M.49 encoding of r, or 0 if this encoding // is not defined for r. -func (r regionID) M49() int { +func (r Region) M49() int { return int(m49[r]) } // IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This // may include private-use tags that are assigned by CLDR and used in this // implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r regionID) IsPrivateUse() bool { +func (r Region) IsPrivateUse() bool { return r.typ()&iso3166UserAssigned != 0 } -type scriptID uint8 +type Script uint8 // getScriptID returns the script id for string s. It assumes that s // is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (scriptID, error) { +func getScriptID(idx tag.Index, s []byte) (Script, error) { i, err := findIndex(idx, s, "Zzzz") - return scriptID(i), err + return Script(i), err } // String returns the script code in title case. // It returns "Zzzz" for an unspecified script. -func (s scriptID) String() string { +func (s Script) String() string { if s == 0 { return "Zzzz" } @@ -331,7 +347,7 @@ func (s scriptID) String() string { } // IsPrivateUse reports whether this script code is reserved for private use. -func (s scriptID) IsPrivateUse() bool { +func (s Script) IsPrivateUse() bool { return _Qaaa <= s && s <= _Qabx } @@ -389,7 +405,7 @@ func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { if v < 0 { return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true } - t.lang = langID(v) + t.LangID = Language(v) return t, true } return t, false diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000000..75a2dbca76 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000000..2be83e1da5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,594 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + if end < cap(s.b) { + b := make([]byte, len(s.b)+diff) + copy(b, s.b[:oldStart]) + copy(b[end:], s.b[oldEnd:]) + s.b = b + } else { + s.b = append(s.b[end:], s.b[oldEnd:]...) + } + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +func parseTag(scan *scanner) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + copy(scan.b[langStart:], lang.String()) + scan.b[langStart+3] = '-' + scan.start = langStart + 4 + } + scan.gobble(e) + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + keyEnd := scan.end + end = scan.acceptMinSize(3) + // TODO: check key value validity + if keyEnd == end || bytes.Compare(key, last) != 1 { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart, keyEnd := scan.start, scan.end + end = scan.acceptMinSize(3) + if keyEnd != end { + keys = append(keys, scan.b[keyStart:end]) + } else { + scan.setError(ErrSyntax) + end = keyStart + } + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000000..239e2d29eb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3431 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8665 + +const NumScripts = 242 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, + 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 656 bytes, 164 elements +var AliasMap = [164]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x73e, To: 0x21a1}, + 20: {From: 0x7b3, To: 0x56}, + 21: {From: 0x7b9, To: 0x299b}, + 22: {From: 0x7c5, To: 0x58}, + 23: {From: 0x7e6, To: 0x145}, + 24: {From: 0x80c, To: 0x5a}, + 25: {From: 0x815, To: 0x8d}, + 26: {From: 0x87e, To: 0x810}, + 27: {From: 0x8c3, To: 0xee3}, + 28: {From: 0x9ef, To: 0x331}, + 29: {From: 0xa36, To: 0x2c5}, + 30: {From: 0xa3d, To: 0xbf}, + 31: {From: 0xabe, To: 0x3322}, + 32: {From: 0xb38, To: 0x529}, + 33: {From: 0xb75, To: 0x265a}, + 34: {From: 0xb7e, To: 0xbc3}, + 35: {From: 0xb9b, To: 0x44e}, + 36: {From: 0xbbc, To: 0x4229}, + 37: {From: 0xbbf, To: 0x529}, + 38: {From: 0xbfe, To: 0x2da7}, + 39: {From: 0xc2e, To: 0x3181}, + 40: {From: 0xcb9, To: 0xf3}, + 41: {From: 0xd08, To: 0xfa}, + 42: {From: 0xdc8, To: 0x11a}, + 43: {From: 0xdd7, To: 0x32d}, + 44: {From: 0xdf8, To: 0xdfb}, + 45: {From: 0xdfe, To: 0x531}, + 46: {From: 0xedf, To: 0x205a}, + 47: {From: 0xeee, To: 0x2e9a}, + 48: {From: 0xf39, To: 0x367}, + 49: {From: 0x10d0, To: 0x140}, + 50: {From: 0x1104, To: 0x2d0}, + 51: {From: 0x11a0, To: 0x1ec}, + 52: {From: 0x1279, To: 0x21}, + 53: {From: 0x1424, To: 0x15e}, + 54: {From: 0x1470, To: 0x14e}, + 55: {From: 0x151f, To: 0xd9b}, + 56: {From: 0x1523, To: 0x390}, + 57: {From: 0x1532, To: 0x19f}, + 58: {From: 0x1580, To: 0x210}, + 59: {From: 0x1583, To: 0x10d}, + 60: {From: 0x15a3, To: 0x3caf}, + 61: {From: 0x166a, To: 0x19b}, + 62: {From: 0x16c8, To: 0x136}, + 63: {From: 0x1700, To: 0x29f8}, + 64: {From: 0x1718, To: 0x194}, + 65: {From: 0x1727, To: 0xf3f}, + 66: {From: 0x177a, To: 0x178}, + 67: {From: 0x1809, To: 0x17b6}, + 68: {From: 0x1816, To: 0x18f3}, + 69: {From: 0x188a, To: 0x436}, + 70: {From: 0x1979, To: 0x1d01}, + 71: {From: 0x1a74, To: 0x2bb0}, + 72: {From: 0x1a8a, To: 0x1f8}, + 73: {From: 0x1b5a, To: 0x1fa}, + 74: {From: 0x1b86, To: 0x1515}, + 75: {From: 0x1d64, To: 0x2c9b}, + 76: {From: 0x2038, To: 0x37b1}, + 77: {From: 0x203d, To: 0x20dd}, + 78: {From: 0x205a, To: 0x30b}, + 79: {From: 0x20e3, To: 0x274}, + 80: {From: 0x20ee, To: 0x263}, + 81: {From: 0x20f2, To: 0x22d}, + 82: {From: 0x20f9, To: 0x256}, + 83: {From: 0x210f, To: 0x21eb}, + 84: {From: 0x2135, To: 0x27d}, + 85: {From: 0x2160, To: 0x913}, + 86: {From: 0x2199, To: 0x121}, + 87: {From: 0x21ce, To: 0x1561}, + 88: {From: 0x21e6, To: 0x504}, + 89: {From: 0x21f4, To: 0x49f}, + 90: {From: 0x222d, To: 0x121}, + 91: {From: 0x2237, To: 0x121}, + 92: {From: 0x2262, To: 0x92a}, + 93: {From: 0x2316, To: 0x3226}, + 94: {From: 0x2382, To: 0x3365}, + 95: {From: 0x2472, To: 0x2c7}, + 96: {From: 0x24e4, To: 0x2ff}, + 97: {From: 0x24f0, To: 0x2fa}, + 98: {From: 0x24fa, To: 0x31f}, + 99: {From: 0x2550, To: 0xb5b}, + 100: {From: 0x25a9, To: 0xe2}, + 101: {From: 0x263e, To: 0x2d0}, + 102: {From: 0x26c9, To: 0x26b4}, + 103: {From: 0x26f9, To: 0x3c8}, + 104: {From: 0x2727, To: 0x3caf}, + 105: {From: 0x2765, To: 0x26b4}, + 106: {From: 0x2789, To: 0x4358}, + 107: {From: 0x28ef, To: 0x2837}, + 108: {From: 0x2914, To: 0x351}, + 109: {From: 0x2986, To: 0x2da7}, + 110: {From: 0x2b1a, To: 0x38d}, + 111: {From: 0x2bfc, To: 0x395}, + 112: {From: 0x2c3f, To: 0x3caf}, + 113: {From: 0x2cfc, To: 0x3be}, + 114: {From: 0x2d13, To: 0x597}, + 115: {From: 0x2d47, To: 0x148}, + 116: {From: 0x2d48, To: 0x148}, + 117: {From: 0x2dff, To: 0x2f1}, + 118: {From: 0x2e08, To: 0x19cc}, + 119: {From: 0x2e1a, To: 0x2d95}, + 120: {From: 0x2e21, To: 0x292}, + 121: {From: 0x2e54, To: 0x7d}, + 122: {From: 0x2e65, To: 0x2282}, + 123: {From: 0x2ea0, To: 0x2e9b}, + 124: {From: 0x2eef, To: 0x2ed7}, + 125: {From: 0x3193, To: 0x3c4}, + 126: {From: 0x3366, To: 0x338e}, + 127: {From: 0x342a, To: 0x3dc}, + 128: {From: 0x34ee, To: 0x18d0}, + 129: {From: 0x35c8, To: 0x2c9b}, + 130: {From: 0x35e6, To: 0x412}, + 131: {From: 0x3658, To: 0x246}, + 132: {From: 0x3676, To: 0x3f4}, + 133: {From: 0x36fd, To: 0x445}, + 134: {From: 0x37c0, To: 0x121}, + 135: {From: 0x3816, To: 0x38f2}, + 136: {From: 0x382b, To: 0x2c9b}, + 137: {From: 0x382f, To: 0xa9}, + 138: {From: 0x3832, To: 0x3228}, + 139: {From: 0x386c, To: 0x39a6}, + 140: {From: 0x3892, To: 0x3fc0}, + 141: {From: 0x38a5, To: 0x39d7}, + 142: {From: 0x38b4, To: 0x1fa4}, + 143: {From: 0x38b5, To: 0x2e9a}, + 144: {From: 0x395c, To: 0x47e}, + 145: {From: 0x3b4e, To: 0xd91}, + 146: {From: 0x3b78, To: 0x137}, + 147: {From: 0x3c99, To: 0x4bc}, + 148: {From: 0x3fbd, To: 0x100}, + 149: {From: 0x4208, To: 0xa91}, + 150: {From: 0x42be, To: 0x573}, + 151: {From: 0x42f9, To: 0x3f60}, + 152: {From: 0x4378, To: 0x25a}, + 153: {From: 0x43cb, To: 0x36cb}, + 154: {From: 0x43cd, To: 0x10f}, + 155: {From: 0x44af, To: 0x3322}, + 156: {From: 0x44e3, To: 0x512}, + 157: {From: 0x45ca, To: 0x2409}, + 158: {From: 0x45dd, To: 0x26dc}, + 159: {From: 0x4610, To: 0x48ae}, + 160: {From: 0x46ae, To: 0x46a0}, + 161: {From: 0x473e, To: 0x4745}, + 162: {From: 0x4916, To: 0x31f}, + 163: {From: 0x49a7, To: 0x523}, +} + +// Size: 164 bytes, 164 elements +var AliasTypes = [164]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, + // Entry 40 - 7F + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, + 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, + 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, + // Entry 80 - BF + 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, + 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, + 0, 1, 1, 1, +} + +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 976 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + + "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + + "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + + "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + + "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + + "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + + "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + + "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + + "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + + "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + + "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + + "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + + "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, + // Entry 140 - 17F + 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 480 - 4BF + 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 1615 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x4d, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x4f, + "aluku": 0x7, + "ao1990": 0x8, + "arevela": 0x9, + "arevmda": 0xa, + "asante": 0xb, + "baku1926": 0xc, + "balanka": 0xd, + "barla": 0xe, + "basiceng": 0xf, + "bauddha": 0x10, + "biscayan": 0x11, + "biske": 0x48, + "bohoric": 0x12, + "boont": 0x13, + "colb1945": 0x14, + "cornu": 0x15, + "dajnko": 0x16, + "ekavsk": 0x17, + "emodeng": 0x18, + "fonipa": 0x50, + "fonnapa": 0x51, + "fonupa": 0x52, + "fonxsamp": 0x53, + "hepburn": 0x19, + "heploc": 0x4e, + "hognorsk": 0x1a, + "hsistemo": 0x1b, + "ijekavsk": 0x1c, + "itihasa": 0x1d, + "jauer": 0x1e, + "jyutping": 0x1f, + "kkcor": 0x20, + "kociewie": 0x21, + "kscor": 0x22, + "laukika": 0x23, + "lipaw": 0x49, + "luna1918": 0x24, + "metelko": 0x25, + "monoton": 0x26, + "ndyuka": 0x27, + "nedis": 0x28, + "newfound": 0x29, + "njiva": 0x4a, + "nulik": 0x2a, + "osojs": 0x4b, + "oxendict": 0x2b, + "pahawh2": 0x2c, + "pahawh3": 0x2d, + "pahawh4": 0x2e, + "pamaka": 0x2f, + "petr1708": 0x30, + "pinyin": 0x31, + "polyton": 0x32, + "puter": 0x33, + "rigik": 0x34, + "rozaj": 0x35, + "rumgr": 0x36, + "scotland": 0x37, + "scouse": 0x38, + "simple": 0x54, + "solba": 0x4c, + "sotav": 0x39, + "spanglis": 0x3a, + "surmiran": 0x3b, + "sursilv": 0x3c, + "sutsilv": 0x3d, + "tarask": 0x3e, + "uccor": 0x3f, + "ucrcor": 0x40, + "ulster": 0x41, + "unifon": 0x42, + "vaidika": 0x43, + "valencia": 0x44, + "vallader": 0x45, + "wadegile": 0x46, + "xsistemo": 0x47, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 79 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 976 bytes, 244 elements +var likelyScript = [244]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 28: {lang: 0xf1, region: 0x6b}, + 30: {lang: 0x1a0, region: 0x5d}, + 31: {lang: 0x3e2, region: 0x106}, + 33: {lang: 0x1be, region: 0x99}, + 36: {lang: 0x15e, region: 0x78}, + 39: {lang: 0x133, region: 0x6b}, + 40: {lang: 0x431, region: 0x27}, + 41: {lang: 0x27, region: 0x6f}, + 43: {lang: 0x210, region: 0x7d}, + 44: {lang: 0xfe, region: 0x38}, + 46: {lang: 0x19b, region: 0x99}, + 47: {lang: 0x19e, region: 0x130}, + 48: {lang: 0x3e9, region: 0x99}, + 49: {lang: 0x136, region: 0x87}, + 50: {lang: 0x1a4, region: 0x99}, + 51: {lang: 0x39d, region: 0x99}, + 52: {lang: 0x529, region: 0x12e}, + 53: {lang: 0x254, region: 0xab}, + 54: {lang: 0x529, region: 0x53}, + 55: {lang: 0x1cb, region: 0xe7}, + 56: {lang: 0x529, region: 0x53}, + 57: {lang: 0x529, region: 0x12e}, + 58: {lang: 0x2fd, region: 0x9b}, + 59: {lang: 0x1bc, region: 0x97}, + 60: {lang: 0x200, region: 0xa2}, + 61: {lang: 0x1c5, region: 0x12b}, + 62: {lang: 0x1ca, region: 0xaf}, + 65: {lang: 0x1d5, region: 0x92}, + 67: {lang: 0x142, region: 0x9e}, + 68: {lang: 0x254, region: 0xab}, + 69: {lang: 0x20e, region: 0x95}, + 70: {lang: 0x200, region: 0xa2}, + 72: {lang: 0x135, region: 0xc4}, + 73: {lang: 0x200, region: 0xa2}, + 74: {lang: 0x3bb, region: 0xe8}, + 75: {lang: 0x24a, region: 0xa6}, + 76: {lang: 0x3fa, region: 0x99}, + 79: {lang: 0x251, region: 0x99}, + 80: {lang: 0x254, region: 0xab}, + 82: {lang: 0x88, region: 0x99}, + 83: {lang: 0x370, region: 0x123}, + 84: {lang: 0x2b8, region: 0xaf}, + 89: {lang: 0x29f, region: 0x99}, + 90: {lang: 0x2a8, region: 0x99}, + 91: {lang: 0x28f, region: 0x87}, + 92: {lang: 0x1a0, region: 0x87}, + 93: {lang: 0x2ac, region: 0x53}, + 95: {lang: 0x4f4, region: 0x12b}, + 96: {lang: 0x4f5, region: 0x12b}, + 97: {lang: 0x1be, region: 0x99}, + 99: {lang: 0x337, region: 0x9c}, + 100: {lang: 0x4f7, region: 0x53}, + 101: {lang: 0xa9, region: 0x53}, + 104: {lang: 0x2e8, region: 0x112}, + 105: {lang: 0x4f8, region: 0x10b}, + 106: {lang: 0x4f8, region: 0x10b}, + 107: {lang: 0x304, region: 0x99}, + 108: {lang: 0x31b, region: 0x99}, + 109: {lang: 0x30b, region: 0x53}, + 111: {lang: 0x31e, region: 0x35}, + 112: {lang: 0x30e, region: 0x99}, + 113: {lang: 0x414, region: 0xe8}, + 114: {lang: 0x331, region: 0xc4}, + 115: {lang: 0x4f9, region: 0x108}, + 116: {lang: 0x3b, region: 0xa1}, + 117: {lang: 0x353, region: 0xdb}, + 120: {lang: 0x2d0, region: 0x84}, + 121: {lang: 0x52a, region: 0x53}, + 122: {lang: 0x403, region: 0x96}, + 123: {lang: 0x3ee, region: 0x99}, + 124: {lang: 0x39b, region: 0xc5}, + 125: {lang: 0x395, region: 0x99}, + 126: {lang: 0x399, region: 0x135}, + 127: {lang: 0x429, region: 0x115}, + 128: {lang: 0x3b, region: 0x11c}, + 129: {lang: 0xfd, region: 0xc4}, + 130: {lang: 0x27d, region: 0x106}, + 131: {lang: 0x2c9, region: 0x53}, + 132: {lang: 0x39f, region: 0x9c}, + 133: {lang: 0x39f, region: 0x53}, + 135: {lang: 0x3ad, region: 0xb0}, + 137: {lang: 0x1c6, region: 0x53}, + 138: {lang: 0x4fd, region: 0x9c}, + 189: {lang: 0x3cb, region: 0x95}, + 191: {lang: 0x372, region: 0x10c}, + 192: {lang: 0x420, region: 0x97}, + 194: {lang: 0x4ff, region: 0x15e}, + 195: {lang: 0x3f0, region: 0x99}, + 196: {lang: 0x45, region: 0x135}, + 197: {lang: 0x139, region: 0x7b}, + 198: {lang: 0x3e9, region: 0x99}, + 200: {lang: 0x3e9, region: 0x99}, + 201: {lang: 0x3fa, region: 0x99}, + 202: {lang: 0x40c, region: 0xb3}, + 203: {lang: 0x433, region: 0x99}, + 204: {lang: 0xef, region: 0xc5}, + 205: {lang: 0x43e, region: 0x95}, + 206: {lang: 0x44d, region: 0x35}, + 207: {lang: 0x44e, region: 0x9b}, + 211: {lang: 0x45a, region: 0xe7}, + 212: {lang: 0x11a, region: 0x99}, + 213: {lang: 0x45e, region: 0x53}, + 214: {lang: 0x232, region: 0x53}, + 215: {lang: 0x450, region: 0x99}, + 216: {lang: 0x4a5, region: 0x53}, + 217: {lang: 0x9f, region: 0x13e}, + 218: {lang: 0x461, region: 0x99}, + 220: {lang: 0x528, region: 0xba}, + 221: {lang: 0x153, region: 0xe7}, + 222: {lang: 0x128, region: 0xcd}, + 223: {lang: 0x46b, region: 0x123}, + 224: {lang: 0xa9, region: 0x53}, + 225: {lang: 0x2ce, region: 0x99}, + 226: {lang: 0x4ad, region: 0x11c}, + 227: {lang: 0x4be, region: 0xb4}, + 229: {lang: 0x1ce, region: 0x99}, + 232: {lang: 0x3a9, region: 0x9c}, + 233: {lang: 0x22, region: 0x9b}, + 234: {lang: 0x1ea, region: 0x53}, + 235: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 5320 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x57, flags: 0x0}, + 1: {region: 0x6f, script: 0x57, flags: 0x0}, + 2: {region: 0x165, script: 0x57, flags: 0x0}, + 3: {region: 0x165, script: 0x57, flags: 0x0}, + 4: {region: 0x165, script: 0x57, flags: 0x0}, + 5: {region: 0x7d, script: 0x1f, flags: 0x0}, + 6: {region: 0x165, script: 0x57, flags: 0x0}, + 7: {region: 0x165, script: 0x1f, flags: 0x0}, + 8: {region: 0x80, script: 0x57, flags: 0x0}, + 9: {region: 0x165, script: 0x57, flags: 0x0}, + 10: {region: 0x165, script: 0x57, flags: 0x0}, + 11: {region: 0x165, script: 0x57, flags: 0x0}, + 12: {region: 0x95, script: 0x57, flags: 0x0}, + 13: {region: 0x131, script: 0x57, flags: 0x0}, + 14: {region: 0x80, script: 0x57, flags: 0x0}, + 15: {region: 0x165, script: 0x57, flags: 0x0}, + 16: {region: 0x165, script: 0x57, flags: 0x0}, + 17: {region: 0x106, script: 0x1f, flags: 0x0}, + 18: {region: 0x165, script: 0x57, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x57, flags: 0x0}, + 22: {region: 0x161, script: 0x57, flags: 0x0}, + 23: {region: 0x165, script: 0x57, flags: 0x0}, + 24: {region: 0x165, script: 0x57, flags: 0x0}, + 25: {region: 0x165, script: 0x57, flags: 0x0}, + 26: {region: 0x165, script: 0x57, flags: 0x0}, + 27: {region: 0x165, script: 0x57, flags: 0x0}, + 28: {region: 0x52, script: 0x57, flags: 0x0}, + 29: {region: 0x165, script: 0x57, flags: 0x0}, + 30: {region: 0x165, script: 0x57, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x57, flags: 0x0}, + 33: {region: 0x80, script: 0x57, flags: 0x0}, + 34: {region: 0x9b, script: 0xe9, flags: 0x0}, + 35: {region: 0x165, script: 0x57, flags: 0x0}, + 36: {region: 0x165, script: 0x57, flags: 0x0}, + 37: {region: 0x14d, script: 0x57, flags: 0x0}, + 38: {region: 0x106, script: 0x1f, flags: 0x0}, + 39: {region: 0x6f, script: 0x29, flags: 0x0}, + 40: {region: 0x165, script: 0x57, flags: 0x0}, + 41: {region: 0x165, script: 0x57, flags: 0x0}, + 42: {region: 0xd6, script: 0x57, flags: 0x0}, + 43: {region: 0x165, script: 0x57, flags: 0x0}, + 45: {region: 0x165, script: 0x57, flags: 0x0}, + 46: {region: 0x165, script: 0x57, flags: 0x0}, + 47: {region: 0x165, script: 0x57, flags: 0x0}, + 48: {region: 0x165, script: 0x57, flags: 0x0}, + 49: {region: 0x165, script: 0x57, flags: 0x0}, + 50: {region: 0x165, script: 0x57, flags: 0x0}, + 51: {region: 0x95, script: 0x57, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x57, flags: 0x0}, + 55: {region: 0x165, script: 0x57, flags: 0x0}, + 56: {region: 0x165, script: 0x57, flags: 0x0}, + 57: {region: 0x165, script: 0x57, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x57, flags: 0x0}, + 61: {region: 0x51, script: 0x57, flags: 0x0}, + 62: {region: 0x3f, script: 0x57, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x57, flags: 0x0}, + 69: {region: 0x135, script: 0xc4, flags: 0x0}, + 70: {region: 0x165, script: 0x57, flags: 0x0}, + 71: {region: 0x165, script: 0x57, flags: 0x0}, + 72: {region: 0x6e, script: 0x57, flags: 0x0}, + 73: {region: 0x165, script: 0x57, flags: 0x0}, + 74: {region: 0x165, script: 0x57, flags: 0x0}, + 75: {region: 0x49, script: 0x57, flags: 0x0}, + 76: {region: 0x165, script: 0x57, flags: 0x0}, + 77: {region: 0x106, script: 0x1f, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x57, flags: 0x0}, + 80: {region: 0x165, script: 0x57, flags: 0x0}, + 81: {region: 0x165, script: 0x57, flags: 0x0}, + 82: {region: 0x99, script: 0x21, flags: 0x0}, + 83: {region: 0x165, script: 0x57, flags: 0x0}, + 84: {region: 0x165, script: 0x57, flags: 0x0}, + 85: {region: 0x165, script: 0x57, flags: 0x0}, + 86: {region: 0x3f, script: 0x57, flags: 0x0}, + 87: {region: 0x165, script: 0x57, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x1f, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x57, flags: 0x0}, + 92: {region: 0xdb, script: 0x21, flags: 0x0}, + 93: {region: 0x2e, script: 0x57, flags: 0x0}, + 94: {region: 0x52, script: 0x57, flags: 0x0}, + 95: {region: 0x165, script: 0x57, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x57, flags: 0x0}, + 98: {region: 0x165, script: 0x57, flags: 0x0}, + 99: {region: 0x95, script: 0x57, flags: 0x0}, + 100: {region: 0x165, script: 0x57, flags: 0x0}, + 101: {region: 0x52, script: 0x57, flags: 0x0}, + 102: {region: 0x165, script: 0x57, flags: 0x0}, + 103: {region: 0x165, script: 0x57, flags: 0x0}, + 104: {region: 0x165, script: 0x57, flags: 0x0}, + 105: {region: 0x165, script: 0x57, flags: 0x0}, + 106: {region: 0x4f, script: 0x57, flags: 0x0}, + 107: {region: 0x165, script: 0x57, flags: 0x0}, + 108: {region: 0x165, script: 0x57, flags: 0x0}, + 109: {region: 0x165, script: 0x57, flags: 0x0}, + 110: {region: 0x165, script: 0x29, flags: 0x0}, + 111: {region: 0x165, script: 0x57, flags: 0x0}, + 112: {region: 0x165, script: 0x57, flags: 0x0}, + 113: {region: 0x47, script: 0x1f, flags: 0x0}, + 114: {region: 0x165, script: 0x57, flags: 0x0}, + 115: {region: 0x165, script: 0x57, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x57, flags: 0x0}, + 118: {region: 0x165, script: 0x57, flags: 0x0}, + 119: {region: 0x95, script: 0x57, flags: 0x0}, + 120: {region: 0x165, script: 0x57, flags: 0x0}, + 121: {region: 0x12f, script: 0x57, flags: 0x0}, + 122: {region: 0x52, script: 0x57, flags: 0x0}, + 123: {region: 0x99, script: 0xd7, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x21, flags: 0x0}, + 126: {region: 0x38, script: 0x1f, flags: 0x0}, + 127: {region: 0x99, script: 0x21, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x31, flags: 0x0}, + 131: {region: 0x99, script: 0x21, flags: 0x0}, + 132: {region: 0x165, script: 0x57, flags: 0x0}, + 133: {region: 0x99, script: 0x21, flags: 0x0}, + 134: {region: 0xe7, script: 0x57, flags: 0x0}, + 135: {region: 0x165, script: 0x57, flags: 0x0}, + 136: {region: 0x99, script: 0x21, flags: 0x0}, + 137: {region: 0x165, script: 0x57, flags: 0x0}, + 138: {region: 0x13f, script: 0x57, flags: 0x0}, + 139: {region: 0x165, script: 0x57, flags: 0x0}, + 140: {region: 0x165, script: 0x57, flags: 0x0}, + 141: {region: 0xe7, script: 0x57, flags: 0x0}, + 142: {region: 0x165, script: 0x57, flags: 0x0}, + 143: {region: 0xd6, script: 0x57, flags: 0x0}, + 144: {region: 0x165, script: 0x57, flags: 0x0}, + 145: {region: 0x165, script: 0x57, flags: 0x0}, + 146: {region: 0x165, script: 0x57, flags: 0x0}, + 147: {region: 0x165, script: 0x29, flags: 0x0}, + 148: {region: 0x99, script: 0x21, flags: 0x0}, + 149: {region: 0x95, script: 0x57, flags: 0x0}, + 150: {region: 0x165, script: 0x57, flags: 0x0}, + 151: {region: 0x165, script: 0x57, flags: 0x0}, + 152: {region: 0x114, script: 0x57, flags: 0x0}, + 153: {region: 0x165, script: 0x57, flags: 0x0}, + 154: {region: 0x165, script: 0x57, flags: 0x0}, + 155: {region: 0x52, script: 0x57, flags: 0x0}, + 156: {region: 0x165, script: 0x57, flags: 0x0}, + 157: {region: 0xe7, script: 0x57, flags: 0x0}, + 158: {region: 0x165, script: 0x57, flags: 0x0}, + 159: {region: 0x13e, script: 0xd9, flags: 0x0}, + 160: {region: 0xc3, script: 0x57, flags: 0x0}, + 161: {region: 0x165, script: 0x57, flags: 0x0}, + 162: {region: 0x165, script: 0x57, flags: 0x0}, + 163: {region: 0xc3, script: 0x57, flags: 0x0}, + 164: {region: 0x165, script: 0x57, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x57, flags: 0x0}, + 167: {region: 0x165, script: 0x57, flags: 0x0}, + 168: {region: 0x165, script: 0x57, flags: 0x0}, + 169: {region: 0x53, script: 0xe0, flags: 0x0}, + 170: {region: 0x165, script: 0x57, flags: 0x0}, + 171: {region: 0x165, script: 0x57, flags: 0x0}, + 172: {region: 0x165, script: 0x57, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x57, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x57, flags: 0x0}, + 177: {region: 0x4f, script: 0x57, flags: 0x0}, + 178: {region: 0x78, script: 0x57, flags: 0x0}, + 179: {region: 0x99, script: 0x21, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x21, flags: 0x0}, + 182: {region: 0x165, script: 0x57, flags: 0x0}, + 183: {region: 0x33, script: 0x57, flags: 0x0}, + 184: {region: 0x165, script: 0x57, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x57, flags: 0x0}, + 187: {region: 0x165, script: 0x29, flags: 0x0}, + 188: {region: 0xe7, script: 0x57, flags: 0x0}, + 189: {region: 0x165, script: 0x57, flags: 0x0}, + 190: {region: 0xe8, script: 0x21, flags: 0x0}, + 191: {region: 0x106, script: 0x1f, flags: 0x0}, + 192: {region: 0x15f, script: 0x57, flags: 0x0}, + 193: {region: 0x165, script: 0x57, flags: 0x0}, + 194: {region: 0x95, script: 0x57, flags: 0x0}, + 195: {region: 0x165, script: 0x57, flags: 0x0}, + 196: {region: 0x52, script: 0x57, flags: 0x0}, + 197: {region: 0x165, script: 0x57, flags: 0x0}, + 198: {region: 0x165, script: 0x57, flags: 0x0}, + 199: {region: 0x165, script: 0x57, flags: 0x0}, + 200: {region: 0x86, script: 0x57, flags: 0x0}, + 201: {region: 0x165, script: 0x57, flags: 0x0}, + 202: {region: 0x165, script: 0x57, flags: 0x0}, + 203: {region: 0x165, script: 0x57, flags: 0x0}, + 204: {region: 0x165, script: 0x57, flags: 0x0}, + 205: {region: 0x6d, script: 0x29, flags: 0x0}, + 206: {region: 0x165, script: 0x57, flags: 0x0}, + 207: {region: 0x165, script: 0x57, flags: 0x0}, + 208: {region: 0x52, script: 0x57, flags: 0x0}, + 209: {region: 0x165, script: 0x57, flags: 0x0}, + 210: {region: 0x165, script: 0x57, flags: 0x0}, + 211: {region: 0xc3, script: 0x57, flags: 0x0}, + 212: {region: 0x165, script: 0x57, flags: 0x0}, + 213: {region: 0x165, script: 0x57, flags: 0x0}, + 214: {region: 0x165, script: 0x57, flags: 0x0}, + 215: {region: 0x6e, script: 0x57, flags: 0x0}, + 216: {region: 0x165, script: 0x57, flags: 0x0}, + 217: {region: 0x165, script: 0x57, flags: 0x0}, + 218: {region: 0xd6, script: 0x57, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x1f, flags: 0x0}, + 221: {region: 0xe7, script: 0x57, flags: 0x0}, + 222: {region: 0x165, script: 0x57, flags: 0x0}, + 223: {region: 0x131, script: 0x57, flags: 0x0}, + 224: {region: 0x8a, script: 0x57, flags: 0x0}, + 225: {region: 0x75, script: 0x57, flags: 0x0}, + 226: {region: 0x106, script: 0x1f, flags: 0x0}, + 227: {region: 0x135, script: 0x57, flags: 0x0}, + 228: {region: 0x49, script: 0x57, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x57, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x57, flags: 0x0}, + 235: {region: 0x165, script: 0x57, flags: 0x0}, + 236: {region: 0x165, script: 0x57, flags: 0x0}, + 237: {region: 0x165, script: 0x57, flags: 0x0}, + 238: {region: 0x165, script: 0x57, flags: 0x0}, + 239: {region: 0xc5, script: 0xcc, flags: 0x0}, + 240: {region: 0x78, script: 0x57, flags: 0x0}, + 241: {region: 0x6b, script: 0x1c, flags: 0x0}, + 242: {region: 0xe7, script: 0x57, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x1f, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x57, flags: 0x0}, + 250: {region: 0x5e, script: 0x57, flags: 0x0}, + 251: {region: 0xe9, script: 0x57, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x81, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x1f, flags: 0x0}, + 256: {region: 0x7b, script: 0x57, flags: 0x0}, + 257: {region: 0x63, script: 0x57, flags: 0x0}, + 258: {region: 0x165, script: 0x57, flags: 0x0}, + 259: {region: 0x165, script: 0x57, flags: 0x0}, + 260: {region: 0x165, script: 0x57, flags: 0x0}, + 261: {region: 0x165, script: 0x57, flags: 0x0}, + 262: {region: 0x135, script: 0x57, flags: 0x0}, + 263: {region: 0x106, script: 0x1f, flags: 0x0}, + 264: {region: 0xa4, script: 0x57, flags: 0x0}, + 265: {region: 0x165, script: 0x57, flags: 0x0}, + 266: {region: 0x165, script: 0x57, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x57, flags: 0x0}, + 269: {region: 0x60, script: 0x57, flags: 0x0}, + 270: {region: 0x165, script: 0x57, flags: 0x0}, + 271: {region: 0x49, script: 0x57, flags: 0x0}, + 272: {region: 0x165, script: 0x57, flags: 0x0}, + 273: {region: 0x165, script: 0x57, flags: 0x0}, + 274: {region: 0x165, script: 0x57, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x57, flags: 0x0}, + 277: {region: 0x165, script: 0x57, flags: 0x0}, + 278: {region: 0x165, script: 0x57, flags: 0x0}, + 279: {region: 0xd4, script: 0x57, flags: 0x0}, + 280: {region: 0x4f, script: 0x57, flags: 0x0}, + 281: {region: 0x165, script: 0x57, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x57, flags: 0x0}, + 284: {region: 0x165, script: 0x57, flags: 0x0}, + 285: {region: 0x165, script: 0x57, flags: 0x0}, + 286: {region: 0x165, script: 0x29, flags: 0x0}, + 287: {region: 0x60, script: 0x57, flags: 0x0}, + 288: {region: 0xc3, script: 0x57, flags: 0x0}, + 289: {region: 0xd0, script: 0x57, flags: 0x0}, + 290: {region: 0x165, script: 0x57, flags: 0x0}, + 291: {region: 0xdb, script: 0x21, flags: 0x0}, + 292: {region: 0x52, script: 0x57, flags: 0x0}, + 293: {region: 0x165, script: 0x57, flags: 0x0}, + 294: {region: 0x165, script: 0x57, flags: 0x0}, + 295: {region: 0x165, script: 0x57, flags: 0x0}, + 296: {region: 0xcd, script: 0xde, flags: 0x0}, + 297: {region: 0x165, script: 0x57, flags: 0x0}, + 298: {region: 0x165, script: 0x57, flags: 0x0}, + 299: {region: 0x114, script: 0x57, flags: 0x0}, + 300: {region: 0x37, script: 0x57, flags: 0x0}, + 301: {region: 0x43, script: 0xe0, flags: 0x0}, + 302: {region: 0x165, script: 0x57, flags: 0x0}, + 303: {region: 0xa4, script: 0x57, flags: 0x0}, + 304: {region: 0x80, script: 0x57, flags: 0x0}, + 305: {region: 0xd6, script: 0x57, flags: 0x0}, + 306: {region: 0x9e, script: 0x57, flags: 0x0}, + 307: {region: 0x6b, script: 0x27, flags: 0x0}, + 308: {region: 0x165, script: 0x57, flags: 0x0}, + 309: {region: 0xc4, script: 0x48, flags: 0x0}, + 310: {region: 0x87, script: 0x31, flags: 0x0}, + 311: {region: 0x165, script: 0x57, flags: 0x0}, + 312: {region: 0x165, script: 0x57, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x57, flags: 0x0}, + 315: {region: 0x165, script: 0x57, flags: 0x0}, + 316: {region: 0x1, script: 0x57, flags: 0x0}, + 317: {region: 0x165, script: 0x57, flags: 0x0}, + 318: {region: 0x6e, script: 0x57, flags: 0x0}, + 319: {region: 0x135, script: 0x57, flags: 0x0}, + 320: {region: 0x6a, script: 0x57, flags: 0x0}, + 321: {region: 0x165, script: 0x57, flags: 0x0}, + 322: {region: 0x9e, script: 0x43, flags: 0x0}, + 323: {region: 0x165, script: 0x57, flags: 0x0}, + 324: {region: 0x165, script: 0x57, flags: 0x0}, + 325: {region: 0x6e, script: 0x57, flags: 0x0}, + 326: {region: 0x52, script: 0x57, flags: 0x0}, + 327: {region: 0x6e, script: 0x57, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x57, flags: 0x0}, + 330: {region: 0x165, script: 0x57, flags: 0x0}, + 331: {region: 0x165, script: 0x57, flags: 0x0}, + 332: {region: 0x165, script: 0x57, flags: 0x0}, + 333: {region: 0x86, script: 0x57, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x57, flags: 0x0}, + 336: {region: 0xc3, script: 0x57, flags: 0x0}, + 337: {region: 0x72, script: 0x57, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x57, flags: 0x0}, + 340: {region: 0x10c, script: 0x57, flags: 0x0}, + 341: {region: 0x73, script: 0x57, flags: 0x0}, + 342: {region: 0x165, script: 0x57, flags: 0x0}, + 343: {region: 0x165, script: 0x57, flags: 0x0}, + 344: {region: 0x76, script: 0x57, flags: 0x0}, + 345: {region: 0x165, script: 0x57, flags: 0x0}, + 346: {region: 0x3b, script: 0x57, flags: 0x0}, + 347: {region: 0x165, script: 0x57, flags: 0x0}, + 348: {region: 0x165, script: 0x57, flags: 0x0}, + 349: {region: 0x165, script: 0x57, flags: 0x0}, + 350: {region: 0x78, script: 0x57, flags: 0x0}, + 351: {region: 0x135, script: 0x57, flags: 0x0}, + 352: {region: 0x78, script: 0x57, flags: 0x0}, + 353: {region: 0x60, script: 0x57, flags: 0x0}, + 354: {region: 0x60, script: 0x57, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x57, flags: 0x0}, + 357: {region: 0x165, script: 0x57, flags: 0x0}, + 358: {region: 0x84, script: 0x57, flags: 0x0}, + 359: {region: 0x165, script: 0x57, flags: 0x0}, + 360: {region: 0xd4, script: 0x57, flags: 0x0}, + 361: {region: 0x9e, script: 0x57, flags: 0x0}, + 362: {region: 0xd6, script: 0x57, flags: 0x0}, + 363: {region: 0x165, script: 0x57, flags: 0x0}, + 364: {region: 0x10b, script: 0x57, flags: 0x0}, + 365: {region: 0xd9, script: 0x57, flags: 0x0}, + 366: {region: 0x96, script: 0x57, flags: 0x0}, + 367: {region: 0x80, script: 0x57, flags: 0x0}, + 368: {region: 0x165, script: 0x57, flags: 0x0}, + 369: {region: 0xbc, script: 0x57, flags: 0x0}, + 370: {region: 0x165, script: 0x57, flags: 0x0}, + 371: {region: 0x165, script: 0x57, flags: 0x0}, + 372: {region: 0x165, script: 0x57, flags: 0x0}, + 373: {region: 0x53, script: 0x38, flags: 0x0}, + 374: {region: 0x165, script: 0x57, flags: 0x0}, + 375: {region: 0x95, script: 0x57, flags: 0x0}, + 376: {region: 0x165, script: 0x57, flags: 0x0}, + 377: {region: 0x165, script: 0x57, flags: 0x0}, + 378: {region: 0x99, script: 0x21, flags: 0x0}, + 379: {region: 0x165, script: 0x57, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x57, flags: 0x0}, + 382: {region: 0x7b, script: 0x57, flags: 0x0}, + 383: {region: 0x165, script: 0x57, flags: 0x0}, + 384: {region: 0x165, script: 0x57, flags: 0x0}, + 385: {region: 0x165, script: 0x57, flags: 0x0}, + 386: {region: 0x165, script: 0x57, flags: 0x0}, + 387: {region: 0x165, script: 0x57, flags: 0x0}, + 388: {region: 0x165, script: 0x57, flags: 0x0}, + 389: {region: 0x6f, script: 0x29, flags: 0x0}, + 390: {region: 0x165, script: 0x57, flags: 0x0}, + 391: {region: 0xdb, script: 0x21, flags: 0x0}, + 392: {region: 0x165, script: 0x57, flags: 0x0}, + 393: {region: 0xa7, script: 0x57, flags: 0x0}, + 394: {region: 0x165, script: 0x57, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x57, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x57, flags: 0x0}, + 399: {region: 0x165, script: 0x57, flags: 0x0}, + 400: {region: 0x6e, script: 0x57, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x57, flags: 0x0}, + 403: {region: 0x165, script: 0x29, flags: 0x0}, + 404: {region: 0xf1, script: 0x57, flags: 0x0}, + 405: {region: 0x165, script: 0x57, flags: 0x0}, + 406: {region: 0x165, script: 0x57, flags: 0x0}, + 407: {region: 0x165, script: 0x57, flags: 0x0}, + 408: {region: 0x165, script: 0x29, flags: 0x0}, + 409: {region: 0x165, script: 0x57, flags: 0x0}, + 410: {region: 0x99, script: 0x21, flags: 0x0}, + 411: {region: 0x99, script: 0xda, flags: 0x0}, + 412: {region: 0x95, script: 0x57, flags: 0x0}, + 413: {region: 0xd9, script: 0x57, flags: 0x0}, + 414: {region: 0x130, script: 0x2f, flags: 0x0}, + 415: {region: 0x165, script: 0x57, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x57, flags: 0x0}, + 419: {region: 0x4e, script: 0x57, flags: 0x0}, + 420: {region: 0x99, script: 0x32, flags: 0x0}, + 421: {region: 0x41, script: 0x57, flags: 0x0}, + 422: {region: 0x54, script: 0x57, flags: 0x0}, + 423: {region: 0x165, script: 0x57, flags: 0x0}, + 424: {region: 0x80, script: 0x57, flags: 0x0}, + 425: {region: 0x165, script: 0x57, flags: 0x0}, + 426: {region: 0x165, script: 0x57, flags: 0x0}, + 427: {region: 0xa4, script: 0x57, flags: 0x0}, + 428: {region: 0x98, script: 0x57, flags: 0x0}, + 429: {region: 0x165, script: 0x57, flags: 0x0}, + 430: {region: 0xdb, script: 0x21, flags: 0x0}, + 431: {region: 0x165, script: 0x57, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x57, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x57, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x57, flags: 0x0}, + 438: {region: 0x53, script: 0x38, flags: 0x0}, + 439: {region: 0x165, script: 0x57, flags: 0x0}, + 440: {region: 0x135, script: 0x57, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x57, flags: 0x0}, + 443: {region: 0x165, script: 0x29, flags: 0x0}, + 444: {region: 0x97, script: 0x3b, flags: 0x0}, + 445: {region: 0x165, script: 0x57, flags: 0x0}, + 446: {region: 0x99, script: 0x21, flags: 0x0}, + 447: {region: 0x165, script: 0x57, flags: 0x0}, + 448: {region: 0x73, script: 0x57, flags: 0x0}, + 449: {region: 0x165, script: 0x57, flags: 0x0}, + 450: {region: 0x165, script: 0x57, flags: 0x0}, + 451: {region: 0xe7, script: 0x57, flags: 0x0}, + 452: {region: 0x165, script: 0x57, flags: 0x0}, + 453: {region: 0x12b, script: 0x3d, flags: 0x0}, + 454: {region: 0x53, script: 0x89, flags: 0x0}, + 455: {region: 0x165, script: 0x57, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x21, flags: 0x0}, + 458: {region: 0xaf, script: 0x3e, flags: 0x0}, + 459: {region: 0xe7, script: 0x57, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x57, flags: 0x0}, + 462: {region: 0x99, script: 0x21, flags: 0x0}, + 463: {region: 0x99, script: 0x21, flags: 0x0}, + 464: {region: 0x165, script: 0x57, flags: 0x0}, + 465: {region: 0x90, script: 0x57, flags: 0x0}, + 466: {region: 0x60, script: 0x57, flags: 0x0}, + 467: {region: 0x53, script: 0x38, flags: 0x0}, + 468: {region: 0x91, script: 0x57, flags: 0x0}, + 469: {region: 0x92, script: 0x57, flags: 0x0}, + 470: {region: 0x165, script: 0x57, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x57, flags: 0x0}, + 473: {region: 0x78, script: 0x57, flags: 0x0}, + 474: {region: 0x165, script: 0x57, flags: 0x0}, + 475: {region: 0x165, script: 0x57, flags: 0x0}, + 476: {region: 0xd0, script: 0x57, flags: 0x0}, + 477: {region: 0xd6, script: 0x57, flags: 0x0}, + 478: {region: 0x165, script: 0x57, flags: 0x0}, + 479: {region: 0x165, script: 0x57, flags: 0x0}, + 480: {region: 0x165, script: 0x57, flags: 0x0}, + 481: {region: 0x95, script: 0x57, flags: 0x0}, + 482: {region: 0x165, script: 0x57, flags: 0x0}, + 483: {region: 0x165, script: 0x57, flags: 0x0}, + 484: {region: 0x165, script: 0x57, flags: 0x0}, + 486: {region: 0x122, script: 0x57, flags: 0x0}, + 487: {region: 0xd6, script: 0x57, flags: 0x0}, + 488: {region: 0x165, script: 0x57, flags: 0x0}, + 489: {region: 0x165, script: 0x57, flags: 0x0}, + 490: {region: 0x53, script: 0xea, flags: 0x0}, + 491: {region: 0x165, script: 0x57, flags: 0x0}, + 492: {region: 0x135, script: 0x57, flags: 0x0}, + 493: {region: 0x165, script: 0x57, flags: 0x0}, + 494: {region: 0x49, script: 0x57, flags: 0x0}, + 495: {region: 0x165, script: 0x57, flags: 0x0}, + 496: {region: 0x165, script: 0x57, flags: 0x0}, + 497: {region: 0xe7, script: 0x57, flags: 0x0}, + 498: {region: 0x165, script: 0x57, flags: 0x0}, + 499: {region: 0x95, script: 0x57, flags: 0x0}, + 500: {region: 0x106, script: 0x1f, flags: 0x0}, + 501: {region: 0x1, script: 0x57, flags: 0x0}, + 502: {region: 0x165, script: 0x57, flags: 0x0}, + 503: {region: 0x165, script: 0x57, flags: 0x0}, + 504: {region: 0x9d, script: 0x57, flags: 0x0}, + 505: {region: 0x9e, script: 0x57, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3b, flags: 0x0}, + 508: {region: 0x165, script: 0x57, flags: 0x0}, + 509: {region: 0x165, script: 0x57, flags: 0x0}, + 510: {region: 0x106, script: 0x57, flags: 0x0}, + 511: {region: 0x165, script: 0x57, flags: 0x0}, + 512: {region: 0xa2, script: 0x46, flags: 0x0}, + 513: {region: 0x165, script: 0x57, flags: 0x0}, + 514: {region: 0xa0, script: 0x57, flags: 0x0}, + 515: {region: 0x1, script: 0x57, flags: 0x0}, + 516: {region: 0x165, script: 0x57, flags: 0x0}, + 517: {region: 0x165, script: 0x57, flags: 0x0}, + 518: {region: 0x165, script: 0x57, flags: 0x0}, + 519: {region: 0x52, script: 0x57, flags: 0x0}, + 520: {region: 0x130, script: 0x3b, flags: 0x0}, + 521: {region: 0x165, script: 0x57, flags: 0x0}, + 522: {region: 0x12f, script: 0x57, flags: 0x0}, + 523: {region: 0xdb, script: 0x21, flags: 0x0}, + 524: {region: 0x165, script: 0x57, flags: 0x0}, + 525: {region: 0x63, script: 0x57, flags: 0x0}, + 526: {region: 0x95, script: 0x57, flags: 0x0}, + 527: {region: 0x95, script: 0x57, flags: 0x0}, + 528: {region: 0x7d, script: 0x2b, flags: 0x0}, + 529: {region: 0x137, script: 0x1f, flags: 0x0}, + 530: {region: 0x67, script: 0x57, flags: 0x0}, + 531: {region: 0xc4, script: 0x57, flags: 0x0}, + 532: {region: 0x165, script: 0x57, flags: 0x0}, + 533: {region: 0x165, script: 0x57, flags: 0x0}, + 534: {region: 0xd6, script: 0x57, flags: 0x0}, + 535: {region: 0xa4, script: 0x57, flags: 0x0}, + 536: {region: 0xc3, script: 0x57, flags: 0x0}, + 537: {region: 0x106, script: 0x1f, flags: 0x0}, + 538: {region: 0x165, script: 0x57, flags: 0x0}, + 539: {region: 0x165, script: 0x57, flags: 0x0}, + 540: {region: 0x165, script: 0x57, flags: 0x0}, + 541: {region: 0x165, script: 0x57, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x57, flags: 0x0}, + 544: {region: 0x164, script: 0x57, flags: 0x0}, + 545: {region: 0x165, script: 0x57, flags: 0x0}, + 546: {region: 0x165, script: 0x57, flags: 0x0}, + 547: {region: 0x12f, script: 0x57, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x57, flags: 0x0}, + 550: {region: 0x123, script: 0xdf, flags: 0x0}, + 551: {region: 0x5a, script: 0x57, flags: 0x0}, + 552: {region: 0x52, script: 0x57, flags: 0x0}, + 553: {region: 0x165, script: 0x57, flags: 0x0}, + 554: {region: 0x4f, script: 0x57, flags: 0x0}, + 555: {region: 0x99, script: 0x21, flags: 0x0}, + 556: {region: 0x99, script: 0x21, flags: 0x0}, + 557: {region: 0x4b, script: 0x57, flags: 0x0}, + 558: {region: 0x95, script: 0x57, flags: 0x0}, + 559: {region: 0x165, script: 0x57, flags: 0x0}, + 560: {region: 0x41, script: 0x57, flags: 0x0}, + 561: {region: 0x99, script: 0x57, flags: 0x0}, + 562: {region: 0x53, script: 0xd6, flags: 0x0}, + 563: {region: 0x99, script: 0x21, flags: 0x0}, + 564: {region: 0xc3, script: 0x57, flags: 0x0}, + 565: {region: 0x165, script: 0x57, flags: 0x0}, + 566: {region: 0x99, script: 0x72, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x57, flags: 0x0}, + 569: {region: 0xa4, script: 0x57, flags: 0x0}, + 570: {region: 0x165, script: 0x57, flags: 0x0}, + 571: {region: 0x12b, script: 0x57, flags: 0x0}, + 572: {region: 0x165, script: 0x57, flags: 0x0}, + 573: {region: 0xd2, script: 0x57, flags: 0x0}, + 574: {region: 0x165, script: 0x57, flags: 0x0}, + 575: {region: 0xaf, script: 0x54, flags: 0x0}, + 576: {region: 0x165, script: 0x57, flags: 0x0}, + 577: {region: 0x165, script: 0x57, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x57, flags: 0x0}, + 580: {region: 0x52, script: 0x57, flags: 0x0}, + 581: {region: 0x82, script: 0x57, flags: 0x0}, + 582: {region: 0xa4, script: 0x57, flags: 0x0}, + 583: {region: 0x165, script: 0x57, flags: 0x0}, + 584: {region: 0x165, script: 0x57, flags: 0x0}, + 585: {region: 0x165, script: 0x57, flags: 0x0}, + 586: {region: 0xa6, script: 0x4b, flags: 0x0}, + 587: {region: 0x2a, script: 0x57, flags: 0x0}, + 588: {region: 0x165, script: 0x57, flags: 0x0}, + 589: {region: 0x165, script: 0x57, flags: 0x0}, + 590: {region: 0x165, script: 0x57, flags: 0x0}, + 591: {region: 0x165, script: 0x57, flags: 0x0}, + 592: {region: 0x165, script: 0x57, flags: 0x0}, + 593: {region: 0x99, script: 0x4f, flags: 0x0}, + 594: {region: 0x8b, script: 0x57, flags: 0x0}, + 595: {region: 0x165, script: 0x57, flags: 0x0}, + 596: {region: 0xab, script: 0x50, flags: 0x0}, + 597: {region: 0x106, script: 0x1f, flags: 0x0}, + 598: {region: 0x99, script: 0x21, flags: 0x0}, + 599: {region: 0x165, script: 0x57, flags: 0x0}, + 600: {region: 0x75, script: 0x57, flags: 0x0}, + 601: {region: 0x165, script: 0x57, flags: 0x0}, + 602: {region: 0xb4, script: 0x57, flags: 0x0}, + 603: {region: 0x165, script: 0x57, flags: 0x0}, + 604: {region: 0x165, script: 0x57, flags: 0x0}, + 605: {region: 0x165, script: 0x57, flags: 0x0}, + 606: {region: 0x165, script: 0x57, flags: 0x0}, + 607: {region: 0x165, script: 0x57, flags: 0x0}, + 608: {region: 0x165, script: 0x57, flags: 0x0}, + 609: {region: 0x165, script: 0x57, flags: 0x0}, + 610: {region: 0x165, script: 0x29, flags: 0x0}, + 611: {region: 0x165, script: 0x57, flags: 0x0}, + 612: {region: 0x106, script: 0x1f, flags: 0x0}, + 613: {region: 0x112, script: 0x57, flags: 0x0}, + 614: {region: 0xe7, script: 0x57, flags: 0x0}, + 615: {region: 0x106, script: 0x57, flags: 0x0}, + 616: {region: 0x165, script: 0x57, flags: 0x0}, + 617: {region: 0x99, script: 0x21, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x57, flags: 0x0}, + 620: {region: 0x165, script: 0x57, flags: 0x0}, + 621: {region: 0x52, script: 0x57, flags: 0x0}, + 622: {region: 0x60, script: 0x57, flags: 0x0}, + 623: {region: 0x165, script: 0x57, flags: 0x0}, + 624: {region: 0x165, script: 0x57, flags: 0x0}, + 625: {region: 0x165, script: 0x29, flags: 0x0}, + 626: {region: 0x165, script: 0x57, flags: 0x0}, + 627: {region: 0x165, script: 0x57, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x57, flags: 0x0}, + 630: {region: 0x165, script: 0x57, flags: 0x0}, + 631: {region: 0x165, script: 0x57, flags: 0x0}, + 632: {region: 0x165, script: 0x57, flags: 0x0}, + 633: {region: 0x106, script: 0x1f, flags: 0x0}, + 634: {region: 0x165, script: 0x57, flags: 0x0}, + 635: {region: 0x165, script: 0x57, flags: 0x0}, + 636: {region: 0x165, script: 0x57, flags: 0x0}, + 637: {region: 0x106, script: 0x1f, flags: 0x0}, + 638: {region: 0x165, script: 0x57, flags: 0x0}, + 639: {region: 0x95, script: 0x57, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x57, flags: 0x0}, + 642: {region: 0x165, script: 0x57, flags: 0x0}, + 643: {region: 0x165, script: 0x57, flags: 0x0}, + 644: {region: 0x165, script: 0x57, flags: 0x0}, + 645: {region: 0x165, script: 0x29, flags: 0x0}, + 646: {region: 0x123, script: 0xdf, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x57, flags: 0x0}, + 649: {region: 0x165, script: 0x57, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x57, flags: 0x0}, + 652: {region: 0x165, script: 0x57, flags: 0x0}, + 653: {region: 0x165, script: 0x57, flags: 0x0}, + 654: {region: 0x138, script: 0x57, flags: 0x0}, + 655: {region: 0x87, script: 0x5b, flags: 0x0}, + 656: {region: 0x97, script: 0x3b, flags: 0x0}, + 657: {region: 0x12f, script: 0x57, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x57, flags: 0x0}, + 660: {region: 0x165, script: 0x57, flags: 0x0}, + 661: {region: 0xb7, script: 0x57, flags: 0x0}, + 662: {region: 0x106, script: 0x1f, flags: 0x0}, + 663: {region: 0x165, script: 0x57, flags: 0x0}, + 664: {region: 0x95, script: 0x57, flags: 0x0}, + 665: {region: 0x165, script: 0x57, flags: 0x0}, + 666: {region: 0x53, script: 0xdf, flags: 0x0}, + 667: {region: 0x165, script: 0x57, flags: 0x0}, + 668: {region: 0x165, script: 0x57, flags: 0x0}, + 669: {region: 0x165, script: 0x57, flags: 0x0}, + 670: {region: 0x165, script: 0x57, flags: 0x0}, + 671: {region: 0x99, script: 0x59, flags: 0x0}, + 672: {region: 0x165, script: 0x57, flags: 0x0}, + 673: {region: 0x165, script: 0x57, flags: 0x0}, + 674: {region: 0x106, script: 0x1f, flags: 0x0}, + 675: {region: 0x131, script: 0x57, flags: 0x0}, + 676: {region: 0x165, script: 0x57, flags: 0x0}, + 677: {region: 0xd9, script: 0x57, flags: 0x0}, + 678: {region: 0x165, script: 0x57, flags: 0x0}, + 679: {region: 0x165, script: 0x57, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x57, flags: 0x0}, + 682: {region: 0x165, script: 0x57, flags: 0x0}, + 683: {region: 0x9e, script: 0x57, flags: 0x0}, + 684: {region: 0x53, script: 0x5d, flags: 0x0}, + 685: {region: 0x95, script: 0x57, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x57, flags: 0x0}, + 688: {region: 0x165, script: 0x57, flags: 0x0}, + 689: {region: 0x165, script: 0x57, flags: 0x0}, + 690: {region: 0x99, script: 0xda, flags: 0x0}, + 691: {region: 0x9e, script: 0x57, flags: 0x0}, + 692: {region: 0x165, script: 0x57, flags: 0x0}, + 693: {region: 0x4b, script: 0x57, flags: 0x0}, + 694: {region: 0x165, script: 0x57, flags: 0x0}, + 695: {region: 0x165, script: 0x57, flags: 0x0}, + 696: {region: 0xaf, script: 0x54, flags: 0x0}, + 697: {region: 0x165, script: 0x57, flags: 0x0}, + 698: {region: 0x165, script: 0x57, flags: 0x0}, + 699: {region: 0x4b, script: 0x57, flags: 0x0}, + 700: {region: 0x165, script: 0x57, flags: 0x0}, + 701: {region: 0x165, script: 0x57, flags: 0x0}, + 702: {region: 0x162, script: 0x57, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x57, flags: 0x0}, + 705: {region: 0xb8, script: 0x57, flags: 0x0}, + 706: {region: 0x4b, script: 0x57, flags: 0x0}, + 707: {region: 0x4b, script: 0x57, flags: 0x0}, + 708: {region: 0xa4, script: 0x57, flags: 0x0}, + 709: {region: 0xa4, script: 0x57, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x57, flags: 0x0}, + 712: {region: 0x123, script: 0xdf, flags: 0x0}, + 713: {region: 0x53, script: 0x38, flags: 0x0}, + 714: {region: 0x12b, script: 0x57, flags: 0x0}, + 715: {region: 0x95, script: 0x57, flags: 0x0}, + 716: {region: 0x52, script: 0x57, flags: 0x0}, + 717: {region: 0x99, script: 0x21, flags: 0x0}, + 718: {region: 0x99, script: 0x21, flags: 0x0}, + 719: {region: 0x95, script: 0x57, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x57, flags: 0x0}, + 722: {region: 0x165, script: 0x57, flags: 0x0}, + 723: {region: 0xcf, script: 0x57, flags: 0x0}, + 724: {region: 0x165, script: 0x57, flags: 0x0}, + 725: {region: 0x165, script: 0x57, flags: 0x0}, + 726: {region: 0x165, script: 0x57, flags: 0x0}, + 727: {region: 0x165, script: 0x57, flags: 0x0}, + 728: {region: 0x165, script: 0x57, flags: 0x0}, + 729: {region: 0x165, script: 0x57, flags: 0x0}, + 730: {region: 0x165, script: 0x57, flags: 0x0}, + 731: {region: 0x165, script: 0x57, flags: 0x0}, + 732: {region: 0x165, script: 0x57, flags: 0x0}, + 733: {region: 0x165, script: 0x57, flags: 0x0}, + 734: {region: 0x165, script: 0x57, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x1f, flags: 0x0}, + 737: {region: 0xe7, script: 0x57, flags: 0x0}, + 738: {region: 0x165, script: 0x57, flags: 0x0}, + 739: {region: 0x95, script: 0x57, flags: 0x0}, + 740: {region: 0x165, script: 0x29, flags: 0x0}, + 741: {region: 0x165, script: 0x57, flags: 0x0}, + 742: {region: 0x165, script: 0x57, flags: 0x0}, + 743: {region: 0x165, script: 0x57, flags: 0x0}, + 744: {region: 0x112, script: 0x57, flags: 0x0}, + 745: {region: 0xa4, script: 0x57, flags: 0x0}, + 746: {region: 0x165, script: 0x57, flags: 0x0}, + 747: {region: 0x165, script: 0x57, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x57, flags: 0x0}, + 750: {region: 0x165, script: 0x57, flags: 0x0}, + 751: {region: 0x165, script: 0x57, flags: 0x0}, + 752: {region: 0x165, script: 0x57, flags: 0x0}, + 753: {region: 0xbf, script: 0x57, flags: 0x0}, + 754: {region: 0xd1, script: 0x57, flags: 0x0}, + 755: {region: 0x165, script: 0x57, flags: 0x0}, + 756: {region: 0x52, script: 0x57, flags: 0x0}, + 757: {region: 0xdb, script: 0x21, flags: 0x0}, + 758: {region: 0x12f, script: 0x57, flags: 0x0}, + 759: {region: 0xc0, script: 0x57, flags: 0x0}, + 760: {region: 0x165, script: 0x57, flags: 0x0}, + 761: {region: 0x165, script: 0x57, flags: 0x0}, + 762: {region: 0xe0, script: 0x57, flags: 0x0}, + 763: {region: 0x165, script: 0x57, flags: 0x0}, + 764: {region: 0x95, script: 0x57, flags: 0x0}, + 765: {region: 0x9b, script: 0x3a, flags: 0x0}, + 766: {region: 0x165, script: 0x57, flags: 0x0}, + 767: {region: 0xc2, script: 0x1f, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x57, flags: 0x0}, + 770: {region: 0x165, script: 0x57, flags: 0x0}, + 771: {region: 0x165, script: 0x57, flags: 0x0}, + 772: {region: 0x99, script: 0x6b, flags: 0x0}, + 773: {region: 0x165, script: 0x57, flags: 0x0}, + 774: {region: 0x165, script: 0x57, flags: 0x0}, + 775: {region: 0x10b, script: 0x57, flags: 0x0}, + 776: {region: 0x165, script: 0x57, flags: 0x0}, + 777: {region: 0x165, script: 0x57, flags: 0x0}, + 778: {region: 0x165, script: 0x57, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x57, flags: 0x0}, + 781: {region: 0x165, script: 0x57, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x72, flags: 0x0}, + 785: {region: 0x165, script: 0x57, flags: 0x0}, + 786: {region: 0x49, script: 0x57, flags: 0x0}, + 787: {region: 0x49, script: 0x57, flags: 0x0}, + 788: {region: 0x37, script: 0x57, flags: 0x0}, + 789: {region: 0x165, script: 0x57, flags: 0x0}, + 790: {region: 0x165, script: 0x57, flags: 0x0}, + 791: {region: 0x165, script: 0x57, flags: 0x0}, + 792: {region: 0x165, script: 0x57, flags: 0x0}, + 793: {region: 0x165, script: 0x57, flags: 0x0}, + 794: {region: 0x165, script: 0x57, flags: 0x0}, + 795: {region: 0x99, script: 0x21, flags: 0x0}, + 796: {region: 0xdb, script: 0x21, flags: 0x0}, + 797: {region: 0x106, script: 0x1f, flags: 0x0}, + 798: {region: 0x35, script: 0x6f, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x57, flags: 0x0}, + 801: {region: 0x165, script: 0x57, flags: 0x0}, + 802: {region: 0x165, script: 0x57, flags: 0x0}, + 803: {region: 0x165, script: 0x57, flags: 0x0}, + 804: {region: 0x99, script: 0x21, flags: 0x0}, + 805: {region: 0x52, script: 0x57, flags: 0x0}, + 807: {region: 0x165, script: 0x57, flags: 0x0}, + 808: {region: 0x135, script: 0x57, flags: 0x0}, + 809: {region: 0x165, script: 0x57, flags: 0x0}, + 810: {region: 0x165, script: 0x57, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x57, flags: 0x0}, + 813: {region: 0x99, script: 0x21, flags: 0x0}, + 814: {region: 0x95, script: 0x57, flags: 0x0}, + 815: {region: 0x164, script: 0x57, flags: 0x0}, + 816: {region: 0x165, script: 0x57, flags: 0x0}, + 817: {region: 0xc4, script: 0x72, flags: 0x0}, + 818: {region: 0x165, script: 0x57, flags: 0x0}, + 819: {region: 0x165, script: 0x29, flags: 0x0}, + 820: {region: 0x106, script: 0x1f, flags: 0x0}, + 821: {region: 0x165, script: 0x57, flags: 0x0}, + 822: {region: 0x131, script: 0x57, flags: 0x0}, + 823: {region: 0x9c, script: 0x63, flags: 0x0}, + 824: {region: 0x165, script: 0x57, flags: 0x0}, + 825: {region: 0x165, script: 0x57, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x57, flags: 0x0}, + 828: {region: 0x165, script: 0x57, flags: 0x0}, + 829: {region: 0x165, script: 0x57, flags: 0x0}, + 830: {region: 0xdd, script: 0x57, flags: 0x0}, + 831: {region: 0x165, script: 0x57, flags: 0x0}, + 832: {region: 0x165, script: 0x57, flags: 0x0}, + 834: {region: 0x165, script: 0x57, flags: 0x0}, + 835: {region: 0x53, script: 0x38, flags: 0x0}, + 836: {region: 0x9e, script: 0x57, flags: 0x0}, + 837: {region: 0xd2, script: 0x57, flags: 0x0}, + 838: {region: 0x165, script: 0x57, flags: 0x0}, + 839: {region: 0xda, script: 0x57, flags: 0x0}, + 840: {region: 0x165, script: 0x57, flags: 0x0}, + 841: {region: 0x165, script: 0x57, flags: 0x0}, + 842: {region: 0x165, script: 0x57, flags: 0x0}, + 843: {region: 0xcf, script: 0x57, flags: 0x0}, + 844: {region: 0x165, script: 0x57, flags: 0x0}, + 845: {region: 0x165, script: 0x57, flags: 0x0}, + 846: {region: 0x164, script: 0x57, flags: 0x0}, + 847: {region: 0xd1, script: 0x57, flags: 0x0}, + 848: {region: 0x60, script: 0x57, flags: 0x0}, + 849: {region: 0xdb, script: 0x21, flags: 0x0}, + 850: {region: 0x165, script: 0x57, flags: 0x0}, + 851: {region: 0xdb, script: 0x21, flags: 0x0}, + 852: {region: 0x165, script: 0x57, flags: 0x0}, + 853: {region: 0x165, script: 0x57, flags: 0x0}, + 854: {region: 0xd2, script: 0x57, flags: 0x0}, + 855: {region: 0x165, script: 0x57, flags: 0x0}, + 856: {region: 0x165, script: 0x57, flags: 0x0}, + 857: {region: 0xd1, script: 0x57, flags: 0x0}, + 858: {region: 0x165, script: 0x57, flags: 0x0}, + 859: {region: 0xcf, script: 0x57, flags: 0x0}, + 860: {region: 0xcf, script: 0x57, flags: 0x0}, + 861: {region: 0x165, script: 0x57, flags: 0x0}, + 862: {region: 0x165, script: 0x57, flags: 0x0}, + 863: {region: 0x95, script: 0x57, flags: 0x0}, + 864: {region: 0x165, script: 0x57, flags: 0x0}, + 865: {region: 0xdf, script: 0x57, flags: 0x0}, + 866: {region: 0x165, script: 0x57, flags: 0x0}, + 867: {region: 0x165, script: 0x57, flags: 0x0}, + 868: {region: 0x99, script: 0x57, flags: 0x0}, + 869: {region: 0x165, script: 0x57, flags: 0x0}, + 870: {region: 0x165, script: 0x57, flags: 0x0}, + 871: {region: 0xd9, script: 0x57, flags: 0x0}, + 872: {region: 0x52, script: 0x57, flags: 0x0}, + 873: {region: 0x165, script: 0x57, flags: 0x0}, + 874: {region: 0xda, script: 0x57, flags: 0x0}, + 875: {region: 0x165, script: 0x57, flags: 0x0}, + 876: {region: 0x52, script: 0x57, flags: 0x0}, + 877: {region: 0x165, script: 0x57, flags: 0x0}, + 878: {region: 0x165, script: 0x57, flags: 0x0}, + 879: {region: 0xda, script: 0x57, flags: 0x0}, + 880: {region: 0x123, script: 0x53, flags: 0x0}, + 881: {region: 0x99, script: 0x21, flags: 0x0}, + 882: {region: 0x10c, script: 0xbf, flags: 0x0}, + 883: {region: 0x165, script: 0x57, flags: 0x0}, + 884: {region: 0x165, script: 0x57, flags: 0x0}, + 885: {region: 0x84, script: 0x78, flags: 0x0}, + 886: {region: 0x161, script: 0x57, flags: 0x0}, + 887: {region: 0x165, script: 0x57, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x57, flags: 0x0}, + 890: {region: 0x161, script: 0x57, flags: 0x0}, + 891: {region: 0x165, script: 0x57, flags: 0x0}, + 892: {region: 0x165, script: 0x57, flags: 0x0}, + 893: {region: 0x165, script: 0x57, flags: 0x0}, + 894: {region: 0x165, script: 0x57, flags: 0x0}, + 895: {region: 0x165, script: 0x57, flags: 0x0}, + 896: {region: 0x117, script: 0x57, flags: 0x0}, + 897: {region: 0x165, script: 0x57, flags: 0x0}, + 898: {region: 0x165, script: 0x57, flags: 0x0}, + 899: {region: 0x135, script: 0x57, flags: 0x0}, + 900: {region: 0x165, script: 0x57, flags: 0x0}, + 901: {region: 0x53, script: 0x57, flags: 0x0}, + 902: {region: 0x165, script: 0x57, flags: 0x0}, + 903: {region: 0xce, script: 0x57, flags: 0x0}, + 904: {region: 0x12f, script: 0x57, flags: 0x0}, + 905: {region: 0x131, script: 0x57, flags: 0x0}, + 906: {region: 0x80, script: 0x57, flags: 0x0}, + 907: {region: 0x78, script: 0x57, flags: 0x0}, + 908: {region: 0x165, script: 0x57, flags: 0x0}, + 910: {region: 0x165, script: 0x57, flags: 0x0}, + 911: {region: 0x165, script: 0x57, flags: 0x0}, + 912: {region: 0x6f, script: 0x57, flags: 0x0}, + 913: {region: 0x165, script: 0x57, flags: 0x0}, + 914: {region: 0x165, script: 0x57, flags: 0x0}, + 915: {region: 0x165, script: 0x57, flags: 0x0}, + 916: {region: 0x165, script: 0x57, flags: 0x0}, + 917: {region: 0x99, script: 0x7d, flags: 0x0}, + 918: {region: 0x165, script: 0x57, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x1f, flags: 0x0}, + 921: {region: 0x135, script: 0x7e, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x7c, flags: 0x0}, + 924: {region: 0x165, script: 0x57, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x57, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x57, flags: 0x0}, + 929: {region: 0x30, script: 0x57, flags: 0x0}, + 930: {region: 0xf0, script: 0x57, flags: 0x0}, + 931: {region: 0x165, script: 0x57, flags: 0x0}, + 932: {region: 0x78, script: 0x57, flags: 0x0}, + 933: {region: 0xd6, script: 0x57, flags: 0x0}, + 934: {region: 0x135, script: 0x57, flags: 0x0}, + 935: {region: 0x49, script: 0x57, flags: 0x0}, + 936: {region: 0x165, script: 0x57, flags: 0x0}, + 937: {region: 0x9c, script: 0xe8, flags: 0x0}, + 938: {region: 0x165, script: 0x57, flags: 0x0}, + 939: {region: 0x60, script: 0x57, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x87, flags: 0x0}, + 943: {region: 0x165, script: 0x57, flags: 0x0}, + 944: {region: 0x165, script: 0x57, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x57, flags: 0x0}, + 947: {region: 0xe9, script: 0x57, flags: 0x0}, + 948: {region: 0x165, script: 0x57, flags: 0x0}, + 949: {region: 0x9e, script: 0x57, flags: 0x0}, + 950: {region: 0x165, script: 0x57, flags: 0x0}, + 951: {region: 0x165, script: 0x57, flags: 0x0}, + 952: {region: 0x87, script: 0x31, flags: 0x0}, + 953: {region: 0x75, script: 0x57, flags: 0x0}, + 954: {region: 0x165, script: 0x57, flags: 0x0}, + 955: {region: 0xe8, script: 0x4a, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x57, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x57, flags: 0x0}, + 960: {region: 0x41, script: 0x57, flags: 0x0}, + 961: {region: 0x165, script: 0x57, flags: 0x0}, + 962: {region: 0x7a, script: 0x57, flags: 0x0}, + 963: {region: 0x165, script: 0x57, flags: 0x0}, + 964: {region: 0xe4, script: 0x57, flags: 0x0}, + 965: {region: 0x89, script: 0x57, flags: 0x0}, + 966: {region: 0x69, script: 0x57, flags: 0x0}, + 967: {region: 0x165, script: 0x57, flags: 0x0}, + 968: {region: 0x99, script: 0x21, flags: 0x0}, + 969: {region: 0x165, script: 0x57, flags: 0x0}, + 970: {region: 0x102, script: 0x57, flags: 0x0}, + 971: {region: 0x95, script: 0x57, flags: 0x0}, + 972: {region: 0x165, script: 0x57, flags: 0x0}, + 973: {region: 0x165, script: 0x57, flags: 0x0}, + 974: {region: 0x9e, script: 0x57, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x57, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x21, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x57, flags: 0x0}, + 981: {region: 0x72, script: 0x57, flags: 0x0}, + 982: {region: 0x4e, script: 0x57, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x57, flags: 0x0}, + 985: {region: 0x3a, script: 0x57, flags: 0x0}, + 986: {region: 0x165, script: 0x57, flags: 0x0}, + 987: {region: 0xd1, script: 0x57, flags: 0x0}, + 988: {region: 0x104, script: 0x57, flags: 0x0}, + 989: {region: 0x95, script: 0x57, flags: 0x0}, + 990: {region: 0x12f, script: 0x57, flags: 0x0}, + 991: {region: 0x165, script: 0x57, flags: 0x0}, + 992: {region: 0x165, script: 0x57, flags: 0x0}, + 993: {region: 0x73, script: 0x57, flags: 0x0}, + 994: {region: 0x106, script: 0x1f, flags: 0x0}, + 995: {region: 0x130, script: 0x1f, flags: 0x0}, + 996: {region: 0x109, script: 0x57, flags: 0x0}, + 997: {region: 0x107, script: 0x57, flags: 0x0}, + 998: {region: 0x12f, script: 0x57, flags: 0x0}, + 999: {region: 0x165, script: 0x57, flags: 0x0}, + 1000: {region: 0xa2, script: 0x49, flags: 0x0}, + 1001: {region: 0x99, script: 0x21, flags: 0x0}, + 1002: {region: 0x80, script: 0x57, flags: 0x0}, + 1003: {region: 0x106, script: 0x1f, flags: 0x0}, + 1004: {region: 0xa4, script: 0x57, flags: 0x0}, + 1005: {region: 0x95, script: 0x57, flags: 0x0}, + 1006: {region: 0x99, script: 0x57, flags: 0x0}, + 1007: {region: 0x114, script: 0x57, flags: 0x0}, + 1008: {region: 0x99, script: 0xc3, flags: 0x0}, + 1009: {region: 0x165, script: 0x57, flags: 0x0}, + 1010: {region: 0x165, script: 0x57, flags: 0x0}, + 1011: {region: 0x12f, script: 0x57, flags: 0x0}, + 1012: {region: 0x9e, script: 0x57, flags: 0x0}, + 1013: {region: 0x99, script: 0x21, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x57, flags: 0x0}, + 1016: {region: 0x7b, script: 0x57, flags: 0x0}, + 1017: {region: 0x49, script: 0x57, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x57, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x57, flags: 0x0}, + 1022: {region: 0x4f, script: 0x57, flags: 0x0}, + 1023: {region: 0xd1, script: 0x57, flags: 0x0}, + 1024: {region: 0xcf, script: 0x57, flags: 0x0}, + 1025: {region: 0xc3, script: 0x57, flags: 0x0}, + 1026: {region: 0x4c, script: 0x57, flags: 0x0}, + 1027: {region: 0x96, script: 0x7a, flags: 0x0}, + 1028: {region: 0xb6, script: 0x57, flags: 0x0}, + 1029: {region: 0x165, script: 0x29, flags: 0x0}, + 1030: {region: 0x165, script: 0x57, flags: 0x0}, + 1032: {region: 0xba, script: 0xdc, flags: 0x0}, + 1033: {region: 0x165, script: 0x57, flags: 0x0}, + 1034: {region: 0xc4, script: 0x72, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xca, flags: 0x0}, + 1037: {region: 0x6f, script: 0x57, flags: 0x0}, + 1038: {region: 0x165, script: 0x57, flags: 0x0}, + 1039: {region: 0x165, script: 0x57, flags: 0x0}, + 1040: {region: 0x165, script: 0x57, flags: 0x0}, + 1041: {region: 0x165, script: 0x57, flags: 0x0}, + 1042: {region: 0x111, script: 0x57, flags: 0x0}, + 1043: {region: 0x165, script: 0x57, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x57, flags: 0x0}, + 1046: {region: 0x10f, script: 0x57, flags: 0x0}, + 1047: {region: 0x165, script: 0x57, flags: 0x0}, + 1048: {region: 0xe9, script: 0x57, flags: 0x0}, + 1049: {region: 0x165, script: 0x57, flags: 0x0}, + 1050: {region: 0x95, script: 0x57, flags: 0x0}, + 1051: {region: 0x142, script: 0x57, flags: 0x0}, + 1052: {region: 0x10c, script: 0x57, flags: 0x0}, + 1054: {region: 0x10c, script: 0x57, flags: 0x0}, + 1055: {region: 0x72, script: 0x57, flags: 0x0}, + 1056: {region: 0x97, script: 0xc0, flags: 0x0}, + 1057: {region: 0x165, script: 0x57, flags: 0x0}, + 1058: {region: 0x72, script: 0x57, flags: 0x0}, + 1059: {region: 0x164, script: 0x57, flags: 0x0}, + 1060: {region: 0x165, script: 0x57, flags: 0x0}, + 1061: {region: 0xc3, script: 0x57, flags: 0x0}, + 1062: {region: 0x165, script: 0x57, flags: 0x0}, + 1063: {region: 0x165, script: 0x57, flags: 0x0}, + 1064: {region: 0x165, script: 0x57, flags: 0x0}, + 1065: {region: 0x115, script: 0x57, flags: 0x0}, + 1066: {region: 0x165, script: 0x57, flags: 0x0}, + 1067: {region: 0x165, script: 0x57, flags: 0x0}, + 1068: {region: 0x123, script: 0xdf, flags: 0x0}, + 1069: {region: 0x165, script: 0x57, flags: 0x0}, + 1070: {region: 0x165, script: 0x57, flags: 0x0}, + 1071: {region: 0x165, script: 0x57, flags: 0x0}, + 1072: {region: 0x165, script: 0x57, flags: 0x0}, + 1073: {region: 0x27, script: 0x57, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xcb, flags: 0x0}, + 1076: {region: 0x116, script: 0x57, flags: 0x0}, + 1077: {region: 0x114, script: 0x57, flags: 0x0}, + 1078: {region: 0x99, script: 0x21, flags: 0x0}, + 1079: {region: 0x161, script: 0x57, flags: 0x0}, + 1080: {region: 0x165, script: 0x57, flags: 0x0}, + 1081: {region: 0x165, script: 0x57, flags: 0x0}, + 1082: {region: 0x6d, script: 0x57, flags: 0x0}, + 1083: {region: 0x161, script: 0x57, flags: 0x0}, + 1084: {region: 0x165, script: 0x57, flags: 0x0}, + 1085: {region: 0x60, script: 0x57, flags: 0x0}, + 1086: {region: 0x95, script: 0x57, flags: 0x0}, + 1087: {region: 0x165, script: 0x57, flags: 0x0}, + 1088: {region: 0x165, script: 0x57, flags: 0x0}, + 1089: {region: 0x12f, script: 0x57, flags: 0x0}, + 1090: {region: 0x165, script: 0x57, flags: 0x0}, + 1091: {region: 0x84, script: 0x57, flags: 0x0}, + 1092: {region: 0x10c, script: 0x57, flags: 0x0}, + 1093: {region: 0x12f, script: 0x57, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x57, flags: 0x0}, + 1096: {region: 0x60, script: 0x57, flags: 0x0}, + 1097: {region: 0x165, script: 0x57, flags: 0x0}, + 1098: {region: 0x99, script: 0x21, flags: 0x0}, + 1099: {region: 0x95, script: 0x57, flags: 0x0}, + 1100: {region: 0x165, script: 0x57, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, + 1103: {region: 0xe9, script: 0x57, flags: 0x0}, + 1104: {region: 0x99, script: 0xd7, flags: 0x0}, + 1105: {region: 0xdb, script: 0x21, flags: 0x0}, + 1106: {region: 0x165, script: 0x57, flags: 0x0}, + 1107: {region: 0x165, script: 0x57, flags: 0x0}, + 1108: {region: 0x165, script: 0x57, flags: 0x0}, + 1109: {region: 0x165, script: 0x57, flags: 0x0}, + 1110: {region: 0x165, script: 0x57, flags: 0x0}, + 1111: {region: 0x165, script: 0x57, flags: 0x0}, + 1112: {region: 0x165, script: 0x57, flags: 0x0}, + 1113: {region: 0x165, script: 0x57, flags: 0x0}, + 1114: {region: 0xe7, script: 0x57, flags: 0x0}, + 1115: {region: 0x165, script: 0x57, flags: 0x0}, + 1116: {region: 0x165, script: 0x57, flags: 0x0}, + 1117: {region: 0x99, script: 0x4f, flags: 0x0}, + 1118: {region: 0x53, script: 0xd5, flags: 0x0}, + 1119: {region: 0xdb, script: 0x21, flags: 0x0}, + 1120: {region: 0xdb, script: 0x21, flags: 0x0}, + 1121: {region: 0x99, script: 0xda, flags: 0x0}, + 1122: {region: 0x165, script: 0x57, flags: 0x0}, + 1123: {region: 0x112, script: 0x57, flags: 0x0}, + 1124: {region: 0x131, script: 0x57, flags: 0x0}, + 1125: {region: 0x126, script: 0x57, flags: 0x0}, + 1126: {region: 0x165, script: 0x57, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x57, flags: 0x0}, + 1129: {region: 0x165, script: 0x57, flags: 0x0}, + 1130: {region: 0x165, script: 0x57, flags: 0x0}, + 1131: {region: 0x123, script: 0xdf, flags: 0x0}, + 1132: {region: 0xdb, script: 0x21, flags: 0x0}, + 1133: {region: 0xdb, script: 0x21, flags: 0x0}, + 1134: {region: 0xdb, script: 0x21, flags: 0x0}, + 1135: {region: 0x6f, script: 0x29, flags: 0x0}, + 1136: {region: 0x165, script: 0x57, flags: 0x0}, + 1137: {region: 0x6d, script: 0x29, flags: 0x0}, + 1138: {region: 0x165, script: 0x57, flags: 0x0}, + 1139: {region: 0x165, script: 0x57, flags: 0x0}, + 1140: {region: 0x165, script: 0x57, flags: 0x0}, + 1141: {region: 0xd6, script: 0x57, flags: 0x0}, + 1142: {region: 0x127, script: 0x57, flags: 0x0}, + 1143: {region: 0x125, script: 0x57, flags: 0x0}, + 1144: {region: 0x32, script: 0x57, flags: 0x0}, + 1145: {region: 0xdb, script: 0x21, flags: 0x0}, + 1146: {region: 0xe7, script: 0x57, flags: 0x0}, + 1147: {region: 0x165, script: 0x57, flags: 0x0}, + 1148: {region: 0x165, script: 0x57, flags: 0x0}, + 1149: {region: 0x32, script: 0x57, flags: 0x0}, + 1150: {region: 0xd4, script: 0x57, flags: 0x0}, + 1151: {region: 0x165, script: 0x57, flags: 0x0}, + 1152: {region: 0x161, script: 0x57, flags: 0x0}, + 1153: {region: 0x165, script: 0x57, flags: 0x0}, + 1154: {region: 0x129, script: 0x57, flags: 0x0}, + 1155: {region: 0x165, script: 0x57, flags: 0x0}, + 1156: {region: 0xce, script: 0x57, flags: 0x0}, + 1157: {region: 0x165, script: 0x57, flags: 0x0}, + 1158: {region: 0xe6, script: 0x57, flags: 0x0}, + 1159: {region: 0x165, script: 0x57, flags: 0x0}, + 1160: {region: 0x165, script: 0x57, flags: 0x0}, + 1161: {region: 0x165, script: 0x57, flags: 0x0}, + 1162: {region: 0x12b, script: 0x57, flags: 0x0}, + 1163: {region: 0x12b, script: 0x57, flags: 0x0}, + 1164: {region: 0x12e, script: 0x57, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x57, flags: 0x0}, + 1167: {region: 0x87, script: 0x31, flags: 0x0}, + 1168: {region: 0xdb, script: 0x21, flags: 0x0}, + 1169: {region: 0xe7, script: 0x57, flags: 0x0}, + 1170: {region: 0x43, script: 0xe0, flags: 0x0}, + 1171: {region: 0x165, script: 0x57, flags: 0x0}, + 1172: {region: 0x106, script: 0x1f, flags: 0x0}, + 1173: {region: 0x165, script: 0x57, flags: 0x0}, + 1174: {region: 0x165, script: 0x57, flags: 0x0}, + 1175: {region: 0x131, script: 0x57, flags: 0x0}, + 1176: {region: 0x165, script: 0x57, flags: 0x0}, + 1177: {region: 0x123, script: 0xdf, flags: 0x0}, + 1178: {region: 0x32, script: 0x57, flags: 0x0}, + 1179: {region: 0x165, script: 0x57, flags: 0x0}, + 1180: {region: 0x165, script: 0x57, flags: 0x0}, + 1181: {region: 0xce, script: 0x57, flags: 0x0}, + 1182: {region: 0x165, script: 0x57, flags: 0x0}, + 1183: {region: 0x165, script: 0x57, flags: 0x0}, + 1184: {region: 0x12d, script: 0x57, flags: 0x0}, + 1185: {region: 0x165, script: 0x57, flags: 0x0}, + 1187: {region: 0x165, script: 0x57, flags: 0x0}, + 1188: {region: 0xd4, script: 0x57, flags: 0x0}, + 1189: {region: 0x53, script: 0xd8, flags: 0x0}, + 1190: {region: 0xe5, script: 0x57, flags: 0x0}, + 1191: {region: 0x165, script: 0x57, flags: 0x0}, + 1192: {region: 0x106, script: 0x1f, flags: 0x0}, + 1193: {region: 0xba, script: 0x57, flags: 0x0}, + 1194: {region: 0x165, script: 0x57, flags: 0x0}, + 1195: {region: 0x106, script: 0x1f, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, + 1198: {region: 0x130, script: 0x1f, flags: 0x0}, + 1199: {region: 0x75, script: 0x57, flags: 0x0}, + 1200: {region: 0x2a, script: 0x57, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x57, flags: 0x0}, + 1206: {region: 0x165, script: 0x57, flags: 0x0}, + 1207: {region: 0x165, script: 0x57, flags: 0x0}, + 1208: {region: 0x165, script: 0x57, flags: 0x0}, + 1209: {region: 0x165, script: 0x57, flags: 0x0}, + 1210: {region: 0x165, script: 0x57, flags: 0x0}, + 1211: {region: 0x165, script: 0x57, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x57, flags: 0x0}, + 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, + 1215: {region: 0x165, script: 0x57, flags: 0x0}, + 1216: {region: 0x161, script: 0x57, flags: 0x0}, + 1217: {region: 0x9e, script: 0x57, flags: 0x0}, + 1218: {region: 0x106, script: 0x57, flags: 0x0}, + 1219: {region: 0x13e, script: 0x57, flags: 0x0}, + 1220: {region: 0x11b, script: 0x57, flags: 0x0}, + 1221: {region: 0x165, script: 0x57, flags: 0x0}, + 1222: {region: 0x36, script: 0x57, flags: 0x0}, + 1223: {region: 0x60, script: 0x57, flags: 0x0}, + 1224: {region: 0xd1, script: 0x57, flags: 0x0}, + 1225: {region: 0x1, script: 0x57, flags: 0x0}, + 1226: {region: 0x106, script: 0x57, flags: 0x0}, + 1227: {region: 0x6a, script: 0x57, flags: 0x0}, + 1228: {region: 0x12f, script: 0x57, flags: 0x0}, + 1229: {region: 0x165, script: 0x57, flags: 0x0}, + 1230: {region: 0x36, script: 0x57, flags: 0x0}, + 1231: {region: 0x4e, script: 0x57, flags: 0x0}, + 1232: {region: 0x165, script: 0x57, flags: 0x0}, + 1233: {region: 0x6f, script: 0x29, flags: 0x0}, + 1234: {region: 0x165, script: 0x57, flags: 0x0}, + 1235: {region: 0xe7, script: 0x57, flags: 0x0}, + 1236: {region: 0x2f, script: 0x57, flags: 0x0}, + 1237: {region: 0x99, script: 0xda, flags: 0x0}, + 1238: {region: 0x99, script: 0x21, flags: 0x0}, + 1239: {region: 0x165, script: 0x57, flags: 0x0}, + 1240: {region: 0x165, script: 0x57, flags: 0x0}, + 1241: {region: 0x165, script: 0x57, flags: 0x0}, + 1242: {region: 0x165, script: 0x57, flags: 0x0}, + 1243: {region: 0x165, script: 0x57, flags: 0x0}, + 1244: {region: 0x165, script: 0x57, flags: 0x0}, + 1245: {region: 0x165, script: 0x57, flags: 0x0}, + 1246: {region: 0x165, script: 0x57, flags: 0x0}, + 1247: {region: 0x165, script: 0x57, flags: 0x0}, + 1248: {region: 0x140, script: 0x57, flags: 0x0}, + 1249: {region: 0x165, script: 0x57, flags: 0x0}, + 1250: {region: 0x165, script: 0x57, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x57, flags: 0x0}, + 1253: {region: 0x114, script: 0x57, flags: 0x0}, + 1254: {region: 0x165, script: 0x57, flags: 0x0}, + 1255: {region: 0x165, script: 0x57, flags: 0x0}, + 1256: {region: 0x165, script: 0x57, flags: 0x0}, + 1257: {region: 0x165, script: 0x57, flags: 0x0}, + 1258: {region: 0x99, script: 0x21, flags: 0x0}, + 1259: {region: 0x53, script: 0x38, flags: 0x0}, + 1260: {region: 0x165, script: 0x57, flags: 0x0}, + 1261: {region: 0x165, script: 0x57, flags: 0x0}, + 1262: {region: 0x41, script: 0x57, flags: 0x0}, + 1263: {region: 0x165, script: 0x57, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x57, flags: 0x0}, + 1266: {region: 0x161, script: 0x57, flags: 0x0}, + 1267: {region: 0x165, script: 0x57, flags: 0x0}, + 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, + 1269: {region: 0x12b, script: 0x60, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, + 1271: {region: 0x53, script: 0x64, flags: 0x0}, + 1272: {region: 0x10b, script: 0x69, flags: 0x0}, + 1273: {region: 0x108, script: 0x73, flags: 0x0}, + 1274: {region: 0x99, script: 0x21, flags: 0x0}, + 1275: {region: 0x131, script: 0x57, flags: 0x0}, + 1276: {region: 0x165, script: 0x57, flags: 0x0}, + 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, + 1278: {region: 0x165, script: 0x57, flags: 0x0}, + 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, + 1280: {region: 0x165, script: 0x57, flags: 0x0}, + 1281: {region: 0x165, script: 0x57, flags: 0x0}, + 1282: {region: 0xdb, script: 0x21, flags: 0x0}, + 1283: {region: 0x165, script: 0x57, flags: 0x0}, + 1284: {region: 0x165, script: 0x57, flags: 0x0}, + 1285: {region: 0xd1, script: 0x57, flags: 0x0}, + 1286: {region: 0x75, script: 0x57, flags: 0x0}, + 1287: {region: 0x165, script: 0x57, flags: 0x0}, + 1288: {region: 0x165, script: 0x57, flags: 0x0}, + 1289: {region: 0x52, script: 0x57, flags: 0x0}, + 1290: {region: 0x165, script: 0x57, flags: 0x0}, + 1291: {region: 0x165, script: 0x57, flags: 0x0}, + 1292: {region: 0x165, script: 0x57, flags: 0x0}, + 1293: {region: 0x52, script: 0x57, flags: 0x0}, + 1294: {region: 0x165, script: 0x57, flags: 0x0}, + 1295: {region: 0x165, script: 0x57, flags: 0x0}, + 1296: {region: 0x165, script: 0x57, flags: 0x0}, + 1297: {region: 0x165, script: 0x57, flags: 0x0}, + 1298: {region: 0x1, script: 0x3b, flags: 0x0}, + 1299: {region: 0x165, script: 0x57, flags: 0x0}, + 1300: {region: 0x165, script: 0x57, flags: 0x0}, + 1301: {region: 0x165, script: 0x57, flags: 0x0}, + 1302: {region: 0x165, script: 0x57, flags: 0x0}, + 1303: {region: 0x165, script: 0x57, flags: 0x0}, + 1304: {region: 0xd6, script: 0x57, flags: 0x0}, + 1305: {region: 0x165, script: 0x57, flags: 0x0}, + 1306: {region: 0x165, script: 0x57, flags: 0x0}, + 1307: {region: 0x165, script: 0x57, flags: 0x0}, + 1308: {region: 0x41, script: 0x57, flags: 0x0}, + 1309: {region: 0x165, script: 0x57, flags: 0x0}, + 1310: {region: 0xcf, script: 0x57, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x57, flags: 0x0}, + 1313: {region: 0x165, script: 0x57, flags: 0x0}, + 1314: {region: 0x165, script: 0x57, flags: 0x0}, + 1315: {region: 0x53, script: 0x57, flags: 0x0}, + 1316: {region: 0x10b, script: 0x57, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x57, flags: 0x0}, + 1320: {region: 0xba, script: 0xdc, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x79, flags: 0x0}, + 1323: {region: 0x165, script: 0x57, flags: 0x0}, + 1324: {region: 0x122, script: 0x57, flags: 0x0}, + 1325: {region: 0xd0, script: 0x57, flags: 0x0}, + 1326: {region: 0x165, script: 0x57, flags: 0x0}, + 1327: {region: 0x161, script: 0x57, flags: 0x0}, + 1329: {region: 0x12b, script: 0x57, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x74, flags: 0x2}, + 2: {region: 0x11c, script: 0x80, flags: 0x2}, + 3: {region: 0x32, script: 0x57, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x1f, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x1f, flags: 0x0}, + 9: {region: 0x38, script: 0x2c, flags: 0x2}, + 10: {region: 0x135, script: 0x57, flags: 0x0}, + 11: {region: 0x7b, script: 0xc5, flags: 0x2}, + 12: {region: 0x114, script: 0x57, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1e, flags: 0x0}, + 15: {region: 0x87, script: 0x5c, flags: 0x2}, + 16: {region: 0xd6, script: 0x57, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x1f, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x57, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x1f, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x57, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x57, flags: 0x2}, + 33: {region: 0xdb, script: 0x21, flags: 0x0}, + 34: {region: 0x99, script: 0x5a, flags: 0x2}, + 35: {region: 0x83, script: 0x57, flags: 0x0}, + 36: {region: 0x84, script: 0x78, flags: 0x4}, + 37: {region: 0x84, script: 0x78, flags: 0x2}, + 38: {region: 0xc5, script: 0x1f, flags: 0x0}, + 39: {region: 0x53, script: 0x6d, flags: 0x4}, + 40: {region: 0x53, script: 0x6d, flags: 0x2}, + 41: {region: 0xd0, script: 0x57, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x33, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x84, flags: 0x0}, + 48: {region: 0x53, script: 0x85, flags: 0x2}, + 49: {region: 0xba, script: 0xdc, flags: 0x0}, + 50: {region: 0xd9, script: 0x57, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x21, flags: 0x2}, + 53: {region: 0x99, script: 0x4c, flags: 0x2}, + 54: {region: 0x99, script: 0xc9, flags: 0x2}, + 55: {region: 0x105, script: 0x1f, flags: 0x0}, + 56: {region: 0xbd, script: 0x57, flags: 0x4}, + 57: {region: 0x104, script: 0x57, flags: 0x4}, + 58: {region: 0x106, script: 0x57, flags: 0x4}, + 59: {region: 0x12b, script: 0x57, flags: 0x4}, + 60: {region: 0x124, script: 0x1f, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x1f, flags: 0x4}, + 65: {region: 0xc5, script: 0x1f, flags: 0x4}, + 66: {region: 0xae, script: 0x1f, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x21, flags: 0x4}, + 69: {region: 0xdb, script: 0x21, flags: 0x2}, + 70: {region: 0x137, script: 0x57, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x1f, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x39, flags: 0x0}, + 75: {region: 0x53, script: 0x38, flags: 0x4}, + 76: {region: 0x53, script: 0x38, flags: 0x2}, + 77: {region: 0x53, script: 0x38, flags: 0x0}, + 78: {region: 0x2f, script: 0x39, flags: 0x4}, + 79: {region: 0x3e, script: 0x39, flags: 0x4}, + 80: {region: 0x7b, script: 0x39, flags: 0x4}, + 81: {region: 0x7e, script: 0x39, flags: 0x4}, + 82: {region: 0x8d, script: 0x39, flags: 0x4}, + 83: {region: 0x95, script: 0x39, flags: 0x4}, + 84: {region: 0xc6, script: 0x39, flags: 0x4}, + 85: {region: 0xd0, script: 0x39, flags: 0x4}, + 86: {region: 0xe2, script: 0x39, flags: 0x4}, + 87: {region: 0xe5, script: 0x39, flags: 0x4}, + 88: {region: 0xe7, script: 0x39, flags: 0x4}, + 89: {region: 0x116, script: 0x39, flags: 0x4}, + 90: {region: 0x123, script: 0x39, flags: 0x4}, + 91: {region: 0x12e, script: 0x39, flags: 0x4}, + 92: {region: 0x135, script: 0x39, flags: 0x4}, + 93: {region: 0x13e, script: 0x39, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x34, flags: 0x2}, + 96: {region: 0x12e, script: 0x39, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 1432 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x57, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 43: {lang: 0x0, script: 0x57, flags: 0x0}, + 44: {lang: 0x13e, script: 0x57, flags: 0x0}, + 45: {lang: 0x41b, script: 0x57, flags: 0x0}, + 46: {lang: 0x10d, script: 0x57, flags: 0x0}, + 48: {lang: 0x367, script: 0x57, flags: 0x0}, + 49: {lang: 0x444, script: 0x57, flags: 0x0}, + 50: {lang: 0x58, script: 0x57, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x57, flags: 0x0}, + 55: {lang: 0x15e, script: 0x57, flags: 0x0}, + 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, + 59: {lang: 0x15e, script: 0x57, flags: 0x0}, + 60: {lang: 0x15e, script: 0x57, flags: 0x0}, + 62: {lang: 0x31f, script: 0x57, flags: 0x0}, + 63: {lang: 0x13e, script: 0x57, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x57, flags: 0x0}, + 71: {lang: 0x71, script: 0x1f, flags: 0x0}, + 73: {lang: 0x512, script: 0x3b, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x57, flags: 0x0}, + 76: {lang: 0x15e, script: 0x57, flags: 0x0}, + 77: {lang: 0x15e, script: 0x57, flags: 0x0}, + 78: {lang: 0x10d, script: 0x57, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 81: {lang: 0x13e, script: 0x57, flags: 0x0}, + 82: {lang: 0x15e, script: 0x57, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x57, flags: 0x0}, + 85: {lang: 0x0, script: 0x57, flags: 0x0}, + 86: {lang: 0x13e, script: 0x57, flags: 0x0}, + 89: {lang: 0x13e, script: 0x57, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x57, flags: 0x0}, + 96: {lang: 0x10d, script: 0x57, flags: 0x0}, + 98: {lang: 0x1, script: 0x57, flags: 0x0}, + 99: {lang: 0x101, script: 0x57, flags: 0x0}, + 101: {lang: 0x13e, script: 0x57, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x57, flags: 0x0}, + 105: {lang: 0x13e, script: 0x57, flags: 0x0}, + 106: {lang: 0x140, script: 0x57, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x29, flags: 0x0}, + 110: {lang: 0x13e, script: 0x57, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x57, flags: 0x0}, + 114: {lang: 0x151, script: 0x57, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, + 118: {lang: 0x158, script: 0x57, flags: 0x0}, + 120: {lang: 0x15e, script: 0x57, flags: 0x0}, + 122: {lang: 0x15e, script: 0x57, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x57, flags: 0x0}, + 128: {lang: 0x21, script: 0x57, flags: 0x0}, + 130: {lang: 0x245, script: 0x57, flags: 0x0}, + 132: {lang: 0x15e, script: 0x57, flags: 0x0}, + 133: {lang: 0x15e, script: 0x57, flags: 0x0}, + 134: {lang: 0x13e, script: 0x57, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x57, flags: 0x0}, + 137: {lang: 0x13e, script: 0x57, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 141: {lang: 0x529, script: 0x39, flags: 0x0}, + 142: {lang: 0x0, script: 0x57, flags: 0x0}, + 143: {lang: 0x13e, script: 0x57, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, + 148: {lang: 0x13e, script: 0x57, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x46, flags: 0x0}, + 164: {lang: 0x445, script: 0x57, flags: 0x0}, + 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x50, flags: 0x0}, + 171: {lang: 0x254, script: 0x50, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x57, flags: 0x0}, + 179: {lang: 0x40c, script: 0xca, flags: 0x0}, + 181: {lang: 0x43b, script: 0x57, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, + 183: {lang: 0x15e, script: 0x57, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x57, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x57, flags: 0x0}, + 190: {lang: 0x15e, script: 0x57, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x57, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x57, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x57, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xde, flags: 0x0}, + 207: {lang: 0x13e, script: 0x57, flags: 0x0}, + 208: {lang: 0x31f, script: 0x57, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 210: {lang: 0x16, script: 0x57, flags: 0x0}, + 211: {lang: 0x15e, script: 0x57, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x57, flags: 0x0}, + 217: {lang: 0x367, script: 0x57, flags: 0x0}, + 218: {lang: 0x347, script: 0x57, flags: 0x0}, + 219: {lang: 0x351, script: 0x21, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x57, flags: 0x0}, + 228: {lang: 0x13e, script: 0x57, flags: 0x0}, + 229: {lang: 0x15e, script: 0x57, flags: 0x0}, + 230: {lang: 0x486, script: 0x57, flags: 0x0}, + 231: {lang: 0x153, script: 0x57, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 234: {lang: 0x15e, script: 0x57, flags: 0x0}, + 236: {lang: 0x13e, script: 0x57, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, + 241: {lang: 0x194, script: 0x57, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x57, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x1f, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x57, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x57, flags: 0x0}, + 272: {lang: 0x347, script: 0x57, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 276: {lang: 0x15e, script: 0x57, flags: 0x0}, + 277: {lang: 0x429, script: 0x57, flags: 0x0}, + 278: {lang: 0x367, script: 0x57, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 282: {lang: 0x13e, script: 0x57, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x57, flags: 0x0}, + 289: {lang: 0x15e, script: 0x57, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x57, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 295: {lang: 0x476, script: 0x57, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x57, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x57, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x57, flags: 0x0}, + 309: {lang: 0x512, script: 0x3b, flags: 0x2}, + 310: {lang: 0x13e, script: 0x57, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 315: {lang: 0x13e, script: 0x57, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, + 319: {lang: 0x8a, script: 0x57, flags: 0x0}, + 320: {lang: 0x15e, script: 0x57, flags: 0x0}, + 322: {lang: 0x41b, script: 0x57, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x57, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 372 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x57, flags: 0x0}, + 2: {lang: 0x431, script: 0x57, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x57, flags: 0x0}, + 6: {lang: 0xb7, script: 0x57, flags: 0x0}, + 7: {lang: 0x432, script: 0x1f, flags: 0x0}, + 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, + 9: {lang: 0x351, script: 0x21, flags: 0x0}, + 10: {lang: 0x529, script: 0x38, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x57, flags: 0x0}, + 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, + 14: {lang: 0x136, script: 0x31, flags: 0x0}, + 15: {lang: 0x48a, script: 0x57, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x57, flags: 0x0}, + 18: {lang: 0x27, script: 0x29, flags: 0x0}, + 19: {lang: 0x139, script: 0x57, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3b, flags: 0x2}, + 22: {lang: 0x210, script: 0x2b, flags: 0x0}, + 23: {lang: 0x5, script: 0x1f, flags: 0x0}, + 24: {lang: 0x274, script: 0x57, flags: 0x0}, + 25: {lang: 0x136, script: 0x31, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x21, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x72, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x57, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xdf, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x57, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, + 40: {lang: 0x226, script: 0xdf, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x57, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 46: {lang: 0x431, script: 0x57, flags: 0x0}, + 47: {lang: 0x331, script: 0x72, flags: 0x0}, + 48: {lang: 0x213, script: 0x57, flags: 0x0}, + 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x39, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x57, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x21, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x21, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 64: {lang: 0x267, script: 0x57, flags: 0x0}, + 65: {lang: 0x444, script: 0x57, flags: 0x0}, + 66: {lang: 0x512, script: 0x3b, flags: 0x0}, + 67: {lang: 0x412, script: 0x57, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x57, flags: 0x0}, + 71: {lang: 0x15e, script: 0x57, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x72, flags: 0x0}, + 76: {lang: 0x467, script: 0x1f, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 80: {lang: 0x48a, script: 0x57, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x1f, flags: 0x0}, + 83: {lang: 0x81, script: 0x31, flags: 0x0}, + 84: {lang: 0x529, script: 0x39, flags: 0x0}, + 85: {lang: 0x48c, script: 0x57, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 87: {lang: 0x512, script: 0x3b, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 89: {lang: 0x431, script: 0x57, flags: 0x0}, + 90: {lang: 0x432, script: 0x1f, flags: 0x0}, + 91: {lang: 0x15e, script: 0x57, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint8 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x57}, + 2: {lang: 0x139, region: 0x135, script: 0x57}, + 3: {lang: 0x3c0, region: 0x41, script: 0x57}, + 4: {lang: 0x139, region: 0x2f, script: 0x57}, + 5: {lang: 0x139, region: 0xd6, script: 0x57}, + 6: {lang: 0x13e, region: 0xcf, script: 0x57}, + 7: {lang: 0x445, region: 0x12f, script: 0x57}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x57}, + 10: {lang: 0x139, region: 0x161, script: 0x57}, + 11: {lang: 0x139, region: 0x135, script: 0x57}, + 12: {lang: 0x139, region: 0x135, script: 0x57}, + 13: {lang: 0x13e, region: 0x59, script: 0x57}, + 14: {lang: 0x529, region: 0x53, script: 0x38}, + 15: {lang: 0x1be, region: 0x99, script: 0x21}, + 16: {lang: 0x1e1, region: 0x95, script: 0x57}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, + 18: {lang: 0x139, region: 0x2f, script: 0x57}, + 19: {lang: 0x139, region: 0xe6, script: 0x57}, + 20: {lang: 0x139, region: 0x8a, script: 0x57}, + 21: {lang: 0x41b, region: 0x142, script: 0x57}, + 22: {lang: 0x529, region: 0x53, script: 0x38}, + 23: {lang: 0x4bc, region: 0x137, script: 0x57}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 27: {lang: 0x139, region: 0x7b, script: 0x57}, + 28: {lang: 0x10d, region: 0x60, script: 0x57}, + 29: {lang: 0x139, region: 0xd6, script: 0x57}, + 30: {lang: 0x13e, region: 0x1f, script: 0x57}, + 31: {lang: 0x139, region: 0x9a, script: 0x57}, + 32: {lang: 0x139, region: 0x7b, script: 0x57}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 25886 bytes (25KiB); checksum: 50D3D57D diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000000..e7afd3188e --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile deleted file mode 100644 index 79f005784f..0000000000 --- a/vendor/golang.org/x/text/language/Makefile +++ /dev/null @@ -1,16 +0,0 @@ -# Copyright 2013 The Go Authors. All rights reserved. -# Use of this source code is governed by a BSD-style -# license that can be found in the LICENSE file. - -CLEANFILES+=maketables - -maketables: maketables.go - go build $^ - -tables: maketables - ./maketables > tables.go - gofmt -w -s tables.go - -# Build (but do not run) maketables during testing, -# just to make sure it still compiles. -testshort: maketables diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go index 101fd23c1d..a24fd1a4d6 100644 --- a/vendor/golang.org/x/text/language/coverage.go +++ b/vendor/golang.org/x/text/language/coverage.go @@ -7,6 +7,8 @@ package language import ( "fmt" "sort" + + "golang.org/x/text/internal/language" ) // The Coverage interface is used to define the level of coverage of an @@ -44,9 +46,9 @@ type allSubtags struct{} // consecutive range, it simply returns a slice of numbers in increasing order. // The "undefined" region is not returned. func (s allSubtags) Regions() []Region { - reg := make([]Region, numRegions) + reg := make([]Region, language.NumRegions) for i := range reg { - reg[i] = Region{regionID(i + 1)} + reg[i] = Region{language.Region(i + 1)} } return reg } @@ -55,9 +57,9 @@ func (s allSubtags) Regions() []Region { // consecutive range, it simply returns a slice of numbers in increasing order. // The "undefined" script is not returned. func (s allSubtags) Scripts() []Script { - scr := make([]Script, numScripts) + scr := make([]Script, language.NumScripts) for i := range scr { - scr[i] = Script{scriptID(i + 1)} + scr[i] = Script{language.Script(i + 1)} } return scr } @@ -65,22 +67,10 @@ func (s allSubtags) Scripts() []Script { // BaseLanguages returns the list of all supported base languages. It generates // the list by traversing the internal structures. func (s allSubtags) BaseLanguages() []Base { - base := make([]Base, 0, numLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Base{langID(i)}) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Base{langID(i)}) - } - v >>= 1 - i++ - } + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} } return base } @@ -90,7 +80,7 @@ func (s allSubtags) Tags() []Tag { return nil } -// coverage is used used by NewCoverage which is used as a convenient way for +// coverage is used by NewCoverage which is used as a convenient way for // creating Coverage implementations for partially defined data. Very often a // package will only need to define a subset of slices. coverage provides a // convenient way to do this. Moreover, packages using NewCoverage, instead of @@ -134,7 +124,7 @@ func (s *coverage) BaseLanguages() []Base { } a := make([]Base, len(tags)) for i, t := range tags { - a[i] = Base{langID(t.lang)} + a[i] = Base{language.Language(t.lang())} } sort.Sort(bases(a)) k := 0 diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go deleted file mode 100644 index 5311e5cbe4..0000000000 --- a/vendor/golang.org/x/text/language/index.go +++ /dev/null @@ -1,783 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 768 - -var specialTags = []Tag{ // 2 elements - 0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, - 1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, -} // Size: 72 bytes - -var coreTags = map[uint32]uint16{ - 0x0: 0, // und - 0x01600000: 3, // af - 0x016000d2: 4, // af-NA - 0x01600161: 5, // af-ZA - 0x01c00000: 6, // agq - 0x01c00052: 7, // agq-CM - 0x02100000: 8, // ak - 0x02100080: 9, // ak-GH - 0x02700000: 10, // am - 0x0270006f: 11, // am-ET - 0x03a00000: 12, // ar - 0x03a00001: 13, // ar-001 - 0x03a00023: 14, // ar-AE - 0x03a00039: 15, // ar-BH - 0x03a00062: 16, // ar-DJ - 0x03a00067: 17, // ar-DZ - 0x03a0006b: 18, // ar-EG - 0x03a0006c: 19, // ar-EH - 0x03a0006d: 20, // ar-ER - 0x03a00097: 21, // ar-IL - 0x03a0009b: 22, // ar-IQ - 0x03a000a1: 23, // ar-JO - 0x03a000a8: 24, // ar-KM - 0x03a000ac: 25, // ar-KW - 0x03a000b0: 26, // ar-LB - 0x03a000b9: 27, // ar-LY - 0x03a000ba: 28, // ar-MA - 0x03a000c9: 29, // ar-MR - 0x03a000e1: 30, // ar-OM - 0x03a000ed: 31, // ar-PS - 0x03a000f3: 32, // ar-QA - 0x03a00108: 33, // ar-SA - 0x03a0010b: 34, // ar-SD - 0x03a00115: 35, // ar-SO - 0x03a00117: 36, // ar-SS - 0x03a0011c: 37, // ar-SY - 0x03a00120: 38, // ar-TD - 0x03a00128: 39, // ar-TN - 0x03a0015e: 40, // ar-YE - 0x04000000: 41, // ars - 0x04300000: 42, // as - 0x04300099: 43, // as-IN - 0x04400000: 44, // asa - 0x0440012f: 45, // asa-TZ - 0x04800000: 46, // ast - 0x0480006e: 47, // ast-ES - 0x05800000: 48, // az - 0x0581f000: 49, // az-Cyrl - 0x0581f032: 50, // az-Cyrl-AZ - 0x05857000: 51, // az-Latn - 0x05857032: 52, // az-Latn-AZ - 0x05e00000: 53, // bas - 0x05e00052: 54, // bas-CM - 0x07100000: 55, // be - 0x07100047: 56, // be-BY - 0x07500000: 57, // bem - 0x07500162: 58, // bem-ZM - 0x07900000: 59, // bez - 0x0790012f: 60, // bez-TZ - 0x07e00000: 61, // bg - 0x07e00038: 62, // bg-BG - 0x08200000: 63, // bh - 0x0a000000: 64, // bm - 0x0a0000c3: 65, // bm-ML - 0x0a500000: 66, // bn - 0x0a500035: 67, // bn-BD - 0x0a500099: 68, // bn-IN - 0x0a900000: 69, // bo - 0x0a900053: 70, // bo-CN - 0x0a900099: 71, // bo-IN - 0x0b200000: 72, // br - 0x0b200078: 73, // br-FR - 0x0b500000: 74, // brx - 0x0b500099: 75, // brx-IN - 0x0b700000: 76, // bs - 0x0b71f000: 77, // bs-Cyrl - 0x0b71f033: 78, // bs-Cyrl-BA - 0x0b757000: 79, // bs-Latn - 0x0b757033: 80, // bs-Latn-BA - 0x0d700000: 81, // ca - 0x0d700022: 82, // ca-AD - 0x0d70006e: 83, // ca-ES - 0x0d700078: 84, // ca-FR - 0x0d70009e: 85, // ca-IT - 0x0db00000: 86, // ccp - 0x0db00035: 87, // ccp-BD - 0x0db00099: 88, // ccp-IN - 0x0dc00000: 89, // ce - 0x0dc00106: 90, // ce-RU - 0x0df00000: 91, // cgg - 0x0df00131: 92, // cgg-UG - 0x0e500000: 93, // chr - 0x0e500135: 94, // chr-US - 0x0e900000: 95, // ckb - 0x0e90009b: 96, // ckb-IQ - 0x0e90009c: 97, // ckb-IR - 0x0fa00000: 98, // cs - 0x0fa0005e: 99, // cs-CZ - 0x0fe00000: 100, // cu - 0x0fe00106: 101, // cu-RU - 0x10000000: 102, // cy - 0x1000007b: 103, // cy-GB - 0x10100000: 104, // da - 0x10100063: 105, // da-DK - 0x10100082: 106, // da-GL - 0x10800000: 107, // dav - 0x108000a4: 108, // dav-KE - 0x10d00000: 109, // de - 0x10d0002e: 110, // de-AT - 0x10d00036: 111, // de-BE - 0x10d0004e: 112, // de-CH - 0x10d00060: 113, // de-DE - 0x10d0009e: 114, // de-IT - 0x10d000b2: 115, // de-LI - 0x10d000b7: 116, // de-LU - 0x11700000: 117, // dje - 0x117000d4: 118, // dje-NE - 0x11f00000: 119, // dsb - 0x11f00060: 120, // dsb-DE - 0x12400000: 121, // dua - 0x12400052: 122, // dua-CM - 0x12800000: 123, // dv - 0x12b00000: 124, // dyo - 0x12b00114: 125, // dyo-SN - 0x12d00000: 126, // dz - 0x12d00043: 127, // dz-BT - 0x12f00000: 128, // ebu - 0x12f000a4: 129, // ebu-KE - 0x13000000: 130, // ee - 0x13000080: 131, // ee-GH - 0x13000122: 132, // ee-TG - 0x13600000: 133, // el - 0x1360005d: 134, // el-CY - 0x13600087: 135, // el-GR - 0x13900000: 136, // en - 0x13900001: 137, // en-001 - 0x1390001a: 138, // en-150 - 0x13900025: 139, // en-AG - 0x13900026: 140, // en-AI - 0x1390002d: 141, // en-AS - 0x1390002e: 142, // en-AT - 0x1390002f: 143, // en-AU - 0x13900034: 144, // en-BB - 0x13900036: 145, // en-BE - 0x1390003a: 146, // en-BI - 0x1390003d: 147, // en-BM - 0x13900042: 148, // en-BS - 0x13900046: 149, // en-BW - 0x13900048: 150, // en-BZ - 0x13900049: 151, // en-CA - 0x1390004a: 152, // en-CC - 0x1390004e: 153, // en-CH - 0x13900050: 154, // en-CK - 0x13900052: 155, // en-CM - 0x1390005c: 156, // en-CX - 0x1390005d: 157, // en-CY - 0x13900060: 158, // en-DE - 0x13900061: 159, // en-DG - 0x13900063: 160, // en-DK - 0x13900064: 161, // en-DM - 0x1390006d: 162, // en-ER - 0x13900072: 163, // en-FI - 0x13900073: 164, // en-FJ - 0x13900074: 165, // en-FK - 0x13900075: 166, // en-FM - 0x1390007b: 167, // en-GB - 0x1390007c: 168, // en-GD - 0x1390007f: 169, // en-GG - 0x13900080: 170, // en-GH - 0x13900081: 171, // en-GI - 0x13900083: 172, // en-GM - 0x1390008a: 173, // en-GU - 0x1390008c: 174, // en-GY - 0x1390008d: 175, // en-HK - 0x13900096: 176, // en-IE - 0x13900097: 177, // en-IL - 0x13900098: 178, // en-IM - 0x13900099: 179, // en-IN - 0x1390009a: 180, // en-IO - 0x1390009f: 181, // en-JE - 0x139000a0: 182, // en-JM - 0x139000a4: 183, // en-KE - 0x139000a7: 184, // en-KI - 0x139000a9: 185, // en-KN - 0x139000ad: 186, // en-KY - 0x139000b1: 187, // en-LC - 0x139000b4: 188, // en-LR - 0x139000b5: 189, // en-LS - 0x139000bf: 190, // en-MG - 0x139000c0: 191, // en-MH - 0x139000c6: 192, // en-MO - 0x139000c7: 193, // en-MP - 0x139000ca: 194, // en-MS - 0x139000cb: 195, // en-MT - 0x139000cc: 196, // en-MU - 0x139000ce: 197, // en-MW - 0x139000d0: 198, // en-MY - 0x139000d2: 199, // en-NA - 0x139000d5: 200, // en-NF - 0x139000d6: 201, // en-NG - 0x139000d9: 202, // en-NL - 0x139000dd: 203, // en-NR - 0x139000df: 204, // en-NU - 0x139000e0: 205, // en-NZ - 0x139000e6: 206, // en-PG - 0x139000e7: 207, // en-PH - 0x139000e8: 208, // en-PK - 0x139000eb: 209, // en-PN - 0x139000ec: 210, // en-PR - 0x139000f0: 211, // en-PW - 0x13900107: 212, // en-RW - 0x13900109: 213, // en-SB - 0x1390010a: 214, // en-SC - 0x1390010b: 215, // en-SD - 0x1390010c: 216, // en-SE - 0x1390010d: 217, // en-SG - 0x1390010e: 218, // en-SH - 0x1390010f: 219, // en-SI - 0x13900112: 220, // en-SL - 0x13900117: 221, // en-SS - 0x1390011b: 222, // en-SX - 0x1390011d: 223, // en-SZ - 0x1390011f: 224, // en-TC - 0x13900125: 225, // en-TK - 0x13900129: 226, // en-TO - 0x1390012c: 227, // en-TT - 0x1390012d: 228, // en-TV - 0x1390012f: 229, // en-TZ - 0x13900131: 230, // en-UG - 0x13900133: 231, // en-UM - 0x13900135: 232, // en-US - 0x13900139: 233, // en-VC - 0x1390013c: 234, // en-VG - 0x1390013d: 235, // en-VI - 0x1390013f: 236, // en-VU - 0x13900142: 237, // en-WS - 0x13900161: 238, // en-ZA - 0x13900162: 239, // en-ZM - 0x13900164: 240, // en-ZW - 0x13c00000: 241, // eo - 0x13c00001: 242, // eo-001 - 0x13e00000: 243, // es - 0x13e0001f: 244, // es-419 - 0x13e0002c: 245, // es-AR - 0x13e0003f: 246, // es-BO - 0x13e00041: 247, // es-BR - 0x13e00048: 248, // es-BZ - 0x13e00051: 249, // es-CL - 0x13e00054: 250, // es-CO - 0x13e00056: 251, // es-CR - 0x13e00059: 252, // es-CU - 0x13e00065: 253, // es-DO - 0x13e00068: 254, // es-EA - 0x13e00069: 255, // es-EC - 0x13e0006e: 256, // es-ES - 0x13e00086: 257, // es-GQ - 0x13e00089: 258, // es-GT - 0x13e0008f: 259, // es-HN - 0x13e00094: 260, // es-IC - 0x13e000cf: 261, // es-MX - 0x13e000d8: 262, // es-NI - 0x13e000e2: 263, // es-PA - 0x13e000e4: 264, // es-PE - 0x13e000e7: 265, // es-PH - 0x13e000ec: 266, // es-PR - 0x13e000f1: 267, // es-PY - 0x13e0011a: 268, // es-SV - 0x13e00135: 269, // es-US - 0x13e00136: 270, // es-UY - 0x13e0013b: 271, // es-VE - 0x14000000: 272, // et - 0x1400006a: 273, // et-EE - 0x14500000: 274, // eu - 0x1450006e: 275, // eu-ES - 0x14600000: 276, // ewo - 0x14600052: 277, // ewo-CM - 0x14800000: 278, // fa - 0x14800024: 279, // fa-AF - 0x1480009c: 280, // fa-IR - 0x14e00000: 281, // ff - 0x14e00052: 282, // ff-CM - 0x14e00084: 283, // ff-GN - 0x14e000c9: 284, // ff-MR - 0x14e00114: 285, // ff-SN - 0x15100000: 286, // fi - 0x15100072: 287, // fi-FI - 0x15300000: 288, // fil - 0x153000e7: 289, // fil-PH - 0x15800000: 290, // fo - 0x15800063: 291, // fo-DK - 0x15800076: 292, // fo-FO - 0x15e00000: 293, // fr - 0x15e00036: 294, // fr-BE - 0x15e00037: 295, // fr-BF - 0x15e0003a: 296, // fr-BI - 0x15e0003b: 297, // fr-BJ - 0x15e0003c: 298, // fr-BL - 0x15e00049: 299, // fr-CA - 0x15e0004b: 300, // fr-CD - 0x15e0004c: 301, // fr-CF - 0x15e0004d: 302, // fr-CG - 0x15e0004e: 303, // fr-CH - 0x15e0004f: 304, // fr-CI - 0x15e00052: 305, // fr-CM - 0x15e00062: 306, // fr-DJ - 0x15e00067: 307, // fr-DZ - 0x15e00078: 308, // fr-FR - 0x15e0007a: 309, // fr-GA - 0x15e0007e: 310, // fr-GF - 0x15e00084: 311, // fr-GN - 0x15e00085: 312, // fr-GP - 0x15e00086: 313, // fr-GQ - 0x15e00091: 314, // fr-HT - 0x15e000a8: 315, // fr-KM - 0x15e000b7: 316, // fr-LU - 0x15e000ba: 317, // fr-MA - 0x15e000bb: 318, // fr-MC - 0x15e000be: 319, // fr-MF - 0x15e000bf: 320, // fr-MG - 0x15e000c3: 321, // fr-ML - 0x15e000c8: 322, // fr-MQ - 0x15e000c9: 323, // fr-MR - 0x15e000cc: 324, // fr-MU - 0x15e000d3: 325, // fr-NC - 0x15e000d4: 326, // fr-NE - 0x15e000e5: 327, // fr-PF - 0x15e000ea: 328, // fr-PM - 0x15e00102: 329, // fr-RE - 0x15e00107: 330, // fr-RW - 0x15e0010a: 331, // fr-SC - 0x15e00114: 332, // fr-SN - 0x15e0011c: 333, // fr-SY - 0x15e00120: 334, // fr-TD - 0x15e00122: 335, // fr-TG - 0x15e00128: 336, // fr-TN - 0x15e0013f: 337, // fr-VU - 0x15e00140: 338, // fr-WF - 0x15e0015f: 339, // fr-YT - 0x16900000: 340, // fur - 0x1690009e: 341, // fur-IT - 0x16d00000: 342, // fy - 0x16d000d9: 343, // fy-NL - 0x16e00000: 344, // ga - 0x16e00096: 345, // ga-IE - 0x17e00000: 346, // gd - 0x17e0007b: 347, // gd-GB - 0x19000000: 348, // gl - 0x1900006e: 349, // gl-ES - 0x1a300000: 350, // gsw - 0x1a30004e: 351, // gsw-CH - 0x1a300078: 352, // gsw-FR - 0x1a3000b2: 353, // gsw-LI - 0x1a400000: 354, // gu - 0x1a400099: 355, // gu-IN - 0x1a900000: 356, // guw - 0x1ab00000: 357, // guz - 0x1ab000a4: 358, // guz-KE - 0x1ac00000: 359, // gv - 0x1ac00098: 360, // gv-IM - 0x1b400000: 361, // ha - 0x1b400080: 362, // ha-GH - 0x1b4000d4: 363, // ha-NE - 0x1b4000d6: 364, // ha-NG - 0x1b800000: 365, // haw - 0x1b800135: 366, // haw-US - 0x1bc00000: 367, // he - 0x1bc00097: 368, // he-IL - 0x1be00000: 369, // hi - 0x1be00099: 370, // hi-IN - 0x1d100000: 371, // hr - 0x1d100033: 372, // hr-BA - 0x1d100090: 373, // hr-HR - 0x1d200000: 374, // hsb - 0x1d200060: 375, // hsb-DE - 0x1d500000: 376, // hu - 0x1d500092: 377, // hu-HU - 0x1d700000: 378, // hy - 0x1d700028: 379, // hy-AM - 0x1e100000: 380, // id - 0x1e100095: 381, // id-ID - 0x1e700000: 382, // ig - 0x1e7000d6: 383, // ig-NG - 0x1ea00000: 384, // ii - 0x1ea00053: 385, // ii-CN - 0x1f500000: 386, // io - 0x1f800000: 387, // is - 0x1f80009d: 388, // is-IS - 0x1f900000: 389, // it - 0x1f90004e: 390, // it-CH - 0x1f90009e: 391, // it-IT - 0x1f900113: 392, // it-SM - 0x1f900138: 393, // it-VA - 0x1fa00000: 394, // iu - 0x20000000: 395, // ja - 0x200000a2: 396, // ja-JP - 0x20300000: 397, // jbo - 0x20700000: 398, // jgo - 0x20700052: 399, // jgo-CM - 0x20a00000: 400, // jmc - 0x20a0012f: 401, // jmc-TZ - 0x20e00000: 402, // jv - 0x21000000: 403, // ka - 0x2100007d: 404, // ka-GE - 0x21200000: 405, // kab - 0x21200067: 406, // kab-DZ - 0x21600000: 407, // kaj - 0x21700000: 408, // kam - 0x217000a4: 409, // kam-KE - 0x21f00000: 410, // kcg - 0x22300000: 411, // kde - 0x2230012f: 412, // kde-TZ - 0x22700000: 413, // kea - 0x2270005a: 414, // kea-CV - 0x23400000: 415, // khq - 0x234000c3: 416, // khq-ML - 0x23900000: 417, // ki - 0x239000a4: 418, // ki-KE - 0x24200000: 419, // kk - 0x242000ae: 420, // kk-KZ - 0x24400000: 421, // kkj - 0x24400052: 422, // kkj-CM - 0x24500000: 423, // kl - 0x24500082: 424, // kl-GL - 0x24600000: 425, // kln - 0x246000a4: 426, // kln-KE - 0x24a00000: 427, // km - 0x24a000a6: 428, // km-KH - 0x25100000: 429, // kn - 0x25100099: 430, // kn-IN - 0x25400000: 431, // ko - 0x254000aa: 432, // ko-KP - 0x254000ab: 433, // ko-KR - 0x25600000: 434, // kok - 0x25600099: 435, // kok-IN - 0x26a00000: 436, // ks - 0x26a00099: 437, // ks-IN - 0x26b00000: 438, // ksb - 0x26b0012f: 439, // ksb-TZ - 0x26d00000: 440, // ksf - 0x26d00052: 441, // ksf-CM - 0x26e00000: 442, // ksh - 0x26e00060: 443, // ksh-DE - 0x27400000: 444, // ku - 0x28100000: 445, // kw - 0x2810007b: 446, // kw-GB - 0x28a00000: 447, // ky - 0x28a000a5: 448, // ky-KG - 0x29100000: 449, // lag - 0x2910012f: 450, // lag-TZ - 0x29500000: 451, // lb - 0x295000b7: 452, // lb-LU - 0x2a300000: 453, // lg - 0x2a300131: 454, // lg-UG - 0x2af00000: 455, // lkt - 0x2af00135: 456, // lkt-US - 0x2b500000: 457, // ln - 0x2b50002a: 458, // ln-AO - 0x2b50004b: 459, // ln-CD - 0x2b50004c: 460, // ln-CF - 0x2b50004d: 461, // ln-CG - 0x2b800000: 462, // lo - 0x2b8000af: 463, // lo-LA - 0x2bf00000: 464, // lrc - 0x2bf0009b: 465, // lrc-IQ - 0x2bf0009c: 466, // lrc-IR - 0x2c000000: 467, // lt - 0x2c0000b6: 468, // lt-LT - 0x2c200000: 469, // lu - 0x2c20004b: 470, // lu-CD - 0x2c400000: 471, // luo - 0x2c4000a4: 472, // luo-KE - 0x2c500000: 473, // luy - 0x2c5000a4: 474, // luy-KE - 0x2c700000: 475, // lv - 0x2c7000b8: 476, // lv-LV - 0x2d100000: 477, // mas - 0x2d1000a4: 478, // mas-KE - 0x2d10012f: 479, // mas-TZ - 0x2e900000: 480, // mer - 0x2e9000a4: 481, // mer-KE - 0x2ed00000: 482, // mfe - 0x2ed000cc: 483, // mfe-MU - 0x2f100000: 484, // mg - 0x2f1000bf: 485, // mg-MG - 0x2f200000: 486, // mgh - 0x2f2000d1: 487, // mgh-MZ - 0x2f400000: 488, // mgo - 0x2f400052: 489, // mgo-CM - 0x2ff00000: 490, // mk - 0x2ff000c2: 491, // mk-MK - 0x30400000: 492, // ml - 0x30400099: 493, // ml-IN - 0x30b00000: 494, // mn - 0x30b000c5: 495, // mn-MN - 0x31b00000: 496, // mr - 0x31b00099: 497, // mr-IN - 0x31f00000: 498, // ms - 0x31f0003e: 499, // ms-BN - 0x31f000d0: 500, // ms-MY - 0x31f0010d: 501, // ms-SG - 0x32000000: 502, // mt - 0x320000cb: 503, // mt-MT - 0x32500000: 504, // mua - 0x32500052: 505, // mua-CM - 0x33100000: 506, // my - 0x331000c4: 507, // my-MM - 0x33a00000: 508, // mzn - 0x33a0009c: 509, // mzn-IR - 0x34100000: 510, // nah - 0x34500000: 511, // naq - 0x345000d2: 512, // naq-NA - 0x34700000: 513, // nb - 0x347000da: 514, // nb-NO - 0x34700110: 515, // nb-SJ - 0x34e00000: 516, // nd - 0x34e00164: 517, // nd-ZW - 0x35000000: 518, // nds - 0x35000060: 519, // nds-DE - 0x350000d9: 520, // nds-NL - 0x35100000: 521, // ne - 0x35100099: 522, // ne-IN - 0x351000db: 523, // ne-NP - 0x36700000: 524, // nl - 0x36700030: 525, // nl-AW - 0x36700036: 526, // nl-BE - 0x36700040: 527, // nl-BQ - 0x3670005b: 528, // nl-CW - 0x367000d9: 529, // nl-NL - 0x36700116: 530, // nl-SR - 0x3670011b: 531, // nl-SX - 0x36800000: 532, // nmg - 0x36800052: 533, // nmg-CM - 0x36a00000: 534, // nn - 0x36a000da: 535, // nn-NO - 0x36c00000: 536, // nnh - 0x36c00052: 537, // nnh-CM - 0x36f00000: 538, // no - 0x37500000: 539, // nqo - 0x37600000: 540, // nr - 0x37a00000: 541, // nso - 0x38000000: 542, // nus - 0x38000117: 543, // nus-SS - 0x38700000: 544, // ny - 0x38900000: 545, // nyn - 0x38900131: 546, // nyn-UG - 0x39000000: 547, // om - 0x3900006f: 548, // om-ET - 0x390000a4: 549, // om-KE - 0x39500000: 550, // or - 0x39500099: 551, // or-IN - 0x39800000: 552, // os - 0x3980007d: 553, // os-GE - 0x39800106: 554, // os-RU - 0x39d00000: 555, // pa - 0x39d05000: 556, // pa-Arab - 0x39d050e8: 557, // pa-Arab-PK - 0x39d33000: 558, // pa-Guru - 0x39d33099: 559, // pa-Guru-IN - 0x3a100000: 560, // pap - 0x3b300000: 561, // pl - 0x3b3000e9: 562, // pl-PL - 0x3bd00000: 563, // prg - 0x3bd00001: 564, // prg-001 - 0x3be00000: 565, // ps - 0x3be00024: 566, // ps-AF - 0x3c000000: 567, // pt - 0x3c00002a: 568, // pt-AO - 0x3c000041: 569, // pt-BR - 0x3c00004e: 570, // pt-CH - 0x3c00005a: 571, // pt-CV - 0x3c000086: 572, // pt-GQ - 0x3c00008b: 573, // pt-GW - 0x3c0000b7: 574, // pt-LU - 0x3c0000c6: 575, // pt-MO - 0x3c0000d1: 576, // pt-MZ - 0x3c0000ee: 577, // pt-PT - 0x3c000118: 578, // pt-ST - 0x3c000126: 579, // pt-TL - 0x3c400000: 580, // qu - 0x3c40003f: 581, // qu-BO - 0x3c400069: 582, // qu-EC - 0x3c4000e4: 583, // qu-PE - 0x3d400000: 584, // rm - 0x3d40004e: 585, // rm-CH - 0x3d900000: 586, // rn - 0x3d90003a: 587, // rn-BI - 0x3dc00000: 588, // ro - 0x3dc000bc: 589, // ro-MD - 0x3dc00104: 590, // ro-RO - 0x3de00000: 591, // rof - 0x3de0012f: 592, // rof-TZ - 0x3e200000: 593, // ru - 0x3e200047: 594, // ru-BY - 0x3e2000a5: 595, // ru-KG - 0x3e2000ae: 596, // ru-KZ - 0x3e2000bc: 597, // ru-MD - 0x3e200106: 598, // ru-RU - 0x3e200130: 599, // ru-UA - 0x3e500000: 600, // rw - 0x3e500107: 601, // rw-RW - 0x3e600000: 602, // rwk - 0x3e60012f: 603, // rwk-TZ - 0x3eb00000: 604, // sah - 0x3eb00106: 605, // sah-RU - 0x3ec00000: 606, // saq - 0x3ec000a4: 607, // saq-KE - 0x3f300000: 608, // sbp - 0x3f30012f: 609, // sbp-TZ - 0x3fa00000: 610, // sd - 0x3fa000e8: 611, // sd-PK - 0x3fc00000: 612, // sdh - 0x3fd00000: 613, // se - 0x3fd00072: 614, // se-FI - 0x3fd000da: 615, // se-NO - 0x3fd0010c: 616, // se-SE - 0x3ff00000: 617, // seh - 0x3ff000d1: 618, // seh-MZ - 0x40100000: 619, // ses - 0x401000c3: 620, // ses-ML - 0x40200000: 621, // sg - 0x4020004c: 622, // sg-CF - 0x40800000: 623, // shi - 0x40857000: 624, // shi-Latn - 0x408570ba: 625, // shi-Latn-MA - 0x408dc000: 626, // shi-Tfng - 0x408dc0ba: 627, // shi-Tfng-MA - 0x40c00000: 628, // si - 0x40c000b3: 629, // si-LK - 0x41200000: 630, // sk - 0x41200111: 631, // sk-SK - 0x41600000: 632, // sl - 0x4160010f: 633, // sl-SI - 0x41c00000: 634, // sma - 0x41d00000: 635, // smi - 0x41e00000: 636, // smj - 0x41f00000: 637, // smn - 0x41f00072: 638, // smn-FI - 0x42200000: 639, // sms - 0x42300000: 640, // sn - 0x42300164: 641, // sn-ZW - 0x42900000: 642, // so - 0x42900062: 643, // so-DJ - 0x4290006f: 644, // so-ET - 0x429000a4: 645, // so-KE - 0x42900115: 646, // so-SO - 0x43100000: 647, // sq - 0x43100027: 648, // sq-AL - 0x431000c2: 649, // sq-MK - 0x4310014d: 650, // sq-XK - 0x43200000: 651, // sr - 0x4321f000: 652, // sr-Cyrl - 0x4321f033: 653, // sr-Cyrl-BA - 0x4321f0bd: 654, // sr-Cyrl-ME - 0x4321f105: 655, // sr-Cyrl-RS - 0x4321f14d: 656, // sr-Cyrl-XK - 0x43257000: 657, // sr-Latn - 0x43257033: 658, // sr-Latn-BA - 0x432570bd: 659, // sr-Latn-ME - 0x43257105: 660, // sr-Latn-RS - 0x4325714d: 661, // sr-Latn-XK - 0x43700000: 662, // ss - 0x43a00000: 663, // ssy - 0x43b00000: 664, // st - 0x44400000: 665, // sv - 0x44400031: 666, // sv-AX - 0x44400072: 667, // sv-FI - 0x4440010c: 668, // sv-SE - 0x44500000: 669, // sw - 0x4450004b: 670, // sw-CD - 0x445000a4: 671, // sw-KE - 0x4450012f: 672, // sw-TZ - 0x44500131: 673, // sw-UG - 0x44e00000: 674, // syr - 0x45000000: 675, // ta - 0x45000099: 676, // ta-IN - 0x450000b3: 677, // ta-LK - 0x450000d0: 678, // ta-MY - 0x4500010d: 679, // ta-SG - 0x46100000: 680, // te - 0x46100099: 681, // te-IN - 0x46400000: 682, // teo - 0x464000a4: 683, // teo-KE - 0x46400131: 684, // teo-UG - 0x46700000: 685, // tg - 0x46700124: 686, // tg-TJ - 0x46b00000: 687, // th - 0x46b00123: 688, // th-TH - 0x46f00000: 689, // ti - 0x46f0006d: 690, // ti-ER - 0x46f0006f: 691, // ti-ET - 0x47100000: 692, // tig - 0x47600000: 693, // tk - 0x47600127: 694, // tk-TM - 0x48000000: 695, // tn - 0x48200000: 696, // to - 0x48200129: 697, // to-TO - 0x48a00000: 698, // tr - 0x48a0005d: 699, // tr-CY - 0x48a0012b: 700, // tr-TR - 0x48e00000: 701, // ts - 0x49400000: 702, // tt - 0x49400106: 703, // tt-RU - 0x4a400000: 704, // twq - 0x4a4000d4: 705, // twq-NE - 0x4a900000: 706, // tzm - 0x4a9000ba: 707, // tzm-MA - 0x4ac00000: 708, // ug - 0x4ac00053: 709, // ug-CN - 0x4ae00000: 710, // uk - 0x4ae00130: 711, // uk-UA - 0x4b400000: 712, // ur - 0x4b400099: 713, // ur-IN - 0x4b4000e8: 714, // ur-PK - 0x4bc00000: 715, // uz - 0x4bc05000: 716, // uz-Arab - 0x4bc05024: 717, // uz-Arab-AF - 0x4bc1f000: 718, // uz-Cyrl - 0x4bc1f137: 719, // uz-Cyrl-UZ - 0x4bc57000: 720, // uz-Latn - 0x4bc57137: 721, // uz-Latn-UZ - 0x4be00000: 722, // vai - 0x4be57000: 723, // vai-Latn - 0x4be570b4: 724, // vai-Latn-LR - 0x4bee3000: 725, // vai-Vaii - 0x4bee30b4: 726, // vai-Vaii-LR - 0x4c000000: 727, // ve - 0x4c300000: 728, // vi - 0x4c30013e: 729, // vi-VN - 0x4c900000: 730, // vo - 0x4c900001: 731, // vo-001 - 0x4cc00000: 732, // vun - 0x4cc0012f: 733, // vun-TZ - 0x4ce00000: 734, // wa - 0x4cf00000: 735, // wae - 0x4cf0004e: 736, // wae-CH - 0x4e500000: 737, // wo - 0x4e500114: 738, // wo-SN - 0x4f200000: 739, // xh - 0x4fb00000: 740, // xog - 0x4fb00131: 741, // xog-UG - 0x50900000: 742, // yav - 0x50900052: 743, // yav-CM - 0x51200000: 744, // yi - 0x51200001: 745, // yi-001 - 0x51800000: 746, // yo - 0x5180003b: 747, // yo-BJ - 0x518000d6: 748, // yo-NG - 0x51f00000: 749, // yue - 0x51f38000: 750, // yue-Hans - 0x51f38053: 751, // yue-Hans-CN - 0x51f39000: 752, // yue-Hant - 0x51f3908d: 753, // yue-Hant-HK - 0x52800000: 754, // zgh - 0x528000ba: 755, // zgh-MA - 0x52900000: 756, // zh - 0x52938000: 757, // zh-Hans - 0x52938053: 758, // zh-Hans-CN - 0x5293808d: 759, // zh-Hans-HK - 0x529380c6: 760, // zh-Hans-MO - 0x5293810d: 761, // zh-Hans-SG - 0x52939000: 762, // zh-Hant - 0x5293908d: 763, // zh-Hant-HK - 0x529390c6: 764, // zh-Hant-MO - 0x5293912e: 765, // zh-Hant-TW - 0x52f00000: 766, // zu - 0x52f00161: 767, // zu-ZA -} - -// Total table size 4676 bytes (4KiB); checksum: 17BE3673 diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index b65e213ff8..b939c89f14 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:generate go run gen.go gen_common.go -output tables.go -//go:generate go run gen_index.go +//go:generate go run gen.go -output tables.go package language @@ -11,47 +10,34 @@ package language // - verifying that tables are dropped correctly (most notably matcher tables). import ( - "errors" - "fmt" "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" ) // Tag represents a BCP 47 language tag. It is used to specify an instance of a // specific language or locale. All language tag values are guaranteed to be // well-formed. -type Tag struct { - lang langID - region regionID - // TODO: we will soon run out of positions for script. Idea: instead of - // storing lang, region, and script codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - script scriptID - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() } +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + // Make is a convenience wrapper for Parse that omits the error. // In case of an error, a sensible default is returned. func Make(s string) Tag { @@ -68,25 +54,13 @@ func (c CanonType) Make(s string) Tag { // Raw returns the raw base language, script and region, without making an // attempt to infer their values. func (t Tag) Raw() (b Base, s Script, r Region) { - return Base{t.lang}, Script{t.script}, Region{t.region} -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.lang == a.lang && t.script == a.script && t.region == a.region + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} } // IsRoot returns true if t is equal to language "und". func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(und) -} - -// private reports whether the Tag consists solely of a private use tag. -func (t Tag) private() bool { - return t.str != "" && t.pVariant == 0 + return compact.Tag(t).IsRoot() } // CanonType can be used to enable or disable various types of canonicalization. @@ -138,73 +112,73 @@ const ( // canonicalize returns the canonicalized equivalent of the tag and // whether there was any change. -func (t Tag) canonicalize(c CanonType) (Tag, bool) { +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { if c == Raw { return t, false } changed := false if c&SuppressScript != 0 { - if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] { - t.script = 0 + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 changed = true } } if c&canonLang != 0 { for { - if l, aliasType := normLang(t.lang); l != t.lang { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { switch aliasType { - case langLegacy: + case language.Legacy: if c&Legacy != 0 { - if t.lang == _sh && t.script == 0 { - t.script = _Latn + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn } - t.lang = l + t.LangID = l changed = true } - case langMacro: + case language.Macro: if c&Macro != 0 { // We deviate here from CLDR. The mapping "nb" -> "no" // qualifies as a typical Macro language mapping. However, // for legacy reasons, CLDR maps "no", the macro language // code for Norwegian, to the dominant variant "nb". This // change is currently under consideration for CLDR as well. - // See http://unicode.org/cldr/trac/ticket/2698 and also - // http://unicode.org/cldr/trac/ticket/1790 for some of the + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the // practical implications. TODO: this check could be removed // if CLDR adopts this change. - if c&CLDR == 0 || t.lang != _nb { + if c&CLDR == 0 || t.LangID != _nb { changed = true - t.lang = l + t.LangID = l } } - case langDeprecated: + case language.Deprecated: if c&DeprecatedBase != 0 { - if t.lang == _mo && t.region == 0 { - t.region = _MD + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD } - t.lang = l + t.LangID = l changed = true // Other canonicalization types may still apply. continue } } - } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 { - t.lang = _nb + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb changed = true } break } } if c&DeprecatedScript != 0 { - if t.script == _Qaai { + if t.ScriptID == _Qaai { changed = true - t.script = _Zinh + t.ScriptID = _Zinh } } if c&DeprecatedRegion != 0 { - if r := normRegion(t.region); r != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { changed = true - t.region = r + t.RegionID = r } } return t, changed @@ -212,11 +186,20 @@ func (t Tag) canonicalize(c CanonType) (Tag, bool) { // Canonicalize returns the canonicalized equivalent of the tag. func (c CanonType) Canonicalize(t Tag) (Tag, error) { - t, changed := t.canonicalize(c) - if changed { - t.remakeString() + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil } return t, nil + } // Confidence indicates the level of certainty for a given return value. @@ -239,83 +222,21 @@ func (c Confidence) String() string { return confName[c] } -// remakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) remakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.lang.stringToBuf(buf[:]) - if t.script != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.script.String()) - } - if t.region != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.region.String()) - } - return n -} - // String returns the canonical string representation of the language tag. func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.script == 0 && t.region == 0 { - return t.lang.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) + return t.tag().String() } // MarshalText implements encoding.TextMarshaler. func (t Tag) MarshalText() (text []byte, err error) { - if t.str != "" { - text = append(text, t.str...) - } else if t.script == 0 && t.region == 0 { - text = append(text, t.lang.String()...) - } else { - buf := [maxCoreSize]byte{} - text = buf[:t.genCoreBytes(buf[:])] - } - return text, nil + return t.tag().MarshalText() } // UnmarshalText implements encoding.TextUnmarshaler. func (t *Tag) UnmarshalText(text []byte) error { - tag, err := Raw.Parse(string(text)) - *t = tag + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) return err } @@ -323,15 +244,16 @@ func (t *Tag) UnmarshalText(text []byte) error { // unspecified, an attempt will be made to infer it from the context. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Base() (Base, Confidence) { - if t.lang != 0 { - return Base{t.lang}, Exact + if b := t.lang(); b != 0 { + return Base{b}, Exact } + tt := t.tag() c := High - if t.script == 0 && !(Region{t.region}).IsCountry() { + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { c = Low } - if tag, err := addTags(t); err == nil && tag.lang != 0 { - return Base{tag.lang}, c + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c } return Base{0}, No } @@ -344,35 +266,34 @@ func (t Tag) Base() (Base, Confidence) { // If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) // as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks // common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. -// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for // unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. // Note that an inferred script is never guaranteed to be the correct one. Latin is // almost exclusively used for Afrikaans, but Arabic has been used for some texts // in the past. Also, the script that is commonly used may change over time. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Script() (Script, Confidence) { - if t.script != 0 { - return Script{t.script}, Exact - } - sc, c := scriptID(_Zzzz), No - if t.lang < langNoIndexOffset { - if scr := scriptID(suppressScript[t.lang]); scr != 0 { - // Note: it is not always the case that a language with a suppress - // script value is only written in one script (e.g. kk, ms, pa). - if t.region == 0 { - return Script{scriptID(scr)}, High - } - sc, c = scr, High + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High } + sc, c = scr, High } - if tag, err := addTags(t); err == nil { - if tag.script != sc { - sc, c = tag.script, Low + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low } } else { - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil && tag.script != sc { - sc, c = tag.script, Low + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low } } return Script{sc}, c @@ -382,28 +303,31 @@ func (t Tag) Script() (Script, Confidence) { // infer a most likely candidate from the context. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Region() (Region, Confidence) { - if t.region != 0 { - return Region{t.region}, Exact + if r := t.region(); r != 0 { + return Region{r}, Exact } - if t, err := addTags(t); err == nil { - return Region{t.region}, Low // TODO: differentiate between high and low. + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. } - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil { - return Region{tag.region}, Low + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low } return Region{_ZZ}, No // TODO: return world instead of undetermined? } -// Variant returns the variants specified explicitly for this language tag. +// Variants returns the variants specified explicitly for this language tag. // or nil if no variant was specified. func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } v := []Variant{} - if int(t.pVariant) < int(t.pExt) { - for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; { - x, str = nextToken(str) - v = append(v, Variant{x}) - } + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) } return v } @@ -411,57 +335,13 @@ func (t Tag) Variants() []Variant { // Parent returns the CLDR parent of t. In CLDR, missing fields in data for a // specific language are substituted with fields from the parent language. // The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - t, _ = Raw.Compose(t.Raw()) - if t.region == 0 && t.script != 0 && t.lang != 0 { - base, _ := addTags(Tag{lang: t.lang}) - if base.script == t.script { - return Tag{lang: t.lang} - } - } - return t - } - if t.lang != 0 { - if t.region != 0 { - maxScript := t.script - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.script - } - - for i := range parents { - if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if regionID(r) == t.region { - return Tag{ - lang: t.lang, - script: scriptID(parents[i].script), - region: regionID(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != maxScript { - return Tag{lang: t.lang, script: maxScript} - } - return Tag{lang: t.lang} - } else if t.script != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != t.script { - return und - } - return Tag{lang: t.lang} - } - } - return und + return Tag(compact.Tag(t).Parent()) } // returns token t and the rest of the string. @@ -487,17 +367,8 @@ func (e Extension) String() string { // ParseExtension parses s as an extension and returns it on success. func ParseExtension(s string) (e Extension, err error) { - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return Extension{}, errSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return Extension{}, errSyntax - } - return Extension{string(scan.b)}, nil + ext, err := language.ParseExtension(s) + return Extension{ext}, err } // Type returns the one-byte extension type of e. It returns 0 for the zero @@ -518,22 +389,20 @@ func (e Extension) Tokens() []string { // false for ok if t does not have the requested extension. The returned // extension will be invalid in this case. func (t Tag) Extension(x byte) (ext Extension, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return Extension{ext}, true - } + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false } - return Extension{}, false + e, ok := t.tag().Extension(x) + return Extension{e}, ok } // Extensions returns all extensions of t. func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } e := []Extension{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) + for _, ext := range t.tag().Extensions() { e = append(e, Extension{ext}) } return e @@ -541,259 +410,105 @@ func (t Tag) Extensions() []Extension { // TypeForKey returns the type associated with the given key, where key and type // are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // TypeForKey will traverse the inheritance chain to get the correct value. func (t Tag) TypeForKey(key string) string { - if start, end, _ := t.findTypeForKey(key); end != start { - return t.str[start:end] + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } } - return "" + return t.tag().TypeForKey(key) } -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - // SetTypeForKey returns a new Tag with the key set to type, where key and type // are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // An empty value removes an existing pair with the same key. func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.private() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, end, _ := t.findTypeForKey(key) - if start != end { - // Remove key tag and leading '-'. - start -= 4 - - // Remove a possible empty extension. - if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, end, hasExt := t.findTypeForKey(key) - if start == end { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) - } - } - return t, nil + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err } -// findKeyAndType returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - // p points to the hyphen preceding the current token. - if p3 := p + 3; s[p3] == '-' { - // Found a key. - // Check whether we just processed the key that was requested. - if curKey == key { - return start, p, true - } - // Set to the next key and continue scanning type tokens. - curKey = s[p+1 : p3] - if curKey > key { - return p, p, true - } - // Start of the type token sequence. - start = p + 4 - // A type is at least 3 characters long. - p += 7 // 4 + 3 - } else { - // Attribute or type, which is at least 3 characters long. - p += 4 - } - // p points past the third character of a type or attribute. - max := p + 5 // maximum length of token plus hyphen. - if len(s) < max { - max = len(s) - } - for ; p < max && s[p] != '-'; p++ { - } - // Bail if we have exhausted all tokens or if the next token starts - // a new extension. - if p == len(s) || s[p+2] == '-' { - if curKey == key { - return start, p, true - } - return p, p, true - } - } -} +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags // CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository. The index will change over time -// and should not be stored in persistent storage. Extensions, except for the -// 'va' type of the 'u' extension, are ignored. It will return 0, false if no -// compact tag exists, where 0 is the index for the root language (Und). -func CompactIndex(t Tag) (index int, ok bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - b, s, r := t.Raw() - if len(t.str) > 0 { - if strings.HasPrefix(t.str, "x-") { - // We have no entries for user-defined tags. - return 0, false - } - if uint16(t.pVariant) != t.pExt { - // There are no tags with variants and an u-va type. - if t.TypeForKey("va") != "" { - return 0, false - } - t, _ = Raw.Compose(b, s, r, t.Variants()) - } else if _, ok := t.Extension('u'); ok { - // Strip all but the 'va' entry. - variant := t.TypeForKey("va") - t, _ = Raw.Compose(b, s, r) - t, _ = t.SetTypeForKey("va", variant) - } - if len(t.str) > 0 { - // We have some variants. - for i, s := range specialTags { - if s == t { - return i + 1, true - } - } - return 0, false - } - } - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - key := uint32(b.langID) << (8 + 12) - key |= uint32(s.scriptID) << 12 - key |= uint32(r.regionID) - x, ok := coreTags[key] - return int(x), ok +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact } +var root = language.Tag{} + // Base is an ISO 639 language code, used for encoding the base language // of a language tag. type Base struct { - langID + langID language.Language } // ParseBase parses a 2- or 3-letter ISO 639 code. // It returns a ValueError if s is a well-formed but unknown language identifier // or another error if another error occurred. func ParseBase(s string) (Base, error) { - if n := len(s); n < 2 || 3 < n { - return Base{}, errSyntax - } - var buf [3]byte - l, err := getLangID(buf[:copy(buf[:], s)]) + l, err := language.ParseBase(s) return Base{l}, err } +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + // Script is a 4-letter ISO 15924 code for representing scripts. // It is idiomatically represented in title case. type Script struct { - scriptID + scriptID language.Script } // ParseScript parses a 4-letter ISO 15924 code. // It returns a ValueError if s is a well-formed but unknown script identifier // or another error if another error occurred. func ParseScript(s string) (Script, error) { - if len(s) != 4 { - return Script{}, errSyntax - } - var buf [4]byte - sc, err := getScriptID(script, buf[:copy(buf[:], s)]) + sc, err := language.ParseScript(s) return Script{sc}, err } +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + // Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. type Region struct { - regionID + regionID language.Region } // EncodeM49 returns the Region for the given UN M.49 code. // It returns an error if r is not a valid code. func EncodeM49(r int) (Region, error) { - rid, err := getRegionM49(r) + rid, err := language.EncodeM49(r) return Region{rid}, err } @@ -801,62 +516,54 @@ func EncodeM49(r int) (Region, error) { // It returns a ValueError if s is a well-formed but unknown region identifier // or another error if another error occurred. func ParseRegion(s string) (Region, error) { - if n := len(s); n < 2 || 3 < n { - return Region{}, errSyntax - } - var buf [3]byte - r, err := getRegionID(buf[:copy(buf[:], s)]) + r, err := language.ParseRegion(s) return Region{r}, err } +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.String() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + // IsCountry returns whether this region is a country or autonomous area. This // includes non-standard definitions from CLDR. func (r Region) IsCountry() bool { - if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK { - return false - } - return true + return r.regionID.IsCountry() } // IsGroup returns whether this region defines a collection of regions. This // includes non-standard definitions from CLDR. func (r Region) IsGroup() bool { - if r.regionID == 0 { - return false - } - return int(regionInclusion[r.regionID]) < len(regionContainment) + return r.regionID.IsGroup() } // Contains returns whether Region c is contained by Region r. It returns true // if c == r. func (r Region) Contains(c Region) bool { - return r.regionID.contains(c.regionID) + return r.regionID.Contains(c.regionID) } -func (r regionID) contains(c regionID) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - // TLD returns the country code top-level domain (ccTLD). UK is returned for GB. // In all other cases it returns either the region itself or an error. // @@ -865,25 +572,15 @@ var errNoTLD = errors.New("language: region is not a valid ccTLD") // region will already be canonicalized it was obtained from a Tag that was // obtained using any of the default methods. func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r.regionID == _GB { - r = Region{_UK} - } - if (r.typ() & ccTLD) == 0 { - return Region{}, errNoTLD - } - return r, nil + tld, err := r.regionID.TLD() + return Region{tld}, err } // Canonicalize returns the region or a possible replacement if the region is // deprecated. It will not return a replacement for deprecated regions that // are split into multiple regions. func (r Region) Canonicalize() Region { - if cr := normRegion(r.regionID); cr != 0 { - return Region{cr} - } - return r + return Region{r.regionID.Canonicalize()} } // Variant represents a registered variant of a language as defined by BCP 47. @@ -894,11 +591,8 @@ type Variant struct { // ParseVariant parses and returns a Variant. An error is returned if s is not // a valid variant. func ParseVariant(s string) (Variant, error) { - s = strings.ToLower(s) - if _, ok := variantIndex[s]; ok { - return Variant{s}, nil - } - return Variant{}, mkErrInvalid([]byte(s)) + v, err := language.ParseVariant(s) + return Variant{v.String()}, err } // String returns the string representation of the variant. diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index 15b74d125c..f734921349 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -4,7 +4,12 @@ package language -import "errors" +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) // A MatchOption configures a Matcher. type MatchOption func(*matcher) @@ -74,12 +79,13 @@ func NewMatcher(t []Tag, options ...MatchOption) Matcher { } func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag match, w, c := m.getBest(want...) if match != nil { - t, index = match.tag, match.index + tt, index = match.tag, match.index } else { // TODO: this should be an option - t = m.default_.tag + tt = m.default_.tag if m.preferSameScript { outer: for _, w := range want { @@ -91,7 +97,7 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { } for i, h := range m.supported { if script.scriptID == h.maxScript { - t, index = h.tag, i + tt, index = h.tag, i break outer } } @@ -99,238 +105,45 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { } // TODO: select first language tag based on script. } - if w.region != 0 && t.region != 0 && t.region.contains(w.region) { - t, _ = Raw.Compose(t, Region{w.region}) + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } } // Copy options from the user-provided tag into the result tag. This is hard // to do after the fact, so we do it here. // TODO: add in alternative variants to -u-va-. // TODO: add preferred region to -u-rg-. if e := w.Extensions(); len(e) > 0 { - t, _ = Raw.Compose(t, e) - } - return t, index, c -} - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id langID) { - if t.lang == 0 { - t.lang = id - } -} - -func (t *Tag) setUndefinedScript(id scriptID) { - if t.script == 0 { - t.script = id - } -} - -func (t *Tag) setUndefinedRegion(id regionID) { - if t.region == 0 || t.region.contains(id) { - t.region = id + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() } + return makeTag(tt), index, c } // ErrMissingLikelyTagsData indicates no information was available // to compute likely values of missing tags. var ErrMissingLikelyTagsData = errors.New("missing likely tags data") -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns an ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.remakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if langID(x.lang) == t.lang && scriptID(x.script) == t.script { - t.region = regionID(x.region) - } - return true - } - return false -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.private() { - return t, nil - } - if t.script != 0 && t.region != 0 { - if t.lang != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.region : t.region+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if scriptID(x.script) == t.script { - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - } - if t.lang != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.script != 0 { - for _, x := range list { - if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(regionID(x.region)) - return t, nil - } - } - } else if t.region != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) { - tt.region = regionID(x.region) - tt.setUndefinedScript(scriptID(x.script)) - goodScript = goodScript && tt.script == scriptID(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.script = tt.script - } - } - } - } - } else { - // Search matches for und-script. - if t.script != 0 { - x := likelyScript[t.script] - if x.region != 0 { - t.setUndefinedRegion(regionID(x.region)) - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.region != 0 { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - t.region = regionID(x.region) - } - } else { - x := likelyRegion[t.region] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(scriptID(x.script)) - t.setUndefinedRegion(regionID(x.region)) - } - specializeRegion(&t) - if t.lang == 0 { - t.lang = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.lang = id.lang - t.script = id.script - t.region = id.region -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.remakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {lang: t.lang}, - {lang: t.lang, region: t.region}, - {lang: t.lang, script: t.script}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } // Tag Matching // CLDR defines an algorithm for finding the best match between two sets of language // tags. The basic algorithm defines how to score a possible match and then find // the match with the best score -// (see http://www.unicode.org/reports/tr35/#LanguageMatching). +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). // Using scoring has several disadvantages. The scoring obfuscates the importance of // the various factors considered, making the algorithm harder to understand. Using // scoring also requires the full score to be computed for each pair of tags. @@ -441,7 +254,7 @@ func minimizeTags(t Tag) (Tag, error) { type matcher struct { default_ *haveTag supported []*haveTag - index map[langID]*matchHeader + index map[language.Language]*matchHeader passSettings bool preferSameScript bool } @@ -456,7 +269,7 @@ type matchHeader struct { // haveTag holds a supported Tag and its maximized script and region. The maximized // or canonicalized language is not stored as it is not needed during matching. type haveTag struct { - tag Tag + tag language.Tag // index of this tag in the original list of supported tags. index int @@ -466,37 +279,37 @@ type haveTag struct { conf Confidence // Maximized region and script. - maxRegion regionID - maxScript scriptID + maxRegion language.Region + maxScript language.Script // altScript may be checked as an alternative match to maxScript. If altScript // matches, the confidence level for this match is Low. Theoretically there // could be multiple alternative scripts. This does not occur in practice. - altScript scriptID + altScript language.Script // nextMax is the index of the next haveTag with the same maximized tags. nextMax uint16 } -func makeHaveTag(tag Tag, index int) (haveTag, langID) { +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { max := tag - if tag.lang != 0 || tag.region != 0 || tag.script != 0 { - max, _ = max.canonicalize(All) - max, _ = addTags(max) - max.remakeString() + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() } - return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID } // altScript returns an alternative script that may match the given script with // a low confidence. At the moment, the langMatch data allows for at most one // script to map to another and we rely on this to keep the code simple. -func altScript(l langID, s scriptID) scriptID { +func altScript(l language.Language, s language.Script) language.Script { for _, alt := range matchScript { // TODO: also match cases where language is not the same. - if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) && - scriptID(alt.haveScript) == s { - return scriptID(alt.wantScript) + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) } } return 0 @@ -508,7 +321,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { h.original = h.original || exact // Don't add new exact matches. for _, v := range h.haveTags { - if v.tag.equalsRest(n.tag) { + if equalsRest(v.tag, n.tag) { return } } @@ -517,7 +330,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { for i, v := range h.haveTags { if v.maxScript == n.maxScript && v.maxRegion == n.maxRegion && - v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() { + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { for h.haveTags[i].nextMax != 0 { i = int(h.haveTags[i].nextMax) } @@ -530,7 +343,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { // header returns the matchHeader for the given language. It creates one if // it doesn't already exist. -func (m *matcher) header(l langID) *matchHeader { +func (m *matcher) header(l language.Language) *matchHeader { if h := m.index[l]; h != nil { return h } @@ -554,7 +367,7 @@ func toConf(d uint8) Confidence { // for a given tag. func newMatcher(supported []Tag, options []MatchOption) *matcher { m := &matcher{ - index: make(map[langID]*matchHeader), + index: make(map[language.Language]*matchHeader), preferSameScript: true, } for _, o := range options { @@ -567,16 +380,18 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // Add supported languages to the index. Add exact matches first to give // them precedence. for i, tag := range supported { - pair, _ := makeHaveTag(tag, i) - m.header(tag.lang).addIfNew(pair, true) + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) m.supported = append(m.supported, &pair) } - m.default_ = m.header(supported[0].lang).haveTags[0] + m.default_ = m.header(supported[0].lang()).haveTags[0] // Keep these in two different loops to support the case that two equivalent // languages are distinguished, such as iw and he. for i, tag := range supported { - pair, max := makeHaveTag(tag, i) - if max != tag.lang { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { m.header(max).addIfNew(pair, true) } } @@ -585,11 +400,11 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // update will only add entries to original indexes, thus not computing any // transitive relations. update := func(want, have uint16, conf Confidence) { - if hh := m.index[langID(have)]; hh != nil { + if hh := m.index[language.Language(have)]; hh != nil { if !hh.original { return } - hw := m.header(langID(want)) + hw := m.header(language.Language(want)) for _, ht := range hh.haveTags { v := *ht if conf < v.conf { @@ -597,7 +412,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { } v.nextMax = 0 // this value needs to be recomputed if v.altScript != 0 { - v.altScript = altScript(langID(want), v.maxScript) + v.altScript = altScript(language.Language(want), v.maxScript) } hw.addIfNew(v, conf == Exact && hh.original) } @@ -618,66 +433,67 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // First we match deprecated equivalents. If they are perfect equivalents // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. - for i, lm := range langAliasMap { + for i, lm := range language.AliasMap { // If deprecated codes match and there is no fiddling with the script or // or region, we consider it an exact match. conf := Exact - if langAliasTypes[i] != langMacro { - if !isExactEquivalent(langID(lm.from)) { + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { conf = High } - update(lm.to, lm.from, conf) + update(lm.To, lm.From, conf) } - update(lm.from, lm.to, conf) + update(lm.From, lm.To, conf) } return m } // getBest gets the best matching tag in m for any of the given tags, taking into // account the order of preference of the given tags. -func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { best := bestMatch{} - for i, w := range want { - var max Tag + for i, ww := range want { + w := ww.tag() + var max language.Tag // Check for exact match first. - h := m.index[w.lang] - if w.lang != 0 { + h := m.index[w.LangID] + if w.LangID != 0 { if h == nil { continue } // Base language is defined. - max, _ = w.canonicalize(Legacy | Deprecated | Macro) + max, _ = canonicalize(Legacy|Deprecated|Macro, w) // A region that is added through canonicalization is stronger than // a maximized region: set it in the original (e.g. mo -> ro-MD). - if w.region != max.region { - w.region = max.region + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID } // TODO: should we do the same for scripts? // See test case: en, sr, nl ; sh ; sr - max, _ = addTags(max) + max, _ = max.Maximize() } else { // Base language is not defined. if h != nil { for i := range h.haveTags { have := h.haveTags[i] - if have.tag.equalsRest(w) { + if equalsRest(have.tag, w) { return have, w, Exact } } } - if w.script == 0 && w.region == 0 { + if w.ScriptID == 0 && w.RegionID == 0 { // We skip all tags matching und for approximate matching, including // private tags. continue } - max, _ = addTags(w) - if h = m.index[max.lang]; h == nil { + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { continue } } pin := true for _, t := range want[i+1:] { - if w.lang == t.lang { + if w.LangID == t.lang() { pin = false break } @@ -685,11 +501,11 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { // Check for match based on maximized tag. for i := range h.haveTags { have := h.haveTags[i] - best.update(have, w, max.script, max.region, pin) + best.update(have, w, max.ScriptID, max.RegionID, pin) if best.conf == Exact { for have.nextMax != 0 { have = h.haveTags[have.nextMax] - best.update(have, w, max.script, max.region, pin) + best.update(have, w, max.ScriptID, max.RegionID, pin) } return best.have, best.want, best.conf } @@ -697,9 +513,9 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { } if best.conf <= No { if len(want) != 0 { - return nil, want[0], No + return nil, want[0].tag(), No } - return nil, Tag{}, No + return nil, language.Tag{}, No } return best.have, best.want, best.conf } @@ -707,9 +523,9 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { // bestMatch accumulates the best match so far. type bestMatch struct { have *haveTag - want Tag + want language.Tag conf Confidence - pinnedRegion regionID + pinnedRegion language.Region pinLanguage bool sameRegionGroup bool // Cached results from applying tie-breaking rules. @@ -734,19 +550,19 @@ type bestMatch struct { // still prefer a second language over a dialect of the preferred language by // explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should // be false. -func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) { +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { // Bail if the maximum attainable confidence is below that of the current best match. c := have.conf if c < m.conf { return } // Don't change the language once we already have found an exact match. - if m.pinLanguage && tag.lang != m.want.lang { + if m.pinLanguage && tag.LangID != m.want.LangID { return } // Pin the region group if we are comparing tags for the same language. - if tag.lang == m.want.lang && m.sameRegionGroup { - _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang) + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) if !sameGroup { return } @@ -756,7 +572,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion // don't pin anything, otherwise pin the language. m.pinLanguage = pin } - if have.tag.equalsRest(tag) { + if equalsRest(have.tag, tag) { } else if have.maxScript != maxScript { // There is usually very little comprehension between different scripts. // In a few cases there may still be Low comprehension. This possibility @@ -786,7 +602,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion // Tie-breaker rules: // We prefer if the pre-maximized language was specified and identical. - origLang := have.tag.lang == tag.lang && tag.lang != 0 + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 if !beaten && m.origLang != origLang { if m.origLang { return @@ -795,7 +611,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } // We prefer if the pre-maximized region was specified and identical. - origReg := have.tag.region == tag.region && tag.region != 0 + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 if !beaten && m.origReg != origReg { if m.origReg { return @@ -803,7 +619,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang) + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) if !beaten && m.regGroupDist != regGroupDist { if regGroupDist > m.regGroupDist { return @@ -811,7 +627,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - paradigmReg := isParadigmLocale(tag.lang, have.maxRegion) + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) if !beaten && m.paradigmReg != paradigmReg { if !paradigmReg { return @@ -820,7 +636,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } // Next we prefer if the pre-maximized script was specified and identical. - origScript := have.tag.script == tag.script && tag.script != 0 + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 if !beaten && m.origScript != origScript { if m.origScript { return @@ -843,9 +659,9 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } } -func isParadigmLocale(lang langID, r regionID) bool { +func isParadigmLocale(lang language.Language, r language.Region) bool { for _, e := range paradigmLocales { - if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { return true } } @@ -854,13 +670,13 @@ func isParadigmLocale(lang langID, r regionID) bool { // regionGroupDist computes the distance between two regions based on their // CLDR grouping. -func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) { +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { const defaultDistance = 4 aGroup := uint(regionToGroups[a]) << 1 bGroup := uint(regionToGroups[b]) << 1 for _, ri := range matchRegion { - if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { group := uint(1 << (ri.group &^ 0x80)) if 0x80&ri.group == 0 { if aGroup&bGroup&group != 0 { // Both regions are in the group. @@ -876,31 +692,16 @@ func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, s return defaultDistance, true } -func (t Tag) variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// variantOrPrivateTagStr returns variants or private use tags. -func (t Tag) variantOrPrivateTagStr() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - // equalsRest compares everything except the language. -func (a Tag) equalsRest(b Tag) bool { +func equalsRest(a, b language.Tag) bool { // TODO: don't include extensions in this comparison. To do this efficiently, // though, we should handle private tags separately. - return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr() + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() } // isExactEquivalent returns true if canonicalizing the language will not alter // the script or region of a tag. -func isExactEquivalent(l langID) bool { +func isExactEquivalent(l language.Language) bool { for _, o := range notEquivalent { if o == l { return false @@ -909,25 +710,26 @@ func isExactEquivalent(l langID) bool { return true } -var notEquivalent []langID +var notEquivalent []language.Language func init() { // Create a list of all languages for which canonicalization may alter the // script or region. - for _, lm := range langAliasMap { - tag := Tag{lang: langID(lm.from)} - if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 { - notEquivalent = append(notEquivalent, langID(lm.from)) + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) } } // Maximize undefined regions of paradigm locales. for i, v := range paradigmLocales { - max, _ := addTags(Tag{lang: langID(v[0])}) + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() if v[1] == 0 { - paradigmLocales[i][1] = uint16(max.region) + paradigmLocales[i][1] = uint16(max.RegionID) } if v[2] == 0 { - paradigmLocales[i][2] = uint16(max.region) + paradigmLocales[i][2] = uint16(max.RegionID) } } } diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go index fca2d30e50..11acfd8856 100644 --- a/vendor/golang.org/x/text/language/parse.go +++ b/vendor/golang.org/x/text/language/parse.go @@ -5,216 +5,21 @@ package language import ( - "bytes" "errors" - "fmt" - "sort" "strconv" "strings" - "golang.org/x/text/internal/tag" + "golang.org/x/text/internal/language" ) -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// errSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var errSyntax = errors.New("language: tag is not well-formed") - // ValueError is returned by any of the parsing functions when the // input is well-formed but the respective subtag is not recognized // as a valid value. -type ValueError struct { - v [8]byte -} - -func mkErrInvalid(s []byte) error { - var e ValueError - copy(e.v[:], s) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} +type ValueError interface { + error -func (s *scanner) setError(e error) { - if s.err == nil || (e == errSyntax && s.err != errSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - if end < cap(s.b) { - b := make([]byte, len(s.b)+diff) - copy(b, s.b[:oldStart]) - copy(b[end:], s.b[oldEnd:]) - s.b = b - } else { - s.b = append(s.b[end:], s.b[oldEnd:]...) - } - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.setError(errSyntax) - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(errSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(errSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end + // Subtag returns the subtag for which the error occurred. + Subtag() string } // Parse parses the given BCP 47 string and returns a valid Tag. If parsing @@ -223,7 +28,7 @@ func (s *scanner) acceptMinSize(min int) (end int) { // ValueError. The Tag returned in this case is just stripped of the unknown // value. All other values are preserved. It accepts tags in the BCP 47 format // and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // The resulting tag is canonicalized using the default canonicalization type. func Parse(s string) (t Tag, err error) { return Default.Parse(s) @@ -235,327 +40,18 @@ func Parse(s string) (t Tag, err error) { // ValueError. The Tag returned in this case is just stripped of the unknown // value. All other values are preserved. It accepts tags in the BCP 47 format // and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the the canonicalization type c. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. func (c CanonType) Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return und, errSyntax - } - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err } - scan := makeScannerString(s) - t, err = parse(&scan, s) - t, changed := t.canonicalize(c) + tt, changed := canonicalize(c, tt) if changed { - t.remakeString() - } - return t, err -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, errSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return und, errSyntax - } else { // the usual case - t, end = parseTag(scan) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(errSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.lang, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.lang.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, - tags are equivalent - // to a tag of the form . - lang, e := getLangID(scan.token) - if lang != 0 { - t.lang = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 - } - scan.gobble(e) - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.script, e = getScriptID(script, scan.token) - if t.script == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.region, e = getRegionID(scan.token) - if t.region == 0 { - scan.gobble(e) - } else { - scan.replace(t.region.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(mkErrInvalid(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort [][]byte - -func (b bytesSort) Len() int { - return len(b) -} - -func (b bytesSort) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bytesSort) Less(i, j int) bool { - return bytes.Compare(b[i], b[j]) == -1 -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(errSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) + tt.RemakeString() } - sort.Sort(bytesSort(exts)) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort(attrs)) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - keyEnd := scan.end - end = scan.acceptMinSize(3) - // TODO: check key value validity - if keyEnd == end || bytes.Compare(key, last) != 1 { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart, keyEnd := scan.start, scan.end - end = scan.acceptMinSize(3) - if keyEnd != end { - keys = append(keys, scan.b[keyStart:end]) - } else { - scan.setError(errSyntax) - end = keyStart - } - } - sort.Sort(bytesSort(keys)) - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], bytes.Join(keys, separator)) - break - } - } - case 't': - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end + return makeTag(tt), err } // Compose creates a Tag from individual parts, which may be of type Tag, Base, @@ -563,10 +59,11 @@ func parseExtension(scan *scanner) int { // Base, Script or Region or slice of type Variant or Extension is passed more // than once, the latter will overwrite the former. Variants and Extensions are // accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using the Default CanonType. If one or more errors are -// encountered, one of the errors is returned. +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. func Compose(part ...interface{}) (t Tag, err error) { return Default.Compose(part...) } @@ -576,191 +73,63 @@ func Compose(part ...interface{}) (t Tag, err error) { // Base, Script or Region or slice of type Variant or Extension is passed more // than once, the latter will overwrite the former. Variants and Extensions are // accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using CanonType c. If one or more errors are encountered, -// one of the errors is returned. +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { - var b builder - if err = b.update(part...); err != nil { + var b language.Builder + if err = update(&b, part...); err != nil { return und, err } - t, _ = b.tag.canonicalize(c) - - if len(b.ext) > 0 || len(b.variant) > 0 { - sort.Sort(sortVariant(b.variant)) - sort.Strings(b.ext) - if b.private != "" { - b.ext = append(b.ext, b.private) - } - n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variant...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.ext...) - t.str = string(buf[:p]) - } else if b.private != "" { - t.str = b.private - t.remakeString() - } - return -} - -type builder struct { - tag Tag - - private string // the x extension - ext []string - variant []string - - err error -} - -func (b *builder) addExt(e string) { - if e == "" { - } else if e[0] == 'x' { - b.private = e - } else { - b.ext = append(b.ext, e) - } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err } var errInvalidArgument = errors.New("invalid Extension or Variant") -func (b *builder) update(part ...interface{}) (err error) { - replace := func(l *[]string, s string, eq func(a, b string) bool) bool { - if s == "" { - b.err = errInvalidArgument - return true - } - for i, v := range *l { - if eq(v, s) { - (*l)[i] = s - return true - } - } - return false - } +func update(b *language.Builder, part ...interface{}) (err error) { for _, x := range part { switch v := x.(type) { case Tag: - b.tag.lang = v.lang - b.tag.region = v.region - b.tag.script = v.script - if v.str != "" { - b.variant = nil - for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; { - x, s = nextToken(s) - b.variant = append(b.variant, x) - } - b.ext, b.private = nil, "" - for i, e := int(v.pExt), ""; i < len(v.str); { - i, e = getExtension(v.str, i) - b.addExt(e) - } - } + b.SetTag(v.tag()) case Base: - b.tag.lang = v.langID + b.Tag.LangID = v.langID case Script: - b.tag.script = v.scriptID + b.Tag.ScriptID = v.scriptID case Region: - b.tag.region = v.regionID + b.Tag.RegionID = v.regionID case Variant: - if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) { - b.variant = append(b.variant, v.variant) + if v.variant == "" { + err = errInvalidArgument + break } + b.AddVariant(v.variant) case Extension: - if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) { - b.addExt(v.s) + if v.s == "" { + err = errInvalidArgument + break } + b.SetExt(v.s) case []Variant: - b.variant = nil - for _, x := range v { - b.update(x) + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) } case []Extension: - b.ext, b.private = nil, "" + b.ClearExtensions() for _, e := range v { - b.update(e) + b.SetExt(e.s) } // TODO: support parsing of raw strings based on morphology or just extensions? case error: - err = v - } - } - return -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariant []string - -func (s sortVariant) Len() int { - return len(s) -} - -func (s sortVariant) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariant) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} - -func findExt(list []string, x byte) int { - for i, e := range list { - if e[0] == x { - return i - } - } - return -1 -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p + if v != nil { + err = v } - p += 3 - } else { - p++ } } - return len(s) + return } var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") @@ -788,7 +157,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { if !ok { return nil, nil, err } - t = Tag{lang: id} + t = makeTag(language.Tag{LangID: id}) } // Scan the optional weight. @@ -830,9 +199,9 @@ func split(s string, c byte) (head, tail string) { return strings.TrimSpace(s), "" } -// Add hack mapping to deal with a small number of cases that that occur +// Add hack mapping to deal with a small number of cases that occur // in Accept-Language (with reasonable frequency). -var acceptFallback = map[string]langID{ +var acceptFallback = map[string]language.Language{ "english": _en, "deutsch": _de, "italian": _it, diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index b738d457b5..e22807719e 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -2,997 +2,22 @@ package language -import "golang.org/x/text/internal/tag" - // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const numLanguages = 8665 - -const numScripts = 242 - -const numRegions = 357 - -type fromTo struct { - from uint16 - to uint16 -} - -const nonCanonicalUnd = 1201 const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 250 - _da = 257 _de = 269 - _el = 310 _en = 313 - _es = 318 - _et = 320 - _fa = 328 - _fi = 337 - _fil = 339 _fr = 350 - _gu = 420 - _he = 444 - _hi = 446 - _hr = 465 - _hu = 469 - _hy = 471 - _id = 481 - _is = 504 _it = 505 - _ja = 512 - _ka = 528 - _kk = 578 - _km = 586 - _kn = 593 - _ko = 596 - _ky = 650 - _lo = 696 - _lt = 704 - _lv = 711 - _mk = 767 - _ml = 772 - _mn = 779 _mo = 784 - _mr = 795 - _ms = 799 - _mul = 806 - _my = 817 - _nb = 839 - _ne = 849 - _nl = 871 _no = 879 - _pa = 925 - _pl = 947 + _nb = 839 _pt = 960 - _ro = 988 - _ru = 994 _sh = 1031 - _si = 1036 - _sk = 1042 - _sl = 1046 - _sq = 1073 - _sr = 1074 - _sv = 1092 - _sw = 1093 - _ta = 1104 - _te = 1121 - _th = 1131 - _tl = 1146 - _tn = 1152 - _tr = 1162 - _uk = 1198 - _ur = 1204 - _uz = 1212 - _vi = 1219 - _zh = 1321 - _zu = 1327 - _jbo = 515 - _ami = 1650 - _bnn = 2357 - _hak = 438 - _tlh = 14467 - _lb = 661 - _nv = 899 - _pwn = 12055 - _tao = 14188 - _tay = 14198 - _tsu = 14662 - _nn = 874 - _sfb = 13629 - _vgt = 15701 - _sgg = 13660 - _cmn = 3007 - _nan = 835 - _hsn = 467 -) - -const langPrivateStart = 0x2f72 - -const langPrivateEnd = 0x3179 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5324 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + - "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + - "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + - "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + - "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + - "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + - "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + - "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + - "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + - "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + - "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + - "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + - "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + - "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + - "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + - "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + - "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + - "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + - "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + - "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + - "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + - "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + - "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + - "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + - "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + - "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + - "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + - "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + - "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + - "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + - "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + - "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + - "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + - "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + - "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + - "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + - "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + - "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + - "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + - "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + - "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + - "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + - "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + - "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + - "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + - "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + - "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + - "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + - "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + - "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + - "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + - "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + - "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + - "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + - "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + - "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + - "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + - "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + - "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + - "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + - "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + - "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + - "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + - "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + - "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + - "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + - "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + - "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + - "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + - "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + - "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + - "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + - "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + - "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + - "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + - "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + - "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + - "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + - "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + - "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + - "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + - "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + - "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + - "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + - "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + - "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + - "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + - "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + - "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + - "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + - "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + - "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + - "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + - "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + - "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + - "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + - "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + - "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + - "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + - "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + - "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + - "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" - -const langNoIndexOffset = 1330 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, - 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, - // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, - 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, -} - -// langAliasMap maps langIDs to their suggested replacements. -// Size: 656 bytes, 164 elements -var langAliasMap = [164]fromTo{ - 0: {from: 0x82, to: 0x88}, - 1: {from: 0x187, to: 0x1ae}, - 2: {from: 0x1f3, to: 0x1e1}, - 3: {from: 0x1fb, to: 0x1bc}, - 4: {from: 0x208, to: 0x512}, - 5: {from: 0x20f, to: 0x20e}, - 6: {from: 0x310, to: 0x3dc}, - 7: {from: 0x347, to: 0x36f}, - 8: {from: 0x407, to: 0x432}, - 9: {from: 0x47a, to: 0x153}, - 10: {from: 0x490, to: 0x451}, - 11: {from: 0x4a2, to: 0x21}, - 12: {from: 0x53e, to: 0x544}, - 13: {from: 0x58f, to: 0x12d}, - 14: {from: 0x630, to: 0x1eb1}, - 15: {from: 0x651, to: 0x431}, - 16: {from: 0x662, to: 0x431}, - 17: {from: 0x6ed, to: 0x3a}, - 18: {from: 0x6f8, to: 0x1d7}, - 19: {from: 0x73e, to: 0x21a1}, - 20: {from: 0x7b3, to: 0x56}, - 21: {from: 0x7b9, to: 0x299b}, - 22: {from: 0x7c5, to: 0x58}, - 23: {from: 0x7e6, to: 0x145}, - 24: {from: 0x80c, to: 0x5a}, - 25: {from: 0x815, to: 0x8d}, - 26: {from: 0x87e, to: 0x810}, - 27: {from: 0x8c3, to: 0xee3}, - 28: {from: 0x9ef, to: 0x331}, - 29: {from: 0xa36, to: 0x2c5}, - 30: {from: 0xa3d, to: 0xbf}, - 31: {from: 0xabe, to: 0x3322}, - 32: {from: 0xb38, to: 0x529}, - 33: {from: 0xb75, to: 0x265a}, - 34: {from: 0xb7e, to: 0xbc3}, - 35: {from: 0xb9b, to: 0x44e}, - 36: {from: 0xbbc, to: 0x4229}, - 37: {from: 0xbbf, to: 0x529}, - 38: {from: 0xbfe, to: 0x2da7}, - 39: {from: 0xc2e, to: 0x3181}, - 40: {from: 0xcb9, to: 0xf3}, - 41: {from: 0xd08, to: 0xfa}, - 42: {from: 0xdc8, to: 0x11a}, - 43: {from: 0xdd7, to: 0x32d}, - 44: {from: 0xdf8, to: 0xdfb}, - 45: {from: 0xdfe, to: 0x531}, - 46: {from: 0xedf, to: 0x205a}, - 47: {from: 0xeee, to: 0x2e9a}, - 48: {from: 0xf39, to: 0x367}, - 49: {from: 0x10d0, to: 0x140}, - 50: {from: 0x1104, to: 0x2d0}, - 51: {from: 0x11a0, to: 0x1ec}, - 52: {from: 0x1279, to: 0x21}, - 53: {from: 0x1424, to: 0x15e}, - 54: {from: 0x1470, to: 0x14e}, - 55: {from: 0x151f, to: 0xd9b}, - 56: {from: 0x1523, to: 0x390}, - 57: {from: 0x1532, to: 0x19f}, - 58: {from: 0x1580, to: 0x210}, - 59: {from: 0x1583, to: 0x10d}, - 60: {from: 0x15a3, to: 0x3caf}, - 61: {from: 0x166a, to: 0x19b}, - 62: {from: 0x16c8, to: 0x136}, - 63: {from: 0x1700, to: 0x29f8}, - 64: {from: 0x1718, to: 0x194}, - 65: {from: 0x1727, to: 0xf3f}, - 66: {from: 0x177a, to: 0x178}, - 67: {from: 0x1809, to: 0x17b6}, - 68: {from: 0x1816, to: 0x18f3}, - 69: {from: 0x188a, to: 0x436}, - 70: {from: 0x1979, to: 0x1d01}, - 71: {from: 0x1a74, to: 0x2bb0}, - 72: {from: 0x1a8a, to: 0x1f8}, - 73: {from: 0x1b5a, to: 0x1fa}, - 74: {from: 0x1b86, to: 0x1515}, - 75: {from: 0x1d64, to: 0x2c9b}, - 76: {from: 0x2038, to: 0x37b1}, - 77: {from: 0x203d, to: 0x20dd}, - 78: {from: 0x205a, to: 0x30b}, - 79: {from: 0x20e3, to: 0x274}, - 80: {from: 0x20ee, to: 0x263}, - 81: {from: 0x20f2, to: 0x22d}, - 82: {from: 0x20f9, to: 0x256}, - 83: {from: 0x210f, to: 0x21eb}, - 84: {from: 0x2135, to: 0x27d}, - 85: {from: 0x2160, to: 0x913}, - 86: {from: 0x2199, to: 0x121}, - 87: {from: 0x21ce, to: 0x1561}, - 88: {from: 0x21e6, to: 0x504}, - 89: {from: 0x21f4, to: 0x49f}, - 90: {from: 0x222d, to: 0x121}, - 91: {from: 0x2237, to: 0x121}, - 92: {from: 0x2262, to: 0x92a}, - 93: {from: 0x2316, to: 0x3226}, - 94: {from: 0x2382, to: 0x3365}, - 95: {from: 0x2472, to: 0x2c7}, - 96: {from: 0x24e4, to: 0x2ff}, - 97: {from: 0x24f0, to: 0x2fa}, - 98: {from: 0x24fa, to: 0x31f}, - 99: {from: 0x2550, to: 0xb5b}, - 100: {from: 0x25a9, to: 0xe2}, - 101: {from: 0x263e, to: 0x2d0}, - 102: {from: 0x26c9, to: 0x26b4}, - 103: {from: 0x26f9, to: 0x3c8}, - 104: {from: 0x2727, to: 0x3caf}, - 105: {from: 0x2765, to: 0x26b4}, - 106: {from: 0x2789, to: 0x4358}, - 107: {from: 0x28ef, to: 0x2837}, - 108: {from: 0x2914, to: 0x351}, - 109: {from: 0x2986, to: 0x2da7}, - 110: {from: 0x2b1a, to: 0x38d}, - 111: {from: 0x2bfc, to: 0x395}, - 112: {from: 0x2c3f, to: 0x3caf}, - 113: {from: 0x2cfc, to: 0x3be}, - 114: {from: 0x2d13, to: 0x597}, - 115: {from: 0x2d47, to: 0x148}, - 116: {from: 0x2d48, to: 0x148}, - 117: {from: 0x2dff, to: 0x2f1}, - 118: {from: 0x2e08, to: 0x19cc}, - 119: {from: 0x2e1a, to: 0x2d95}, - 120: {from: 0x2e21, to: 0x292}, - 121: {from: 0x2e54, to: 0x7d}, - 122: {from: 0x2e65, to: 0x2282}, - 123: {from: 0x2ea0, to: 0x2e9b}, - 124: {from: 0x2eef, to: 0x2ed7}, - 125: {from: 0x3193, to: 0x3c4}, - 126: {from: 0x3366, to: 0x338e}, - 127: {from: 0x342a, to: 0x3dc}, - 128: {from: 0x34ee, to: 0x18d0}, - 129: {from: 0x35c8, to: 0x2c9b}, - 130: {from: 0x35e6, to: 0x412}, - 131: {from: 0x3658, to: 0x246}, - 132: {from: 0x3676, to: 0x3f4}, - 133: {from: 0x36fd, to: 0x445}, - 134: {from: 0x37c0, to: 0x121}, - 135: {from: 0x3816, to: 0x38f2}, - 136: {from: 0x382b, to: 0x2c9b}, - 137: {from: 0x382f, to: 0xa9}, - 138: {from: 0x3832, to: 0x3228}, - 139: {from: 0x386c, to: 0x39a6}, - 140: {from: 0x3892, to: 0x3fc0}, - 141: {from: 0x38a5, to: 0x39d7}, - 142: {from: 0x38b4, to: 0x1fa4}, - 143: {from: 0x38b5, to: 0x2e9a}, - 144: {from: 0x395c, to: 0x47e}, - 145: {from: 0x3b4e, to: 0xd91}, - 146: {from: 0x3b78, to: 0x137}, - 147: {from: 0x3c99, to: 0x4bc}, - 148: {from: 0x3fbd, to: 0x100}, - 149: {from: 0x4208, to: 0xa91}, - 150: {from: 0x42be, to: 0x573}, - 151: {from: 0x42f9, to: 0x3f60}, - 152: {from: 0x4378, to: 0x25a}, - 153: {from: 0x43cb, to: 0x36cb}, - 154: {from: 0x43cd, to: 0x10f}, - 155: {from: 0x44af, to: 0x3322}, - 156: {from: 0x44e3, to: 0x512}, - 157: {from: 0x45ca, to: 0x2409}, - 158: {from: 0x45dd, to: 0x26dc}, - 159: {from: 0x4610, to: 0x48ae}, - 160: {from: 0x46ae, to: 0x46a0}, - 161: {from: 0x473e, to: 0x4745}, - 162: {from: 0x4916, to: 0x31f}, - 163: {from: 0x49a7, to: 0x523}, -} - -// Size: 164 bytes, 164 elements -var langAliasTypes = [164]langAliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, - 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, - 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, - // Entry 40 - 7F - 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, - 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, - 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, - 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, - // Entry 80 - BF - 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, - 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, - 0, 1, 1, 1, -} - -const ( - _Latn = 87 - _Hani = 54 - _Hans = 56 - _Hant = 57 - _Qaaa = 139 - _Qaai = 147 - _Qabx = 188 - _Zinh = 236 - _Zyyy = 241 - _Zzzz = 242 + _mul = 806 + _und = 0 ) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 976 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + - "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + - "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + - "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + - "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + - "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + - "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + - "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + - "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + - "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + - "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + - "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + - "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1330 bytes, 1330 elements -var suppressScript = [1330]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, - // Entry 140 - 17F - 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, - // Entry 200 - 23F - 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, - // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, - // Entry 3C0 - 3FF - 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - // Entry 480 - 4BF - 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 4C0 - 4FF - 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, -} - const ( _001 = 1 _419 = 31 @@ -1009,2290 +34,20 @@ const ( _XC = 325 _XK = 333 ) +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 32 - -// regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]fromTo{ - 0: {from: 0x44, to: 0xc4}, - 1: {from: 0x58, to: 0xa7}, - 2: {from: 0x5f, to: 0x60}, - 3: {from: 0x66, to: 0x3b}, - 4: {from: 0x79, to: 0x78}, - 5: {from: 0x93, to: 0x37}, - 6: {from: 0xa3, to: 0x133}, - 7: {from: 0xc1, to: 0x133}, - 8: {from: 0xd7, to: 0x13f}, - 9: {from: 0xdc, to: 0x2b}, - 10: {from: 0xef, to: 0x133}, - 11: {from: 0xf2, to: 0xe2}, - 12: {from: 0xfc, to: 0x70}, - 13: {from: 0x103, to: 0x164}, - 14: {from: 0x12a, to: 0x126}, - 15: {from: 0x132, to: 0x7b}, - 16: {from: 0x13a, to: 0x13e}, - 17: {from: 0x141, to: 0x133}, - 18: {from: 0x15d, to: 0x15e}, - 19: {from: 0x163, to: 0x4b}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 202, 419, - 958, 0, 20, 784, 4, 28, 660, 8, - 51, 530, 24, 10, 32, 16, 40, 36, - 533, 248, 31, 70, 52, 50, 56, 854, - 100, 48, 108, 204, 652, 60, 96, 68, - // Entry 40 - 7F - 535, 76, 44, 64, 104, 74, 72, 112, - 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, - // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, - // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, - // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, - // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 108, 143, 181, 220, 259, 291, - 333, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 666 bytes, 333 elements -var fromM49 = [333]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, - 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, - 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, - 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, - 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, - // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, - // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, - // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, - // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, -} - -// Size: 1615 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x4d, - "1996": 0x4, - "abl1943": 0x5, - "akuapem": 0x6, - "alalc97": 0x4f, - "aluku": 0x7, - "ao1990": 0x8, - "arevela": 0x9, - "arevmda": 0xa, - "asante": 0xb, - "baku1926": 0xc, - "balanka": 0xd, - "barla": 0xe, - "basiceng": 0xf, - "bauddha": 0x10, - "biscayan": 0x11, - "biske": 0x48, - "bohoric": 0x12, - "boont": 0x13, - "colb1945": 0x14, - "cornu": 0x15, - "dajnko": 0x16, - "ekavsk": 0x17, - "emodeng": 0x18, - "fonipa": 0x50, - "fonnapa": 0x51, - "fonupa": 0x52, - "fonxsamp": 0x53, - "hepburn": 0x19, - "heploc": 0x4e, - "hognorsk": 0x1a, - "hsistemo": 0x1b, - "ijekavsk": 0x1c, - "itihasa": 0x1d, - "jauer": 0x1e, - "jyutping": 0x1f, - "kkcor": 0x20, - "kociewie": 0x21, - "kscor": 0x22, - "laukika": 0x23, - "lipaw": 0x49, - "luna1918": 0x24, - "metelko": 0x25, - "monoton": 0x26, - "ndyuka": 0x27, - "nedis": 0x28, - "newfound": 0x29, - "njiva": 0x4a, - "nulik": 0x2a, - "osojs": 0x4b, - "oxendict": 0x2b, - "pahawh2": 0x2c, - "pahawh3": 0x2d, - "pahawh4": 0x2e, - "pamaka": 0x2f, - "petr1708": 0x30, - "pinyin": 0x31, - "polyton": 0x32, - "puter": 0x33, - "rigik": 0x34, - "rozaj": 0x35, - "rumgr": 0x36, - "scotland": 0x37, - "scouse": 0x38, - "simple": 0x54, - "solba": 0x4c, - "sotav": 0x39, - "spanglis": 0x3a, - "surmiran": 0x3b, - "sursilv": 0x3c, - "sutsilv": 0x3d, - "tarask": 0x3e, - "uccor": 0x3f, - "ucrcor": 0x40, - "ulster": 0x41, - "unifon": 0x42, - "vaidika": 0x43, - "valencia": 0x44, - "vallader": 0x45, - "wadegile": 0x46, - "xsistemo": 0x47, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 79 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 33 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 976 bytes, 244 elements -var likelyScript = [244]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, - 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, - 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, - 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, - 22: {lang: 0xdb, region: 0x35}, - 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 28: {lang: 0xf1, region: 0x6b}, - 30: {lang: 0x1a0, region: 0x5d}, - 31: {lang: 0x3e2, region: 0x106}, - 33: {lang: 0x1be, region: 0x99}, - 36: {lang: 0x15e, region: 0x78}, - 39: {lang: 0x133, region: 0x6b}, - 40: {lang: 0x431, region: 0x27}, - 41: {lang: 0x27, region: 0x6f}, - 43: {lang: 0x210, region: 0x7d}, - 44: {lang: 0xfe, region: 0x38}, - 46: {lang: 0x19b, region: 0x99}, - 47: {lang: 0x19e, region: 0x130}, - 48: {lang: 0x3e9, region: 0x99}, - 49: {lang: 0x136, region: 0x87}, - 50: {lang: 0x1a4, region: 0x99}, - 51: {lang: 0x39d, region: 0x99}, - 52: {lang: 0x529, region: 0x12e}, - 53: {lang: 0x254, region: 0xab}, - 54: {lang: 0x529, region: 0x53}, - 55: {lang: 0x1cb, region: 0xe7}, - 56: {lang: 0x529, region: 0x53}, - 57: {lang: 0x529, region: 0x12e}, - 58: {lang: 0x2fd, region: 0x9b}, - 59: {lang: 0x1bc, region: 0x97}, - 60: {lang: 0x200, region: 0xa2}, - 61: {lang: 0x1c5, region: 0x12b}, - 62: {lang: 0x1ca, region: 0xaf}, - 65: {lang: 0x1d5, region: 0x92}, - 67: {lang: 0x142, region: 0x9e}, - 68: {lang: 0x254, region: 0xab}, - 69: {lang: 0x20e, region: 0x95}, - 70: {lang: 0x200, region: 0xa2}, - 72: {lang: 0x135, region: 0xc4}, - 73: {lang: 0x200, region: 0xa2}, - 74: {lang: 0x3bb, region: 0xe8}, - 75: {lang: 0x24a, region: 0xa6}, - 76: {lang: 0x3fa, region: 0x99}, - 79: {lang: 0x251, region: 0x99}, - 80: {lang: 0x254, region: 0xab}, - 82: {lang: 0x88, region: 0x99}, - 83: {lang: 0x370, region: 0x123}, - 84: {lang: 0x2b8, region: 0xaf}, - 89: {lang: 0x29f, region: 0x99}, - 90: {lang: 0x2a8, region: 0x99}, - 91: {lang: 0x28f, region: 0x87}, - 92: {lang: 0x1a0, region: 0x87}, - 93: {lang: 0x2ac, region: 0x53}, - 95: {lang: 0x4f4, region: 0x12b}, - 96: {lang: 0x4f5, region: 0x12b}, - 97: {lang: 0x1be, region: 0x99}, - 99: {lang: 0x337, region: 0x9c}, - 100: {lang: 0x4f7, region: 0x53}, - 101: {lang: 0xa9, region: 0x53}, - 104: {lang: 0x2e8, region: 0x112}, - 105: {lang: 0x4f8, region: 0x10b}, - 106: {lang: 0x4f8, region: 0x10b}, - 107: {lang: 0x304, region: 0x99}, - 108: {lang: 0x31b, region: 0x99}, - 109: {lang: 0x30b, region: 0x53}, - 111: {lang: 0x31e, region: 0x35}, - 112: {lang: 0x30e, region: 0x99}, - 113: {lang: 0x414, region: 0xe8}, - 114: {lang: 0x331, region: 0xc4}, - 115: {lang: 0x4f9, region: 0x108}, - 116: {lang: 0x3b, region: 0xa1}, - 117: {lang: 0x353, region: 0xdb}, - 120: {lang: 0x2d0, region: 0x84}, - 121: {lang: 0x52a, region: 0x53}, - 122: {lang: 0x403, region: 0x96}, - 123: {lang: 0x3ee, region: 0x99}, - 124: {lang: 0x39b, region: 0xc5}, - 125: {lang: 0x395, region: 0x99}, - 126: {lang: 0x399, region: 0x135}, - 127: {lang: 0x429, region: 0x115}, - 128: {lang: 0x3b, region: 0x11c}, - 129: {lang: 0xfd, region: 0xc4}, - 130: {lang: 0x27d, region: 0x106}, - 131: {lang: 0x2c9, region: 0x53}, - 132: {lang: 0x39f, region: 0x9c}, - 133: {lang: 0x39f, region: 0x53}, - 135: {lang: 0x3ad, region: 0xb0}, - 137: {lang: 0x1c6, region: 0x53}, - 138: {lang: 0x4fd, region: 0x9c}, - 189: {lang: 0x3cb, region: 0x95}, - 191: {lang: 0x372, region: 0x10c}, - 192: {lang: 0x420, region: 0x97}, - 194: {lang: 0x4ff, region: 0x15e}, - 195: {lang: 0x3f0, region: 0x99}, - 196: {lang: 0x45, region: 0x135}, - 197: {lang: 0x139, region: 0x7b}, - 198: {lang: 0x3e9, region: 0x99}, - 200: {lang: 0x3e9, region: 0x99}, - 201: {lang: 0x3fa, region: 0x99}, - 202: {lang: 0x40c, region: 0xb3}, - 203: {lang: 0x433, region: 0x99}, - 204: {lang: 0xef, region: 0xc5}, - 205: {lang: 0x43e, region: 0x95}, - 206: {lang: 0x44d, region: 0x35}, - 207: {lang: 0x44e, region: 0x9b}, - 211: {lang: 0x45a, region: 0xe7}, - 212: {lang: 0x11a, region: 0x99}, - 213: {lang: 0x45e, region: 0x53}, - 214: {lang: 0x232, region: 0x53}, - 215: {lang: 0x450, region: 0x99}, - 216: {lang: 0x4a5, region: 0x53}, - 217: {lang: 0x9f, region: 0x13e}, - 218: {lang: 0x461, region: 0x99}, - 220: {lang: 0x528, region: 0xba}, - 221: {lang: 0x153, region: 0xe7}, - 222: {lang: 0x128, region: 0xcd}, - 223: {lang: 0x46b, region: 0x123}, - 224: {lang: 0xa9, region: 0x53}, - 225: {lang: 0x2ce, region: 0x99}, - 226: {lang: 0x4ad, region: 0x11c}, - 227: {lang: 0x4be, region: 0xb4}, - 229: {lang: 0x1ce, region: 0x99}, - 232: {lang: 0x3a9, region: 0x9c}, - 233: {lang: 0x22, region: 0x9b}, - 234: {lang: 0x1ea, region: 0x53}, - 235: {lang: 0xef, region: 0xc5}, -} - -type likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 5320 bytes, 1330 elements -var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x57, flags: 0x0}, - 1: {region: 0x6f, script: 0x57, flags: 0x0}, - 2: {region: 0x165, script: 0x57, flags: 0x0}, - 3: {region: 0x165, script: 0x57, flags: 0x0}, - 4: {region: 0x165, script: 0x57, flags: 0x0}, - 5: {region: 0x7d, script: 0x1f, flags: 0x0}, - 6: {region: 0x165, script: 0x57, flags: 0x0}, - 7: {region: 0x165, script: 0x1f, flags: 0x0}, - 8: {region: 0x80, script: 0x57, flags: 0x0}, - 9: {region: 0x165, script: 0x57, flags: 0x0}, - 10: {region: 0x165, script: 0x57, flags: 0x0}, - 11: {region: 0x165, script: 0x57, flags: 0x0}, - 12: {region: 0x95, script: 0x57, flags: 0x0}, - 13: {region: 0x131, script: 0x57, flags: 0x0}, - 14: {region: 0x80, script: 0x57, flags: 0x0}, - 15: {region: 0x165, script: 0x57, flags: 0x0}, - 16: {region: 0x165, script: 0x57, flags: 0x0}, - 17: {region: 0x106, script: 0x1f, flags: 0x0}, - 18: {region: 0x165, script: 0x57, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x57, flags: 0x0}, - 22: {region: 0x161, script: 0x57, flags: 0x0}, - 23: {region: 0x165, script: 0x57, flags: 0x0}, - 24: {region: 0x165, script: 0x57, flags: 0x0}, - 25: {region: 0x165, script: 0x57, flags: 0x0}, - 26: {region: 0x165, script: 0x57, flags: 0x0}, - 27: {region: 0x165, script: 0x57, flags: 0x0}, - 28: {region: 0x52, script: 0x57, flags: 0x0}, - 29: {region: 0x165, script: 0x57, flags: 0x0}, - 30: {region: 0x165, script: 0x57, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x57, flags: 0x0}, - 33: {region: 0x80, script: 0x57, flags: 0x0}, - 34: {region: 0x9b, script: 0xe9, flags: 0x0}, - 35: {region: 0x165, script: 0x57, flags: 0x0}, - 36: {region: 0x165, script: 0x57, flags: 0x0}, - 37: {region: 0x14d, script: 0x57, flags: 0x0}, - 38: {region: 0x106, script: 0x1f, flags: 0x0}, - 39: {region: 0x6f, script: 0x29, flags: 0x0}, - 40: {region: 0x165, script: 0x57, flags: 0x0}, - 41: {region: 0x165, script: 0x57, flags: 0x0}, - 42: {region: 0xd6, script: 0x57, flags: 0x0}, - 43: {region: 0x165, script: 0x57, flags: 0x0}, - 45: {region: 0x165, script: 0x57, flags: 0x0}, - 46: {region: 0x165, script: 0x57, flags: 0x0}, - 47: {region: 0x165, script: 0x57, flags: 0x0}, - 48: {region: 0x165, script: 0x57, flags: 0x0}, - 49: {region: 0x165, script: 0x57, flags: 0x0}, - 50: {region: 0x165, script: 0x57, flags: 0x0}, - 51: {region: 0x95, script: 0x57, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x57, flags: 0x0}, - 55: {region: 0x165, script: 0x57, flags: 0x0}, - 56: {region: 0x165, script: 0x57, flags: 0x0}, - 57: {region: 0x165, script: 0x57, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x57, flags: 0x0}, - 61: {region: 0x51, script: 0x57, flags: 0x0}, - 62: {region: 0x3f, script: 0x57, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x57, flags: 0x0}, - 69: {region: 0x135, script: 0xc4, flags: 0x0}, - 70: {region: 0x165, script: 0x57, flags: 0x0}, - 71: {region: 0x165, script: 0x57, flags: 0x0}, - 72: {region: 0x6e, script: 0x57, flags: 0x0}, - 73: {region: 0x165, script: 0x57, flags: 0x0}, - 74: {region: 0x165, script: 0x57, flags: 0x0}, - 75: {region: 0x49, script: 0x57, flags: 0x0}, - 76: {region: 0x165, script: 0x57, flags: 0x0}, - 77: {region: 0x106, script: 0x1f, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x57, flags: 0x0}, - 80: {region: 0x165, script: 0x57, flags: 0x0}, - 81: {region: 0x165, script: 0x57, flags: 0x0}, - 82: {region: 0x99, script: 0x21, flags: 0x0}, - 83: {region: 0x165, script: 0x57, flags: 0x0}, - 84: {region: 0x165, script: 0x57, flags: 0x0}, - 85: {region: 0x165, script: 0x57, flags: 0x0}, - 86: {region: 0x3f, script: 0x57, flags: 0x0}, - 87: {region: 0x165, script: 0x57, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x1f, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x57, flags: 0x0}, - 92: {region: 0xdb, script: 0x21, flags: 0x0}, - 93: {region: 0x2e, script: 0x57, flags: 0x0}, - 94: {region: 0x52, script: 0x57, flags: 0x0}, - 95: {region: 0x165, script: 0x57, flags: 0x0}, - 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x57, flags: 0x0}, - 98: {region: 0x165, script: 0x57, flags: 0x0}, - 99: {region: 0x95, script: 0x57, flags: 0x0}, - 100: {region: 0x165, script: 0x57, flags: 0x0}, - 101: {region: 0x52, script: 0x57, flags: 0x0}, - 102: {region: 0x165, script: 0x57, flags: 0x0}, - 103: {region: 0x165, script: 0x57, flags: 0x0}, - 104: {region: 0x165, script: 0x57, flags: 0x0}, - 105: {region: 0x165, script: 0x57, flags: 0x0}, - 106: {region: 0x4f, script: 0x57, flags: 0x0}, - 107: {region: 0x165, script: 0x57, flags: 0x0}, - 108: {region: 0x165, script: 0x57, flags: 0x0}, - 109: {region: 0x165, script: 0x57, flags: 0x0}, - 110: {region: 0x165, script: 0x29, flags: 0x0}, - 111: {region: 0x165, script: 0x57, flags: 0x0}, - 112: {region: 0x165, script: 0x57, flags: 0x0}, - 113: {region: 0x47, script: 0x1f, flags: 0x0}, - 114: {region: 0x165, script: 0x57, flags: 0x0}, - 115: {region: 0x165, script: 0x57, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x57, flags: 0x0}, - 118: {region: 0x165, script: 0x57, flags: 0x0}, - 119: {region: 0x95, script: 0x57, flags: 0x0}, - 120: {region: 0x165, script: 0x57, flags: 0x0}, - 121: {region: 0x12f, script: 0x57, flags: 0x0}, - 122: {region: 0x52, script: 0x57, flags: 0x0}, - 123: {region: 0x99, script: 0xd7, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x21, flags: 0x0}, - 126: {region: 0x38, script: 0x1f, flags: 0x0}, - 127: {region: 0x99, script: 0x21, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x31, flags: 0x0}, - 131: {region: 0x99, script: 0x21, flags: 0x0}, - 132: {region: 0x165, script: 0x57, flags: 0x0}, - 133: {region: 0x99, script: 0x21, flags: 0x0}, - 134: {region: 0xe7, script: 0x57, flags: 0x0}, - 135: {region: 0x165, script: 0x57, flags: 0x0}, - 136: {region: 0x99, script: 0x21, flags: 0x0}, - 137: {region: 0x165, script: 0x57, flags: 0x0}, - 138: {region: 0x13f, script: 0x57, flags: 0x0}, - 139: {region: 0x165, script: 0x57, flags: 0x0}, - 140: {region: 0x165, script: 0x57, flags: 0x0}, - 141: {region: 0xe7, script: 0x57, flags: 0x0}, - 142: {region: 0x165, script: 0x57, flags: 0x0}, - 143: {region: 0xd6, script: 0x57, flags: 0x0}, - 144: {region: 0x165, script: 0x57, flags: 0x0}, - 145: {region: 0x165, script: 0x57, flags: 0x0}, - 146: {region: 0x165, script: 0x57, flags: 0x0}, - 147: {region: 0x165, script: 0x29, flags: 0x0}, - 148: {region: 0x99, script: 0x21, flags: 0x0}, - 149: {region: 0x95, script: 0x57, flags: 0x0}, - 150: {region: 0x165, script: 0x57, flags: 0x0}, - 151: {region: 0x165, script: 0x57, flags: 0x0}, - 152: {region: 0x114, script: 0x57, flags: 0x0}, - 153: {region: 0x165, script: 0x57, flags: 0x0}, - 154: {region: 0x165, script: 0x57, flags: 0x0}, - 155: {region: 0x52, script: 0x57, flags: 0x0}, - 156: {region: 0x165, script: 0x57, flags: 0x0}, - 157: {region: 0xe7, script: 0x57, flags: 0x0}, - 158: {region: 0x165, script: 0x57, flags: 0x0}, - 159: {region: 0x13e, script: 0xd9, flags: 0x0}, - 160: {region: 0xc3, script: 0x57, flags: 0x0}, - 161: {region: 0x165, script: 0x57, flags: 0x0}, - 162: {region: 0x165, script: 0x57, flags: 0x0}, - 163: {region: 0xc3, script: 0x57, flags: 0x0}, - 164: {region: 0x165, script: 0x57, flags: 0x0}, - 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x57, flags: 0x0}, - 167: {region: 0x165, script: 0x57, flags: 0x0}, - 168: {region: 0x165, script: 0x57, flags: 0x0}, - 169: {region: 0x53, script: 0xe0, flags: 0x0}, - 170: {region: 0x165, script: 0x57, flags: 0x0}, - 171: {region: 0x165, script: 0x57, flags: 0x0}, - 172: {region: 0x165, script: 0x57, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x57, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x57, flags: 0x0}, - 177: {region: 0x4f, script: 0x57, flags: 0x0}, - 178: {region: 0x78, script: 0x57, flags: 0x0}, - 179: {region: 0x99, script: 0x21, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x21, flags: 0x0}, - 182: {region: 0x165, script: 0x57, flags: 0x0}, - 183: {region: 0x33, script: 0x57, flags: 0x0}, - 184: {region: 0x165, script: 0x57, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x57, flags: 0x0}, - 187: {region: 0x165, script: 0x29, flags: 0x0}, - 188: {region: 0xe7, script: 0x57, flags: 0x0}, - 189: {region: 0x165, script: 0x57, flags: 0x0}, - 190: {region: 0xe8, script: 0x21, flags: 0x0}, - 191: {region: 0x106, script: 0x1f, flags: 0x0}, - 192: {region: 0x15f, script: 0x57, flags: 0x0}, - 193: {region: 0x165, script: 0x57, flags: 0x0}, - 194: {region: 0x95, script: 0x57, flags: 0x0}, - 195: {region: 0x165, script: 0x57, flags: 0x0}, - 196: {region: 0x52, script: 0x57, flags: 0x0}, - 197: {region: 0x165, script: 0x57, flags: 0x0}, - 198: {region: 0x165, script: 0x57, flags: 0x0}, - 199: {region: 0x165, script: 0x57, flags: 0x0}, - 200: {region: 0x86, script: 0x57, flags: 0x0}, - 201: {region: 0x165, script: 0x57, flags: 0x0}, - 202: {region: 0x165, script: 0x57, flags: 0x0}, - 203: {region: 0x165, script: 0x57, flags: 0x0}, - 204: {region: 0x165, script: 0x57, flags: 0x0}, - 205: {region: 0x6d, script: 0x29, flags: 0x0}, - 206: {region: 0x165, script: 0x57, flags: 0x0}, - 207: {region: 0x165, script: 0x57, flags: 0x0}, - 208: {region: 0x52, script: 0x57, flags: 0x0}, - 209: {region: 0x165, script: 0x57, flags: 0x0}, - 210: {region: 0x165, script: 0x57, flags: 0x0}, - 211: {region: 0xc3, script: 0x57, flags: 0x0}, - 212: {region: 0x165, script: 0x57, flags: 0x0}, - 213: {region: 0x165, script: 0x57, flags: 0x0}, - 214: {region: 0x165, script: 0x57, flags: 0x0}, - 215: {region: 0x6e, script: 0x57, flags: 0x0}, - 216: {region: 0x165, script: 0x57, flags: 0x0}, - 217: {region: 0x165, script: 0x57, flags: 0x0}, - 218: {region: 0xd6, script: 0x57, flags: 0x0}, - 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x1f, flags: 0x0}, - 221: {region: 0xe7, script: 0x57, flags: 0x0}, - 222: {region: 0x165, script: 0x57, flags: 0x0}, - 223: {region: 0x131, script: 0x57, flags: 0x0}, - 224: {region: 0x8a, script: 0x57, flags: 0x0}, - 225: {region: 0x75, script: 0x57, flags: 0x0}, - 226: {region: 0x106, script: 0x1f, flags: 0x0}, - 227: {region: 0x135, script: 0x57, flags: 0x0}, - 228: {region: 0x49, script: 0x57, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x57, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x57, flags: 0x0}, - 235: {region: 0x165, script: 0x57, flags: 0x0}, - 236: {region: 0x165, script: 0x57, flags: 0x0}, - 237: {region: 0x165, script: 0x57, flags: 0x0}, - 238: {region: 0x165, script: 0x57, flags: 0x0}, - 239: {region: 0xc5, script: 0xcc, flags: 0x0}, - 240: {region: 0x78, script: 0x57, flags: 0x0}, - 241: {region: 0x6b, script: 0x1c, flags: 0x0}, - 242: {region: 0xe7, script: 0x57, flags: 0x0}, - 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x1f, flags: 0x0}, - 245: {region: 0x49, script: 0x17, flags: 0x0}, - 246: {region: 0x49, script: 0x17, flags: 0x0}, - 247: {region: 0x49, script: 0x17, flags: 0x0}, - 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x57, flags: 0x0}, - 250: {region: 0x5e, script: 0x57, flags: 0x0}, - 251: {region: 0xe9, script: 0x57, flags: 0x0}, - 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x81, flags: 0x0}, - 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x1f, flags: 0x0}, - 256: {region: 0x7b, script: 0x57, flags: 0x0}, - 257: {region: 0x63, script: 0x57, flags: 0x0}, - 258: {region: 0x165, script: 0x57, flags: 0x0}, - 259: {region: 0x165, script: 0x57, flags: 0x0}, - 260: {region: 0x165, script: 0x57, flags: 0x0}, - 261: {region: 0x165, script: 0x57, flags: 0x0}, - 262: {region: 0x135, script: 0x57, flags: 0x0}, - 263: {region: 0x106, script: 0x1f, flags: 0x0}, - 264: {region: 0xa4, script: 0x57, flags: 0x0}, - 265: {region: 0x165, script: 0x57, flags: 0x0}, - 266: {region: 0x165, script: 0x57, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x57, flags: 0x0}, - 269: {region: 0x60, script: 0x57, flags: 0x0}, - 270: {region: 0x165, script: 0x57, flags: 0x0}, - 271: {region: 0x49, script: 0x57, flags: 0x0}, - 272: {region: 0x165, script: 0x57, flags: 0x0}, - 273: {region: 0x165, script: 0x57, flags: 0x0}, - 274: {region: 0x165, script: 0x57, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x57, flags: 0x0}, - 277: {region: 0x165, script: 0x57, flags: 0x0}, - 278: {region: 0x165, script: 0x57, flags: 0x0}, - 279: {region: 0xd4, script: 0x57, flags: 0x0}, - 280: {region: 0x4f, script: 0x57, flags: 0x0}, - 281: {region: 0x165, script: 0x57, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x57, flags: 0x0}, - 284: {region: 0x165, script: 0x57, flags: 0x0}, - 285: {region: 0x165, script: 0x57, flags: 0x0}, - 286: {region: 0x165, script: 0x29, flags: 0x0}, - 287: {region: 0x60, script: 0x57, flags: 0x0}, - 288: {region: 0xc3, script: 0x57, flags: 0x0}, - 289: {region: 0xd0, script: 0x57, flags: 0x0}, - 290: {region: 0x165, script: 0x57, flags: 0x0}, - 291: {region: 0xdb, script: 0x21, flags: 0x0}, - 292: {region: 0x52, script: 0x57, flags: 0x0}, - 293: {region: 0x165, script: 0x57, flags: 0x0}, - 294: {region: 0x165, script: 0x57, flags: 0x0}, - 295: {region: 0x165, script: 0x57, flags: 0x0}, - 296: {region: 0xcd, script: 0xde, flags: 0x0}, - 297: {region: 0x165, script: 0x57, flags: 0x0}, - 298: {region: 0x165, script: 0x57, flags: 0x0}, - 299: {region: 0x114, script: 0x57, flags: 0x0}, - 300: {region: 0x37, script: 0x57, flags: 0x0}, - 301: {region: 0x43, script: 0xe0, flags: 0x0}, - 302: {region: 0x165, script: 0x57, flags: 0x0}, - 303: {region: 0xa4, script: 0x57, flags: 0x0}, - 304: {region: 0x80, script: 0x57, flags: 0x0}, - 305: {region: 0xd6, script: 0x57, flags: 0x0}, - 306: {region: 0x9e, script: 0x57, flags: 0x0}, - 307: {region: 0x6b, script: 0x27, flags: 0x0}, - 308: {region: 0x165, script: 0x57, flags: 0x0}, - 309: {region: 0xc4, script: 0x48, flags: 0x0}, - 310: {region: 0x87, script: 0x31, flags: 0x0}, - 311: {region: 0x165, script: 0x57, flags: 0x0}, - 312: {region: 0x165, script: 0x57, flags: 0x0}, - 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x57, flags: 0x0}, - 315: {region: 0x165, script: 0x57, flags: 0x0}, - 316: {region: 0x1, script: 0x57, flags: 0x0}, - 317: {region: 0x165, script: 0x57, flags: 0x0}, - 318: {region: 0x6e, script: 0x57, flags: 0x0}, - 319: {region: 0x135, script: 0x57, flags: 0x0}, - 320: {region: 0x6a, script: 0x57, flags: 0x0}, - 321: {region: 0x165, script: 0x57, flags: 0x0}, - 322: {region: 0x9e, script: 0x43, flags: 0x0}, - 323: {region: 0x165, script: 0x57, flags: 0x0}, - 324: {region: 0x165, script: 0x57, flags: 0x0}, - 325: {region: 0x6e, script: 0x57, flags: 0x0}, - 326: {region: 0x52, script: 0x57, flags: 0x0}, - 327: {region: 0x6e, script: 0x57, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x57, flags: 0x0}, - 330: {region: 0x165, script: 0x57, flags: 0x0}, - 331: {region: 0x165, script: 0x57, flags: 0x0}, - 332: {region: 0x165, script: 0x57, flags: 0x0}, - 333: {region: 0x86, script: 0x57, flags: 0x0}, - 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x57, flags: 0x0}, - 336: {region: 0xc3, script: 0x57, flags: 0x0}, - 337: {region: 0x72, script: 0x57, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x57, flags: 0x0}, - 340: {region: 0x10c, script: 0x57, flags: 0x0}, - 341: {region: 0x73, script: 0x57, flags: 0x0}, - 342: {region: 0x165, script: 0x57, flags: 0x0}, - 343: {region: 0x165, script: 0x57, flags: 0x0}, - 344: {region: 0x76, script: 0x57, flags: 0x0}, - 345: {region: 0x165, script: 0x57, flags: 0x0}, - 346: {region: 0x3b, script: 0x57, flags: 0x0}, - 347: {region: 0x165, script: 0x57, flags: 0x0}, - 348: {region: 0x165, script: 0x57, flags: 0x0}, - 349: {region: 0x165, script: 0x57, flags: 0x0}, - 350: {region: 0x78, script: 0x57, flags: 0x0}, - 351: {region: 0x135, script: 0x57, flags: 0x0}, - 352: {region: 0x78, script: 0x57, flags: 0x0}, - 353: {region: 0x60, script: 0x57, flags: 0x0}, - 354: {region: 0x60, script: 0x57, flags: 0x0}, - 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x57, flags: 0x0}, - 357: {region: 0x165, script: 0x57, flags: 0x0}, - 358: {region: 0x84, script: 0x57, flags: 0x0}, - 359: {region: 0x165, script: 0x57, flags: 0x0}, - 360: {region: 0xd4, script: 0x57, flags: 0x0}, - 361: {region: 0x9e, script: 0x57, flags: 0x0}, - 362: {region: 0xd6, script: 0x57, flags: 0x0}, - 363: {region: 0x165, script: 0x57, flags: 0x0}, - 364: {region: 0x10b, script: 0x57, flags: 0x0}, - 365: {region: 0xd9, script: 0x57, flags: 0x0}, - 366: {region: 0x96, script: 0x57, flags: 0x0}, - 367: {region: 0x80, script: 0x57, flags: 0x0}, - 368: {region: 0x165, script: 0x57, flags: 0x0}, - 369: {region: 0xbc, script: 0x57, flags: 0x0}, - 370: {region: 0x165, script: 0x57, flags: 0x0}, - 371: {region: 0x165, script: 0x57, flags: 0x0}, - 372: {region: 0x165, script: 0x57, flags: 0x0}, - 373: {region: 0x53, script: 0x38, flags: 0x0}, - 374: {region: 0x165, script: 0x57, flags: 0x0}, - 375: {region: 0x95, script: 0x57, flags: 0x0}, - 376: {region: 0x165, script: 0x57, flags: 0x0}, - 377: {region: 0x165, script: 0x57, flags: 0x0}, - 378: {region: 0x99, script: 0x21, flags: 0x0}, - 379: {region: 0x165, script: 0x57, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x57, flags: 0x0}, - 382: {region: 0x7b, script: 0x57, flags: 0x0}, - 383: {region: 0x165, script: 0x57, flags: 0x0}, - 384: {region: 0x165, script: 0x57, flags: 0x0}, - 385: {region: 0x165, script: 0x57, flags: 0x0}, - 386: {region: 0x165, script: 0x57, flags: 0x0}, - 387: {region: 0x165, script: 0x57, flags: 0x0}, - 388: {region: 0x165, script: 0x57, flags: 0x0}, - 389: {region: 0x6f, script: 0x29, flags: 0x0}, - 390: {region: 0x165, script: 0x57, flags: 0x0}, - 391: {region: 0xdb, script: 0x21, flags: 0x0}, - 392: {region: 0x165, script: 0x57, flags: 0x0}, - 393: {region: 0xa7, script: 0x57, flags: 0x0}, - 394: {region: 0x165, script: 0x57, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x57, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x57, flags: 0x0}, - 399: {region: 0x165, script: 0x57, flags: 0x0}, - 400: {region: 0x6e, script: 0x57, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x57, flags: 0x0}, - 403: {region: 0x165, script: 0x29, flags: 0x0}, - 404: {region: 0xf1, script: 0x57, flags: 0x0}, - 405: {region: 0x165, script: 0x57, flags: 0x0}, - 406: {region: 0x165, script: 0x57, flags: 0x0}, - 407: {region: 0x165, script: 0x57, flags: 0x0}, - 408: {region: 0x165, script: 0x29, flags: 0x0}, - 409: {region: 0x165, script: 0x57, flags: 0x0}, - 410: {region: 0x99, script: 0x21, flags: 0x0}, - 411: {region: 0x99, script: 0xda, flags: 0x0}, - 412: {region: 0x95, script: 0x57, flags: 0x0}, - 413: {region: 0xd9, script: 0x57, flags: 0x0}, - 414: {region: 0x130, script: 0x2f, flags: 0x0}, - 415: {region: 0x165, script: 0x57, flags: 0x0}, - 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x57, flags: 0x0}, - 419: {region: 0x4e, script: 0x57, flags: 0x0}, - 420: {region: 0x99, script: 0x32, flags: 0x0}, - 421: {region: 0x41, script: 0x57, flags: 0x0}, - 422: {region: 0x54, script: 0x57, flags: 0x0}, - 423: {region: 0x165, script: 0x57, flags: 0x0}, - 424: {region: 0x80, script: 0x57, flags: 0x0}, - 425: {region: 0x165, script: 0x57, flags: 0x0}, - 426: {region: 0x165, script: 0x57, flags: 0x0}, - 427: {region: 0xa4, script: 0x57, flags: 0x0}, - 428: {region: 0x98, script: 0x57, flags: 0x0}, - 429: {region: 0x165, script: 0x57, flags: 0x0}, - 430: {region: 0xdb, script: 0x21, flags: 0x0}, - 431: {region: 0x165, script: 0x57, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x57, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x57, flags: 0x0}, - 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x57, flags: 0x0}, - 438: {region: 0x53, script: 0x38, flags: 0x0}, - 439: {region: 0x165, script: 0x57, flags: 0x0}, - 440: {region: 0x135, script: 0x57, flags: 0x0}, - 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x57, flags: 0x0}, - 443: {region: 0x165, script: 0x29, flags: 0x0}, - 444: {region: 0x97, script: 0x3b, flags: 0x0}, - 445: {region: 0x165, script: 0x57, flags: 0x0}, - 446: {region: 0x99, script: 0x21, flags: 0x0}, - 447: {region: 0x165, script: 0x57, flags: 0x0}, - 448: {region: 0x73, script: 0x57, flags: 0x0}, - 449: {region: 0x165, script: 0x57, flags: 0x0}, - 450: {region: 0x165, script: 0x57, flags: 0x0}, - 451: {region: 0xe7, script: 0x57, flags: 0x0}, - 452: {region: 0x165, script: 0x57, flags: 0x0}, - 453: {region: 0x12b, script: 0x3d, flags: 0x0}, - 454: {region: 0x53, script: 0x89, flags: 0x0}, - 455: {region: 0x165, script: 0x57, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x21, flags: 0x0}, - 458: {region: 0xaf, script: 0x3e, flags: 0x0}, - 459: {region: 0xe7, script: 0x57, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x57, flags: 0x0}, - 462: {region: 0x99, script: 0x21, flags: 0x0}, - 463: {region: 0x99, script: 0x21, flags: 0x0}, - 464: {region: 0x165, script: 0x57, flags: 0x0}, - 465: {region: 0x90, script: 0x57, flags: 0x0}, - 466: {region: 0x60, script: 0x57, flags: 0x0}, - 467: {region: 0x53, script: 0x38, flags: 0x0}, - 468: {region: 0x91, script: 0x57, flags: 0x0}, - 469: {region: 0x92, script: 0x57, flags: 0x0}, - 470: {region: 0x165, script: 0x57, flags: 0x0}, - 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x57, flags: 0x0}, - 473: {region: 0x78, script: 0x57, flags: 0x0}, - 474: {region: 0x165, script: 0x57, flags: 0x0}, - 475: {region: 0x165, script: 0x57, flags: 0x0}, - 476: {region: 0xd0, script: 0x57, flags: 0x0}, - 477: {region: 0xd6, script: 0x57, flags: 0x0}, - 478: {region: 0x165, script: 0x57, flags: 0x0}, - 479: {region: 0x165, script: 0x57, flags: 0x0}, - 480: {region: 0x165, script: 0x57, flags: 0x0}, - 481: {region: 0x95, script: 0x57, flags: 0x0}, - 482: {region: 0x165, script: 0x57, flags: 0x0}, - 483: {region: 0x165, script: 0x57, flags: 0x0}, - 484: {region: 0x165, script: 0x57, flags: 0x0}, - 486: {region: 0x122, script: 0x57, flags: 0x0}, - 487: {region: 0xd6, script: 0x57, flags: 0x0}, - 488: {region: 0x165, script: 0x57, flags: 0x0}, - 489: {region: 0x165, script: 0x57, flags: 0x0}, - 490: {region: 0x53, script: 0xea, flags: 0x0}, - 491: {region: 0x165, script: 0x57, flags: 0x0}, - 492: {region: 0x135, script: 0x57, flags: 0x0}, - 493: {region: 0x165, script: 0x57, flags: 0x0}, - 494: {region: 0x49, script: 0x57, flags: 0x0}, - 495: {region: 0x165, script: 0x57, flags: 0x0}, - 496: {region: 0x165, script: 0x57, flags: 0x0}, - 497: {region: 0xe7, script: 0x57, flags: 0x0}, - 498: {region: 0x165, script: 0x57, flags: 0x0}, - 499: {region: 0x95, script: 0x57, flags: 0x0}, - 500: {region: 0x106, script: 0x1f, flags: 0x0}, - 501: {region: 0x1, script: 0x57, flags: 0x0}, - 502: {region: 0x165, script: 0x57, flags: 0x0}, - 503: {region: 0x165, script: 0x57, flags: 0x0}, - 504: {region: 0x9d, script: 0x57, flags: 0x0}, - 505: {region: 0x9e, script: 0x57, flags: 0x0}, - 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3b, flags: 0x0}, - 508: {region: 0x165, script: 0x57, flags: 0x0}, - 509: {region: 0x165, script: 0x57, flags: 0x0}, - 510: {region: 0x106, script: 0x57, flags: 0x0}, - 511: {region: 0x165, script: 0x57, flags: 0x0}, - 512: {region: 0xa2, script: 0x46, flags: 0x0}, - 513: {region: 0x165, script: 0x57, flags: 0x0}, - 514: {region: 0xa0, script: 0x57, flags: 0x0}, - 515: {region: 0x1, script: 0x57, flags: 0x0}, - 516: {region: 0x165, script: 0x57, flags: 0x0}, - 517: {region: 0x165, script: 0x57, flags: 0x0}, - 518: {region: 0x165, script: 0x57, flags: 0x0}, - 519: {region: 0x52, script: 0x57, flags: 0x0}, - 520: {region: 0x130, script: 0x3b, flags: 0x0}, - 521: {region: 0x165, script: 0x57, flags: 0x0}, - 522: {region: 0x12f, script: 0x57, flags: 0x0}, - 523: {region: 0xdb, script: 0x21, flags: 0x0}, - 524: {region: 0x165, script: 0x57, flags: 0x0}, - 525: {region: 0x63, script: 0x57, flags: 0x0}, - 526: {region: 0x95, script: 0x57, flags: 0x0}, - 527: {region: 0x95, script: 0x57, flags: 0x0}, - 528: {region: 0x7d, script: 0x2b, flags: 0x0}, - 529: {region: 0x137, script: 0x1f, flags: 0x0}, - 530: {region: 0x67, script: 0x57, flags: 0x0}, - 531: {region: 0xc4, script: 0x57, flags: 0x0}, - 532: {region: 0x165, script: 0x57, flags: 0x0}, - 533: {region: 0x165, script: 0x57, flags: 0x0}, - 534: {region: 0xd6, script: 0x57, flags: 0x0}, - 535: {region: 0xa4, script: 0x57, flags: 0x0}, - 536: {region: 0xc3, script: 0x57, flags: 0x0}, - 537: {region: 0x106, script: 0x1f, flags: 0x0}, - 538: {region: 0x165, script: 0x57, flags: 0x0}, - 539: {region: 0x165, script: 0x57, flags: 0x0}, - 540: {region: 0x165, script: 0x57, flags: 0x0}, - 541: {region: 0x165, script: 0x57, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x57, flags: 0x0}, - 544: {region: 0x164, script: 0x57, flags: 0x0}, - 545: {region: 0x165, script: 0x57, flags: 0x0}, - 546: {region: 0x165, script: 0x57, flags: 0x0}, - 547: {region: 0x12f, script: 0x57, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x57, flags: 0x0}, - 550: {region: 0x123, script: 0xdf, flags: 0x0}, - 551: {region: 0x5a, script: 0x57, flags: 0x0}, - 552: {region: 0x52, script: 0x57, flags: 0x0}, - 553: {region: 0x165, script: 0x57, flags: 0x0}, - 554: {region: 0x4f, script: 0x57, flags: 0x0}, - 555: {region: 0x99, script: 0x21, flags: 0x0}, - 556: {region: 0x99, script: 0x21, flags: 0x0}, - 557: {region: 0x4b, script: 0x57, flags: 0x0}, - 558: {region: 0x95, script: 0x57, flags: 0x0}, - 559: {region: 0x165, script: 0x57, flags: 0x0}, - 560: {region: 0x41, script: 0x57, flags: 0x0}, - 561: {region: 0x99, script: 0x57, flags: 0x0}, - 562: {region: 0x53, script: 0xd6, flags: 0x0}, - 563: {region: 0x99, script: 0x21, flags: 0x0}, - 564: {region: 0xc3, script: 0x57, flags: 0x0}, - 565: {region: 0x165, script: 0x57, flags: 0x0}, - 566: {region: 0x99, script: 0x72, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x57, flags: 0x0}, - 569: {region: 0xa4, script: 0x57, flags: 0x0}, - 570: {region: 0x165, script: 0x57, flags: 0x0}, - 571: {region: 0x12b, script: 0x57, flags: 0x0}, - 572: {region: 0x165, script: 0x57, flags: 0x0}, - 573: {region: 0xd2, script: 0x57, flags: 0x0}, - 574: {region: 0x165, script: 0x57, flags: 0x0}, - 575: {region: 0xaf, script: 0x54, flags: 0x0}, - 576: {region: 0x165, script: 0x57, flags: 0x0}, - 577: {region: 0x165, script: 0x57, flags: 0x0}, - 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x57, flags: 0x0}, - 580: {region: 0x52, script: 0x57, flags: 0x0}, - 581: {region: 0x82, script: 0x57, flags: 0x0}, - 582: {region: 0xa4, script: 0x57, flags: 0x0}, - 583: {region: 0x165, script: 0x57, flags: 0x0}, - 584: {region: 0x165, script: 0x57, flags: 0x0}, - 585: {region: 0x165, script: 0x57, flags: 0x0}, - 586: {region: 0xa6, script: 0x4b, flags: 0x0}, - 587: {region: 0x2a, script: 0x57, flags: 0x0}, - 588: {region: 0x165, script: 0x57, flags: 0x0}, - 589: {region: 0x165, script: 0x57, flags: 0x0}, - 590: {region: 0x165, script: 0x57, flags: 0x0}, - 591: {region: 0x165, script: 0x57, flags: 0x0}, - 592: {region: 0x165, script: 0x57, flags: 0x0}, - 593: {region: 0x99, script: 0x4f, flags: 0x0}, - 594: {region: 0x8b, script: 0x57, flags: 0x0}, - 595: {region: 0x165, script: 0x57, flags: 0x0}, - 596: {region: 0xab, script: 0x50, flags: 0x0}, - 597: {region: 0x106, script: 0x1f, flags: 0x0}, - 598: {region: 0x99, script: 0x21, flags: 0x0}, - 599: {region: 0x165, script: 0x57, flags: 0x0}, - 600: {region: 0x75, script: 0x57, flags: 0x0}, - 601: {region: 0x165, script: 0x57, flags: 0x0}, - 602: {region: 0xb4, script: 0x57, flags: 0x0}, - 603: {region: 0x165, script: 0x57, flags: 0x0}, - 604: {region: 0x165, script: 0x57, flags: 0x0}, - 605: {region: 0x165, script: 0x57, flags: 0x0}, - 606: {region: 0x165, script: 0x57, flags: 0x0}, - 607: {region: 0x165, script: 0x57, flags: 0x0}, - 608: {region: 0x165, script: 0x57, flags: 0x0}, - 609: {region: 0x165, script: 0x57, flags: 0x0}, - 610: {region: 0x165, script: 0x29, flags: 0x0}, - 611: {region: 0x165, script: 0x57, flags: 0x0}, - 612: {region: 0x106, script: 0x1f, flags: 0x0}, - 613: {region: 0x112, script: 0x57, flags: 0x0}, - 614: {region: 0xe7, script: 0x57, flags: 0x0}, - 615: {region: 0x106, script: 0x57, flags: 0x0}, - 616: {region: 0x165, script: 0x57, flags: 0x0}, - 617: {region: 0x99, script: 0x21, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x57, flags: 0x0}, - 620: {region: 0x165, script: 0x57, flags: 0x0}, - 621: {region: 0x52, script: 0x57, flags: 0x0}, - 622: {region: 0x60, script: 0x57, flags: 0x0}, - 623: {region: 0x165, script: 0x57, flags: 0x0}, - 624: {region: 0x165, script: 0x57, flags: 0x0}, - 625: {region: 0x165, script: 0x29, flags: 0x0}, - 626: {region: 0x165, script: 0x57, flags: 0x0}, - 627: {region: 0x165, script: 0x57, flags: 0x0}, - 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x57, flags: 0x0}, - 630: {region: 0x165, script: 0x57, flags: 0x0}, - 631: {region: 0x165, script: 0x57, flags: 0x0}, - 632: {region: 0x165, script: 0x57, flags: 0x0}, - 633: {region: 0x106, script: 0x1f, flags: 0x0}, - 634: {region: 0x165, script: 0x57, flags: 0x0}, - 635: {region: 0x165, script: 0x57, flags: 0x0}, - 636: {region: 0x165, script: 0x57, flags: 0x0}, - 637: {region: 0x106, script: 0x1f, flags: 0x0}, - 638: {region: 0x165, script: 0x57, flags: 0x0}, - 639: {region: 0x95, script: 0x57, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x57, flags: 0x0}, - 642: {region: 0x165, script: 0x57, flags: 0x0}, - 643: {region: 0x165, script: 0x57, flags: 0x0}, - 644: {region: 0x165, script: 0x57, flags: 0x0}, - 645: {region: 0x165, script: 0x29, flags: 0x0}, - 646: {region: 0x123, script: 0xdf, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x57, flags: 0x0}, - 649: {region: 0x165, script: 0x57, flags: 0x0}, - 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x57, flags: 0x0}, - 652: {region: 0x165, script: 0x57, flags: 0x0}, - 653: {region: 0x165, script: 0x57, flags: 0x0}, - 654: {region: 0x138, script: 0x57, flags: 0x0}, - 655: {region: 0x87, script: 0x5b, flags: 0x0}, - 656: {region: 0x97, script: 0x3b, flags: 0x0}, - 657: {region: 0x12f, script: 0x57, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x57, flags: 0x0}, - 660: {region: 0x165, script: 0x57, flags: 0x0}, - 661: {region: 0xb7, script: 0x57, flags: 0x0}, - 662: {region: 0x106, script: 0x1f, flags: 0x0}, - 663: {region: 0x165, script: 0x57, flags: 0x0}, - 664: {region: 0x95, script: 0x57, flags: 0x0}, - 665: {region: 0x165, script: 0x57, flags: 0x0}, - 666: {region: 0x53, script: 0xdf, flags: 0x0}, - 667: {region: 0x165, script: 0x57, flags: 0x0}, - 668: {region: 0x165, script: 0x57, flags: 0x0}, - 669: {region: 0x165, script: 0x57, flags: 0x0}, - 670: {region: 0x165, script: 0x57, flags: 0x0}, - 671: {region: 0x99, script: 0x59, flags: 0x0}, - 672: {region: 0x165, script: 0x57, flags: 0x0}, - 673: {region: 0x165, script: 0x57, flags: 0x0}, - 674: {region: 0x106, script: 0x1f, flags: 0x0}, - 675: {region: 0x131, script: 0x57, flags: 0x0}, - 676: {region: 0x165, script: 0x57, flags: 0x0}, - 677: {region: 0xd9, script: 0x57, flags: 0x0}, - 678: {region: 0x165, script: 0x57, flags: 0x0}, - 679: {region: 0x165, script: 0x57, flags: 0x0}, - 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x57, flags: 0x0}, - 682: {region: 0x165, script: 0x57, flags: 0x0}, - 683: {region: 0x9e, script: 0x57, flags: 0x0}, - 684: {region: 0x53, script: 0x5d, flags: 0x0}, - 685: {region: 0x95, script: 0x57, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x57, flags: 0x0}, - 688: {region: 0x165, script: 0x57, flags: 0x0}, - 689: {region: 0x165, script: 0x57, flags: 0x0}, - 690: {region: 0x99, script: 0xda, flags: 0x0}, - 691: {region: 0x9e, script: 0x57, flags: 0x0}, - 692: {region: 0x165, script: 0x57, flags: 0x0}, - 693: {region: 0x4b, script: 0x57, flags: 0x0}, - 694: {region: 0x165, script: 0x57, flags: 0x0}, - 695: {region: 0x165, script: 0x57, flags: 0x0}, - 696: {region: 0xaf, script: 0x54, flags: 0x0}, - 697: {region: 0x165, script: 0x57, flags: 0x0}, - 698: {region: 0x165, script: 0x57, flags: 0x0}, - 699: {region: 0x4b, script: 0x57, flags: 0x0}, - 700: {region: 0x165, script: 0x57, flags: 0x0}, - 701: {region: 0x165, script: 0x57, flags: 0x0}, - 702: {region: 0x162, script: 0x57, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x57, flags: 0x0}, - 705: {region: 0xb8, script: 0x57, flags: 0x0}, - 706: {region: 0x4b, script: 0x57, flags: 0x0}, - 707: {region: 0x4b, script: 0x57, flags: 0x0}, - 708: {region: 0xa4, script: 0x57, flags: 0x0}, - 709: {region: 0xa4, script: 0x57, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x57, flags: 0x0}, - 712: {region: 0x123, script: 0xdf, flags: 0x0}, - 713: {region: 0x53, script: 0x38, flags: 0x0}, - 714: {region: 0x12b, script: 0x57, flags: 0x0}, - 715: {region: 0x95, script: 0x57, flags: 0x0}, - 716: {region: 0x52, script: 0x57, flags: 0x0}, - 717: {region: 0x99, script: 0x21, flags: 0x0}, - 718: {region: 0x99, script: 0x21, flags: 0x0}, - 719: {region: 0x95, script: 0x57, flags: 0x0}, - 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x57, flags: 0x0}, - 722: {region: 0x165, script: 0x57, flags: 0x0}, - 723: {region: 0xcf, script: 0x57, flags: 0x0}, - 724: {region: 0x165, script: 0x57, flags: 0x0}, - 725: {region: 0x165, script: 0x57, flags: 0x0}, - 726: {region: 0x165, script: 0x57, flags: 0x0}, - 727: {region: 0x165, script: 0x57, flags: 0x0}, - 728: {region: 0x165, script: 0x57, flags: 0x0}, - 729: {region: 0x165, script: 0x57, flags: 0x0}, - 730: {region: 0x165, script: 0x57, flags: 0x0}, - 731: {region: 0x165, script: 0x57, flags: 0x0}, - 732: {region: 0x165, script: 0x57, flags: 0x0}, - 733: {region: 0x165, script: 0x57, flags: 0x0}, - 734: {region: 0x165, script: 0x57, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x1f, flags: 0x0}, - 737: {region: 0xe7, script: 0x57, flags: 0x0}, - 738: {region: 0x165, script: 0x57, flags: 0x0}, - 739: {region: 0x95, script: 0x57, flags: 0x0}, - 740: {region: 0x165, script: 0x29, flags: 0x0}, - 741: {region: 0x165, script: 0x57, flags: 0x0}, - 742: {region: 0x165, script: 0x57, flags: 0x0}, - 743: {region: 0x165, script: 0x57, flags: 0x0}, - 744: {region: 0x112, script: 0x57, flags: 0x0}, - 745: {region: 0xa4, script: 0x57, flags: 0x0}, - 746: {region: 0x165, script: 0x57, flags: 0x0}, - 747: {region: 0x165, script: 0x57, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x57, flags: 0x0}, - 750: {region: 0x165, script: 0x57, flags: 0x0}, - 751: {region: 0x165, script: 0x57, flags: 0x0}, - 752: {region: 0x165, script: 0x57, flags: 0x0}, - 753: {region: 0xbf, script: 0x57, flags: 0x0}, - 754: {region: 0xd1, script: 0x57, flags: 0x0}, - 755: {region: 0x165, script: 0x57, flags: 0x0}, - 756: {region: 0x52, script: 0x57, flags: 0x0}, - 757: {region: 0xdb, script: 0x21, flags: 0x0}, - 758: {region: 0x12f, script: 0x57, flags: 0x0}, - 759: {region: 0xc0, script: 0x57, flags: 0x0}, - 760: {region: 0x165, script: 0x57, flags: 0x0}, - 761: {region: 0x165, script: 0x57, flags: 0x0}, - 762: {region: 0xe0, script: 0x57, flags: 0x0}, - 763: {region: 0x165, script: 0x57, flags: 0x0}, - 764: {region: 0x95, script: 0x57, flags: 0x0}, - 765: {region: 0x9b, script: 0x3a, flags: 0x0}, - 766: {region: 0x165, script: 0x57, flags: 0x0}, - 767: {region: 0xc2, script: 0x1f, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x57, flags: 0x0}, - 770: {region: 0x165, script: 0x57, flags: 0x0}, - 771: {region: 0x165, script: 0x57, flags: 0x0}, - 772: {region: 0x99, script: 0x6b, flags: 0x0}, - 773: {region: 0x165, script: 0x57, flags: 0x0}, - 774: {region: 0x165, script: 0x57, flags: 0x0}, - 775: {region: 0x10b, script: 0x57, flags: 0x0}, - 776: {region: 0x165, script: 0x57, flags: 0x0}, - 777: {region: 0x165, script: 0x57, flags: 0x0}, - 778: {region: 0x165, script: 0x57, flags: 0x0}, - 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x57, flags: 0x0}, - 781: {region: 0x165, script: 0x57, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x72, flags: 0x0}, - 785: {region: 0x165, script: 0x57, flags: 0x0}, - 786: {region: 0x49, script: 0x57, flags: 0x0}, - 787: {region: 0x49, script: 0x57, flags: 0x0}, - 788: {region: 0x37, script: 0x57, flags: 0x0}, - 789: {region: 0x165, script: 0x57, flags: 0x0}, - 790: {region: 0x165, script: 0x57, flags: 0x0}, - 791: {region: 0x165, script: 0x57, flags: 0x0}, - 792: {region: 0x165, script: 0x57, flags: 0x0}, - 793: {region: 0x165, script: 0x57, flags: 0x0}, - 794: {region: 0x165, script: 0x57, flags: 0x0}, - 795: {region: 0x99, script: 0x21, flags: 0x0}, - 796: {region: 0xdb, script: 0x21, flags: 0x0}, - 797: {region: 0x106, script: 0x1f, flags: 0x0}, - 798: {region: 0x35, script: 0x6f, flags: 0x0}, - 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x57, flags: 0x0}, - 801: {region: 0x165, script: 0x57, flags: 0x0}, - 802: {region: 0x165, script: 0x57, flags: 0x0}, - 803: {region: 0x165, script: 0x57, flags: 0x0}, - 804: {region: 0x99, script: 0x21, flags: 0x0}, - 805: {region: 0x52, script: 0x57, flags: 0x0}, - 807: {region: 0x165, script: 0x57, flags: 0x0}, - 808: {region: 0x135, script: 0x57, flags: 0x0}, - 809: {region: 0x165, script: 0x57, flags: 0x0}, - 810: {region: 0x165, script: 0x57, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x57, flags: 0x0}, - 813: {region: 0x99, script: 0x21, flags: 0x0}, - 814: {region: 0x95, script: 0x57, flags: 0x0}, - 815: {region: 0x164, script: 0x57, flags: 0x0}, - 816: {region: 0x165, script: 0x57, flags: 0x0}, - 817: {region: 0xc4, script: 0x72, flags: 0x0}, - 818: {region: 0x165, script: 0x57, flags: 0x0}, - 819: {region: 0x165, script: 0x29, flags: 0x0}, - 820: {region: 0x106, script: 0x1f, flags: 0x0}, - 821: {region: 0x165, script: 0x57, flags: 0x0}, - 822: {region: 0x131, script: 0x57, flags: 0x0}, - 823: {region: 0x9c, script: 0x63, flags: 0x0}, - 824: {region: 0x165, script: 0x57, flags: 0x0}, - 825: {region: 0x165, script: 0x57, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x57, flags: 0x0}, - 828: {region: 0x165, script: 0x57, flags: 0x0}, - 829: {region: 0x165, script: 0x57, flags: 0x0}, - 830: {region: 0xdd, script: 0x57, flags: 0x0}, - 831: {region: 0x165, script: 0x57, flags: 0x0}, - 832: {region: 0x165, script: 0x57, flags: 0x0}, - 834: {region: 0x165, script: 0x57, flags: 0x0}, - 835: {region: 0x53, script: 0x38, flags: 0x0}, - 836: {region: 0x9e, script: 0x57, flags: 0x0}, - 837: {region: 0xd2, script: 0x57, flags: 0x0}, - 838: {region: 0x165, script: 0x57, flags: 0x0}, - 839: {region: 0xda, script: 0x57, flags: 0x0}, - 840: {region: 0x165, script: 0x57, flags: 0x0}, - 841: {region: 0x165, script: 0x57, flags: 0x0}, - 842: {region: 0x165, script: 0x57, flags: 0x0}, - 843: {region: 0xcf, script: 0x57, flags: 0x0}, - 844: {region: 0x165, script: 0x57, flags: 0x0}, - 845: {region: 0x165, script: 0x57, flags: 0x0}, - 846: {region: 0x164, script: 0x57, flags: 0x0}, - 847: {region: 0xd1, script: 0x57, flags: 0x0}, - 848: {region: 0x60, script: 0x57, flags: 0x0}, - 849: {region: 0xdb, script: 0x21, flags: 0x0}, - 850: {region: 0x165, script: 0x57, flags: 0x0}, - 851: {region: 0xdb, script: 0x21, flags: 0x0}, - 852: {region: 0x165, script: 0x57, flags: 0x0}, - 853: {region: 0x165, script: 0x57, flags: 0x0}, - 854: {region: 0xd2, script: 0x57, flags: 0x0}, - 855: {region: 0x165, script: 0x57, flags: 0x0}, - 856: {region: 0x165, script: 0x57, flags: 0x0}, - 857: {region: 0xd1, script: 0x57, flags: 0x0}, - 858: {region: 0x165, script: 0x57, flags: 0x0}, - 859: {region: 0xcf, script: 0x57, flags: 0x0}, - 860: {region: 0xcf, script: 0x57, flags: 0x0}, - 861: {region: 0x165, script: 0x57, flags: 0x0}, - 862: {region: 0x165, script: 0x57, flags: 0x0}, - 863: {region: 0x95, script: 0x57, flags: 0x0}, - 864: {region: 0x165, script: 0x57, flags: 0x0}, - 865: {region: 0xdf, script: 0x57, flags: 0x0}, - 866: {region: 0x165, script: 0x57, flags: 0x0}, - 867: {region: 0x165, script: 0x57, flags: 0x0}, - 868: {region: 0x99, script: 0x57, flags: 0x0}, - 869: {region: 0x165, script: 0x57, flags: 0x0}, - 870: {region: 0x165, script: 0x57, flags: 0x0}, - 871: {region: 0xd9, script: 0x57, flags: 0x0}, - 872: {region: 0x52, script: 0x57, flags: 0x0}, - 873: {region: 0x165, script: 0x57, flags: 0x0}, - 874: {region: 0xda, script: 0x57, flags: 0x0}, - 875: {region: 0x165, script: 0x57, flags: 0x0}, - 876: {region: 0x52, script: 0x57, flags: 0x0}, - 877: {region: 0x165, script: 0x57, flags: 0x0}, - 878: {region: 0x165, script: 0x57, flags: 0x0}, - 879: {region: 0xda, script: 0x57, flags: 0x0}, - 880: {region: 0x123, script: 0x53, flags: 0x0}, - 881: {region: 0x99, script: 0x21, flags: 0x0}, - 882: {region: 0x10c, script: 0xbf, flags: 0x0}, - 883: {region: 0x165, script: 0x57, flags: 0x0}, - 884: {region: 0x165, script: 0x57, flags: 0x0}, - 885: {region: 0x84, script: 0x78, flags: 0x0}, - 886: {region: 0x161, script: 0x57, flags: 0x0}, - 887: {region: 0x165, script: 0x57, flags: 0x0}, - 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x57, flags: 0x0}, - 890: {region: 0x161, script: 0x57, flags: 0x0}, - 891: {region: 0x165, script: 0x57, flags: 0x0}, - 892: {region: 0x165, script: 0x57, flags: 0x0}, - 893: {region: 0x165, script: 0x57, flags: 0x0}, - 894: {region: 0x165, script: 0x57, flags: 0x0}, - 895: {region: 0x165, script: 0x57, flags: 0x0}, - 896: {region: 0x117, script: 0x57, flags: 0x0}, - 897: {region: 0x165, script: 0x57, flags: 0x0}, - 898: {region: 0x165, script: 0x57, flags: 0x0}, - 899: {region: 0x135, script: 0x57, flags: 0x0}, - 900: {region: 0x165, script: 0x57, flags: 0x0}, - 901: {region: 0x53, script: 0x57, flags: 0x0}, - 902: {region: 0x165, script: 0x57, flags: 0x0}, - 903: {region: 0xce, script: 0x57, flags: 0x0}, - 904: {region: 0x12f, script: 0x57, flags: 0x0}, - 905: {region: 0x131, script: 0x57, flags: 0x0}, - 906: {region: 0x80, script: 0x57, flags: 0x0}, - 907: {region: 0x78, script: 0x57, flags: 0x0}, - 908: {region: 0x165, script: 0x57, flags: 0x0}, - 910: {region: 0x165, script: 0x57, flags: 0x0}, - 911: {region: 0x165, script: 0x57, flags: 0x0}, - 912: {region: 0x6f, script: 0x57, flags: 0x0}, - 913: {region: 0x165, script: 0x57, flags: 0x0}, - 914: {region: 0x165, script: 0x57, flags: 0x0}, - 915: {region: 0x165, script: 0x57, flags: 0x0}, - 916: {region: 0x165, script: 0x57, flags: 0x0}, - 917: {region: 0x99, script: 0x7d, flags: 0x0}, - 918: {region: 0x165, script: 0x57, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x1f, flags: 0x0}, - 921: {region: 0x135, script: 0x7e, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x7c, flags: 0x0}, - 924: {region: 0x165, script: 0x57, flags: 0x0}, - 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x57, flags: 0x0}, - 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x57, flags: 0x0}, - 929: {region: 0x30, script: 0x57, flags: 0x0}, - 930: {region: 0xf0, script: 0x57, flags: 0x0}, - 931: {region: 0x165, script: 0x57, flags: 0x0}, - 932: {region: 0x78, script: 0x57, flags: 0x0}, - 933: {region: 0xd6, script: 0x57, flags: 0x0}, - 934: {region: 0x135, script: 0x57, flags: 0x0}, - 935: {region: 0x49, script: 0x57, flags: 0x0}, - 936: {region: 0x165, script: 0x57, flags: 0x0}, - 937: {region: 0x9c, script: 0xe8, flags: 0x0}, - 938: {region: 0x165, script: 0x57, flags: 0x0}, - 939: {region: 0x60, script: 0x57, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x87, flags: 0x0}, - 943: {region: 0x165, script: 0x57, flags: 0x0}, - 944: {region: 0x165, script: 0x57, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x57, flags: 0x0}, - 947: {region: 0xe9, script: 0x57, flags: 0x0}, - 948: {region: 0x165, script: 0x57, flags: 0x0}, - 949: {region: 0x9e, script: 0x57, flags: 0x0}, - 950: {region: 0x165, script: 0x57, flags: 0x0}, - 951: {region: 0x165, script: 0x57, flags: 0x0}, - 952: {region: 0x87, script: 0x31, flags: 0x0}, - 953: {region: 0x75, script: 0x57, flags: 0x0}, - 954: {region: 0x165, script: 0x57, flags: 0x0}, - 955: {region: 0xe8, script: 0x4a, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x57, flags: 0x0}, - 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x57, flags: 0x0}, - 960: {region: 0x41, script: 0x57, flags: 0x0}, - 961: {region: 0x165, script: 0x57, flags: 0x0}, - 962: {region: 0x7a, script: 0x57, flags: 0x0}, - 963: {region: 0x165, script: 0x57, flags: 0x0}, - 964: {region: 0xe4, script: 0x57, flags: 0x0}, - 965: {region: 0x89, script: 0x57, flags: 0x0}, - 966: {region: 0x69, script: 0x57, flags: 0x0}, - 967: {region: 0x165, script: 0x57, flags: 0x0}, - 968: {region: 0x99, script: 0x21, flags: 0x0}, - 969: {region: 0x165, script: 0x57, flags: 0x0}, - 970: {region: 0x102, script: 0x57, flags: 0x0}, - 971: {region: 0x95, script: 0x57, flags: 0x0}, - 972: {region: 0x165, script: 0x57, flags: 0x0}, - 973: {region: 0x165, script: 0x57, flags: 0x0}, - 974: {region: 0x9e, script: 0x57, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x57, flags: 0x0}, - 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x21, flags: 0x0}, - 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x57, flags: 0x0}, - 981: {region: 0x72, script: 0x57, flags: 0x0}, - 982: {region: 0x4e, script: 0x57, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x57, flags: 0x0}, - 985: {region: 0x3a, script: 0x57, flags: 0x0}, - 986: {region: 0x165, script: 0x57, flags: 0x0}, - 987: {region: 0xd1, script: 0x57, flags: 0x0}, - 988: {region: 0x104, script: 0x57, flags: 0x0}, - 989: {region: 0x95, script: 0x57, flags: 0x0}, - 990: {region: 0x12f, script: 0x57, flags: 0x0}, - 991: {region: 0x165, script: 0x57, flags: 0x0}, - 992: {region: 0x165, script: 0x57, flags: 0x0}, - 993: {region: 0x73, script: 0x57, flags: 0x0}, - 994: {region: 0x106, script: 0x1f, flags: 0x0}, - 995: {region: 0x130, script: 0x1f, flags: 0x0}, - 996: {region: 0x109, script: 0x57, flags: 0x0}, - 997: {region: 0x107, script: 0x57, flags: 0x0}, - 998: {region: 0x12f, script: 0x57, flags: 0x0}, - 999: {region: 0x165, script: 0x57, flags: 0x0}, - 1000: {region: 0xa2, script: 0x49, flags: 0x0}, - 1001: {region: 0x99, script: 0x21, flags: 0x0}, - 1002: {region: 0x80, script: 0x57, flags: 0x0}, - 1003: {region: 0x106, script: 0x1f, flags: 0x0}, - 1004: {region: 0xa4, script: 0x57, flags: 0x0}, - 1005: {region: 0x95, script: 0x57, flags: 0x0}, - 1006: {region: 0x99, script: 0x57, flags: 0x0}, - 1007: {region: 0x114, script: 0x57, flags: 0x0}, - 1008: {region: 0x99, script: 0xc3, flags: 0x0}, - 1009: {region: 0x165, script: 0x57, flags: 0x0}, - 1010: {region: 0x165, script: 0x57, flags: 0x0}, - 1011: {region: 0x12f, script: 0x57, flags: 0x0}, - 1012: {region: 0x9e, script: 0x57, flags: 0x0}, - 1013: {region: 0x99, script: 0x21, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x57, flags: 0x0}, - 1016: {region: 0x7b, script: 0x57, flags: 0x0}, - 1017: {region: 0x49, script: 0x57, flags: 0x0}, - 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x57, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x57, flags: 0x0}, - 1022: {region: 0x4f, script: 0x57, flags: 0x0}, - 1023: {region: 0xd1, script: 0x57, flags: 0x0}, - 1024: {region: 0xcf, script: 0x57, flags: 0x0}, - 1025: {region: 0xc3, script: 0x57, flags: 0x0}, - 1026: {region: 0x4c, script: 0x57, flags: 0x0}, - 1027: {region: 0x96, script: 0x7a, flags: 0x0}, - 1028: {region: 0xb6, script: 0x57, flags: 0x0}, - 1029: {region: 0x165, script: 0x29, flags: 0x0}, - 1030: {region: 0x165, script: 0x57, flags: 0x0}, - 1032: {region: 0xba, script: 0xdc, flags: 0x0}, - 1033: {region: 0x165, script: 0x57, flags: 0x0}, - 1034: {region: 0xc4, script: 0x72, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xca, flags: 0x0}, - 1037: {region: 0x6f, script: 0x57, flags: 0x0}, - 1038: {region: 0x165, script: 0x57, flags: 0x0}, - 1039: {region: 0x165, script: 0x57, flags: 0x0}, - 1040: {region: 0x165, script: 0x57, flags: 0x0}, - 1041: {region: 0x165, script: 0x57, flags: 0x0}, - 1042: {region: 0x111, script: 0x57, flags: 0x0}, - 1043: {region: 0x165, script: 0x57, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x57, flags: 0x0}, - 1046: {region: 0x10f, script: 0x57, flags: 0x0}, - 1047: {region: 0x165, script: 0x57, flags: 0x0}, - 1048: {region: 0xe9, script: 0x57, flags: 0x0}, - 1049: {region: 0x165, script: 0x57, flags: 0x0}, - 1050: {region: 0x95, script: 0x57, flags: 0x0}, - 1051: {region: 0x142, script: 0x57, flags: 0x0}, - 1052: {region: 0x10c, script: 0x57, flags: 0x0}, - 1054: {region: 0x10c, script: 0x57, flags: 0x0}, - 1055: {region: 0x72, script: 0x57, flags: 0x0}, - 1056: {region: 0x97, script: 0xc0, flags: 0x0}, - 1057: {region: 0x165, script: 0x57, flags: 0x0}, - 1058: {region: 0x72, script: 0x57, flags: 0x0}, - 1059: {region: 0x164, script: 0x57, flags: 0x0}, - 1060: {region: 0x165, script: 0x57, flags: 0x0}, - 1061: {region: 0xc3, script: 0x57, flags: 0x0}, - 1062: {region: 0x165, script: 0x57, flags: 0x0}, - 1063: {region: 0x165, script: 0x57, flags: 0x0}, - 1064: {region: 0x165, script: 0x57, flags: 0x0}, - 1065: {region: 0x115, script: 0x57, flags: 0x0}, - 1066: {region: 0x165, script: 0x57, flags: 0x0}, - 1067: {region: 0x165, script: 0x57, flags: 0x0}, - 1068: {region: 0x123, script: 0xdf, flags: 0x0}, - 1069: {region: 0x165, script: 0x57, flags: 0x0}, - 1070: {region: 0x165, script: 0x57, flags: 0x0}, - 1071: {region: 0x165, script: 0x57, flags: 0x0}, - 1072: {region: 0x165, script: 0x57, flags: 0x0}, - 1073: {region: 0x27, script: 0x57, flags: 0x0}, - 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xcb, flags: 0x0}, - 1076: {region: 0x116, script: 0x57, flags: 0x0}, - 1077: {region: 0x114, script: 0x57, flags: 0x0}, - 1078: {region: 0x99, script: 0x21, flags: 0x0}, - 1079: {region: 0x161, script: 0x57, flags: 0x0}, - 1080: {region: 0x165, script: 0x57, flags: 0x0}, - 1081: {region: 0x165, script: 0x57, flags: 0x0}, - 1082: {region: 0x6d, script: 0x57, flags: 0x0}, - 1083: {region: 0x161, script: 0x57, flags: 0x0}, - 1084: {region: 0x165, script: 0x57, flags: 0x0}, - 1085: {region: 0x60, script: 0x57, flags: 0x0}, - 1086: {region: 0x95, script: 0x57, flags: 0x0}, - 1087: {region: 0x165, script: 0x57, flags: 0x0}, - 1088: {region: 0x165, script: 0x57, flags: 0x0}, - 1089: {region: 0x12f, script: 0x57, flags: 0x0}, - 1090: {region: 0x165, script: 0x57, flags: 0x0}, - 1091: {region: 0x84, script: 0x57, flags: 0x0}, - 1092: {region: 0x10c, script: 0x57, flags: 0x0}, - 1093: {region: 0x12f, script: 0x57, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x57, flags: 0x0}, - 1096: {region: 0x60, script: 0x57, flags: 0x0}, - 1097: {region: 0x165, script: 0x57, flags: 0x0}, - 1098: {region: 0x99, script: 0x21, flags: 0x0}, - 1099: {region: 0x95, script: 0x57, flags: 0x0}, - 1100: {region: 0x165, script: 0x57, flags: 0x0}, - 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, - 1103: {region: 0xe9, script: 0x57, flags: 0x0}, - 1104: {region: 0x99, script: 0xd7, flags: 0x0}, - 1105: {region: 0xdb, script: 0x21, flags: 0x0}, - 1106: {region: 0x165, script: 0x57, flags: 0x0}, - 1107: {region: 0x165, script: 0x57, flags: 0x0}, - 1108: {region: 0x165, script: 0x57, flags: 0x0}, - 1109: {region: 0x165, script: 0x57, flags: 0x0}, - 1110: {region: 0x165, script: 0x57, flags: 0x0}, - 1111: {region: 0x165, script: 0x57, flags: 0x0}, - 1112: {region: 0x165, script: 0x57, flags: 0x0}, - 1113: {region: 0x165, script: 0x57, flags: 0x0}, - 1114: {region: 0xe7, script: 0x57, flags: 0x0}, - 1115: {region: 0x165, script: 0x57, flags: 0x0}, - 1116: {region: 0x165, script: 0x57, flags: 0x0}, - 1117: {region: 0x99, script: 0x4f, flags: 0x0}, - 1118: {region: 0x53, script: 0xd5, flags: 0x0}, - 1119: {region: 0xdb, script: 0x21, flags: 0x0}, - 1120: {region: 0xdb, script: 0x21, flags: 0x0}, - 1121: {region: 0x99, script: 0xda, flags: 0x0}, - 1122: {region: 0x165, script: 0x57, flags: 0x0}, - 1123: {region: 0x112, script: 0x57, flags: 0x0}, - 1124: {region: 0x131, script: 0x57, flags: 0x0}, - 1125: {region: 0x126, script: 0x57, flags: 0x0}, - 1126: {region: 0x165, script: 0x57, flags: 0x0}, - 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x57, flags: 0x0}, - 1129: {region: 0x165, script: 0x57, flags: 0x0}, - 1130: {region: 0x165, script: 0x57, flags: 0x0}, - 1131: {region: 0x123, script: 0xdf, flags: 0x0}, - 1132: {region: 0xdb, script: 0x21, flags: 0x0}, - 1133: {region: 0xdb, script: 0x21, flags: 0x0}, - 1134: {region: 0xdb, script: 0x21, flags: 0x0}, - 1135: {region: 0x6f, script: 0x29, flags: 0x0}, - 1136: {region: 0x165, script: 0x57, flags: 0x0}, - 1137: {region: 0x6d, script: 0x29, flags: 0x0}, - 1138: {region: 0x165, script: 0x57, flags: 0x0}, - 1139: {region: 0x165, script: 0x57, flags: 0x0}, - 1140: {region: 0x165, script: 0x57, flags: 0x0}, - 1141: {region: 0xd6, script: 0x57, flags: 0x0}, - 1142: {region: 0x127, script: 0x57, flags: 0x0}, - 1143: {region: 0x125, script: 0x57, flags: 0x0}, - 1144: {region: 0x32, script: 0x57, flags: 0x0}, - 1145: {region: 0xdb, script: 0x21, flags: 0x0}, - 1146: {region: 0xe7, script: 0x57, flags: 0x0}, - 1147: {region: 0x165, script: 0x57, flags: 0x0}, - 1148: {region: 0x165, script: 0x57, flags: 0x0}, - 1149: {region: 0x32, script: 0x57, flags: 0x0}, - 1150: {region: 0xd4, script: 0x57, flags: 0x0}, - 1151: {region: 0x165, script: 0x57, flags: 0x0}, - 1152: {region: 0x161, script: 0x57, flags: 0x0}, - 1153: {region: 0x165, script: 0x57, flags: 0x0}, - 1154: {region: 0x129, script: 0x57, flags: 0x0}, - 1155: {region: 0x165, script: 0x57, flags: 0x0}, - 1156: {region: 0xce, script: 0x57, flags: 0x0}, - 1157: {region: 0x165, script: 0x57, flags: 0x0}, - 1158: {region: 0xe6, script: 0x57, flags: 0x0}, - 1159: {region: 0x165, script: 0x57, flags: 0x0}, - 1160: {region: 0x165, script: 0x57, flags: 0x0}, - 1161: {region: 0x165, script: 0x57, flags: 0x0}, - 1162: {region: 0x12b, script: 0x57, flags: 0x0}, - 1163: {region: 0x12b, script: 0x57, flags: 0x0}, - 1164: {region: 0x12e, script: 0x57, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x57, flags: 0x0}, - 1167: {region: 0x87, script: 0x31, flags: 0x0}, - 1168: {region: 0xdb, script: 0x21, flags: 0x0}, - 1169: {region: 0xe7, script: 0x57, flags: 0x0}, - 1170: {region: 0x43, script: 0xe0, flags: 0x0}, - 1171: {region: 0x165, script: 0x57, flags: 0x0}, - 1172: {region: 0x106, script: 0x1f, flags: 0x0}, - 1173: {region: 0x165, script: 0x57, flags: 0x0}, - 1174: {region: 0x165, script: 0x57, flags: 0x0}, - 1175: {region: 0x131, script: 0x57, flags: 0x0}, - 1176: {region: 0x165, script: 0x57, flags: 0x0}, - 1177: {region: 0x123, script: 0xdf, flags: 0x0}, - 1178: {region: 0x32, script: 0x57, flags: 0x0}, - 1179: {region: 0x165, script: 0x57, flags: 0x0}, - 1180: {region: 0x165, script: 0x57, flags: 0x0}, - 1181: {region: 0xce, script: 0x57, flags: 0x0}, - 1182: {region: 0x165, script: 0x57, flags: 0x0}, - 1183: {region: 0x165, script: 0x57, flags: 0x0}, - 1184: {region: 0x12d, script: 0x57, flags: 0x0}, - 1185: {region: 0x165, script: 0x57, flags: 0x0}, - 1187: {region: 0x165, script: 0x57, flags: 0x0}, - 1188: {region: 0xd4, script: 0x57, flags: 0x0}, - 1189: {region: 0x53, script: 0xd8, flags: 0x0}, - 1190: {region: 0xe5, script: 0x57, flags: 0x0}, - 1191: {region: 0x165, script: 0x57, flags: 0x0}, - 1192: {region: 0x106, script: 0x1f, flags: 0x0}, - 1193: {region: 0xba, script: 0x57, flags: 0x0}, - 1194: {region: 0x165, script: 0x57, flags: 0x0}, - 1195: {region: 0x106, script: 0x1f, flags: 0x0}, - 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, - 1198: {region: 0x130, script: 0x1f, flags: 0x0}, - 1199: {region: 0x75, script: 0x57, flags: 0x0}, - 1200: {region: 0x2a, script: 0x57, flags: 0x0}, - 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x57, flags: 0x0}, - 1206: {region: 0x165, script: 0x57, flags: 0x0}, - 1207: {region: 0x165, script: 0x57, flags: 0x0}, - 1208: {region: 0x165, script: 0x57, flags: 0x0}, - 1209: {region: 0x165, script: 0x57, flags: 0x0}, - 1210: {region: 0x165, script: 0x57, flags: 0x0}, - 1211: {region: 0x165, script: 0x57, flags: 0x0}, - 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x57, flags: 0x0}, - 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, - 1215: {region: 0x165, script: 0x57, flags: 0x0}, - 1216: {region: 0x161, script: 0x57, flags: 0x0}, - 1217: {region: 0x9e, script: 0x57, flags: 0x0}, - 1218: {region: 0x106, script: 0x57, flags: 0x0}, - 1219: {region: 0x13e, script: 0x57, flags: 0x0}, - 1220: {region: 0x11b, script: 0x57, flags: 0x0}, - 1221: {region: 0x165, script: 0x57, flags: 0x0}, - 1222: {region: 0x36, script: 0x57, flags: 0x0}, - 1223: {region: 0x60, script: 0x57, flags: 0x0}, - 1224: {region: 0xd1, script: 0x57, flags: 0x0}, - 1225: {region: 0x1, script: 0x57, flags: 0x0}, - 1226: {region: 0x106, script: 0x57, flags: 0x0}, - 1227: {region: 0x6a, script: 0x57, flags: 0x0}, - 1228: {region: 0x12f, script: 0x57, flags: 0x0}, - 1229: {region: 0x165, script: 0x57, flags: 0x0}, - 1230: {region: 0x36, script: 0x57, flags: 0x0}, - 1231: {region: 0x4e, script: 0x57, flags: 0x0}, - 1232: {region: 0x165, script: 0x57, flags: 0x0}, - 1233: {region: 0x6f, script: 0x29, flags: 0x0}, - 1234: {region: 0x165, script: 0x57, flags: 0x0}, - 1235: {region: 0xe7, script: 0x57, flags: 0x0}, - 1236: {region: 0x2f, script: 0x57, flags: 0x0}, - 1237: {region: 0x99, script: 0xda, flags: 0x0}, - 1238: {region: 0x99, script: 0x21, flags: 0x0}, - 1239: {region: 0x165, script: 0x57, flags: 0x0}, - 1240: {region: 0x165, script: 0x57, flags: 0x0}, - 1241: {region: 0x165, script: 0x57, flags: 0x0}, - 1242: {region: 0x165, script: 0x57, flags: 0x0}, - 1243: {region: 0x165, script: 0x57, flags: 0x0}, - 1244: {region: 0x165, script: 0x57, flags: 0x0}, - 1245: {region: 0x165, script: 0x57, flags: 0x0}, - 1246: {region: 0x165, script: 0x57, flags: 0x0}, - 1247: {region: 0x165, script: 0x57, flags: 0x0}, - 1248: {region: 0x140, script: 0x57, flags: 0x0}, - 1249: {region: 0x165, script: 0x57, flags: 0x0}, - 1250: {region: 0x165, script: 0x57, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x57, flags: 0x0}, - 1253: {region: 0x114, script: 0x57, flags: 0x0}, - 1254: {region: 0x165, script: 0x57, flags: 0x0}, - 1255: {region: 0x165, script: 0x57, flags: 0x0}, - 1256: {region: 0x165, script: 0x57, flags: 0x0}, - 1257: {region: 0x165, script: 0x57, flags: 0x0}, - 1258: {region: 0x99, script: 0x21, flags: 0x0}, - 1259: {region: 0x53, script: 0x38, flags: 0x0}, - 1260: {region: 0x165, script: 0x57, flags: 0x0}, - 1261: {region: 0x165, script: 0x57, flags: 0x0}, - 1262: {region: 0x41, script: 0x57, flags: 0x0}, - 1263: {region: 0x165, script: 0x57, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x57, flags: 0x0}, - 1266: {region: 0x161, script: 0x57, flags: 0x0}, - 1267: {region: 0x165, script: 0x57, flags: 0x0}, - 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, - 1269: {region: 0x12b, script: 0x60, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, - 1271: {region: 0x53, script: 0x64, flags: 0x0}, - 1272: {region: 0x10b, script: 0x69, flags: 0x0}, - 1273: {region: 0x108, script: 0x73, flags: 0x0}, - 1274: {region: 0x99, script: 0x21, flags: 0x0}, - 1275: {region: 0x131, script: 0x57, flags: 0x0}, - 1276: {region: 0x165, script: 0x57, flags: 0x0}, - 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, - 1278: {region: 0x165, script: 0x57, flags: 0x0}, - 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, - 1280: {region: 0x165, script: 0x57, flags: 0x0}, - 1281: {region: 0x165, script: 0x57, flags: 0x0}, - 1282: {region: 0xdb, script: 0x21, flags: 0x0}, - 1283: {region: 0x165, script: 0x57, flags: 0x0}, - 1284: {region: 0x165, script: 0x57, flags: 0x0}, - 1285: {region: 0xd1, script: 0x57, flags: 0x0}, - 1286: {region: 0x75, script: 0x57, flags: 0x0}, - 1287: {region: 0x165, script: 0x57, flags: 0x0}, - 1288: {region: 0x165, script: 0x57, flags: 0x0}, - 1289: {region: 0x52, script: 0x57, flags: 0x0}, - 1290: {region: 0x165, script: 0x57, flags: 0x0}, - 1291: {region: 0x165, script: 0x57, flags: 0x0}, - 1292: {region: 0x165, script: 0x57, flags: 0x0}, - 1293: {region: 0x52, script: 0x57, flags: 0x0}, - 1294: {region: 0x165, script: 0x57, flags: 0x0}, - 1295: {region: 0x165, script: 0x57, flags: 0x0}, - 1296: {region: 0x165, script: 0x57, flags: 0x0}, - 1297: {region: 0x165, script: 0x57, flags: 0x0}, - 1298: {region: 0x1, script: 0x3b, flags: 0x0}, - 1299: {region: 0x165, script: 0x57, flags: 0x0}, - 1300: {region: 0x165, script: 0x57, flags: 0x0}, - 1301: {region: 0x165, script: 0x57, flags: 0x0}, - 1302: {region: 0x165, script: 0x57, flags: 0x0}, - 1303: {region: 0x165, script: 0x57, flags: 0x0}, - 1304: {region: 0xd6, script: 0x57, flags: 0x0}, - 1305: {region: 0x165, script: 0x57, flags: 0x0}, - 1306: {region: 0x165, script: 0x57, flags: 0x0}, - 1307: {region: 0x165, script: 0x57, flags: 0x0}, - 1308: {region: 0x41, script: 0x57, flags: 0x0}, - 1309: {region: 0x165, script: 0x57, flags: 0x0}, - 1310: {region: 0xcf, script: 0x57, flags: 0x0}, - 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x57, flags: 0x0}, - 1313: {region: 0x165, script: 0x57, flags: 0x0}, - 1314: {region: 0x165, script: 0x57, flags: 0x0}, - 1315: {region: 0x53, script: 0x57, flags: 0x0}, - 1316: {region: 0x10b, script: 0x57, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x57, flags: 0x0}, - 1320: {region: 0xba, script: 0xdc, flags: 0x0}, - 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x79, flags: 0x0}, - 1323: {region: 0x165, script: 0x57, flags: 0x0}, - 1324: {region: 0x122, script: 0x57, flags: 0x0}, - 1325: {region: 0xd0, script: 0x57, flags: 0x0}, - 1326: {region: 0x165, script: 0x57, flags: 0x0}, - 1327: {region: 0x161, script: 0x57, flags: 0x0}, - 1329: {region: 0x12b, script: 0x57, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x74, flags: 0x2}, - 2: {region: 0x11c, script: 0x80, flags: 0x2}, - 3: {region: 0x32, script: 0x57, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x1f, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x1f, flags: 0x0}, - 9: {region: 0x38, script: 0x2c, flags: 0x2}, - 10: {region: 0x135, script: 0x57, flags: 0x0}, - 11: {region: 0x7b, script: 0xc5, flags: 0x2}, - 12: {region: 0x114, script: 0x57, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1e, flags: 0x0}, - 15: {region: 0x87, script: 0x5c, flags: 0x2}, - 16: {region: 0xd6, script: 0x57, flags: 0x0}, - 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x1f, flags: 0x0}, - 20: {region: 0x24, script: 0x5, flags: 0x4}, - 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, - 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x57, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x1f, flags: 0x0}, - 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x57, flags: 0x4}, - 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x57, flags: 0x2}, - 33: {region: 0xdb, script: 0x21, flags: 0x0}, - 34: {region: 0x99, script: 0x5a, flags: 0x2}, - 35: {region: 0x83, script: 0x57, flags: 0x0}, - 36: {region: 0x84, script: 0x78, flags: 0x4}, - 37: {region: 0x84, script: 0x78, flags: 0x2}, - 38: {region: 0xc5, script: 0x1f, flags: 0x0}, - 39: {region: 0x53, script: 0x6d, flags: 0x4}, - 40: {region: 0x53, script: 0x6d, flags: 0x2}, - 41: {region: 0xd0, script: 0x57, flags: 0x0}, - 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x33, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x84, flags: 0x0}, - 48: {region: 0x53, script: 0x85, flags: 0x2}, - 49: {region: 0xba, script: 0xdc, flags: 0x0}, - 50: {region: 0xd9, script: 0x57, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x21, flags: 0x2}, - 53: {region: 0x99, script: 0x4c, flags: 0x2}, - 54: {region: 0x99, script: 0xc9, flags: 0x2}, - 55: {region: 0x105, script: 0x1f, flags: 0x0}, - 56: {region: 0xbd, script: 0x57, flags: 0x4}, - 57: {region: 0x104, script: 0x57, flags: 0x4}, - 58: {region: 0x106, script: 0x57, flags: 0x4}, - 59: {region: 0x12b, script: 0x57, flags: 0x4}, - 60: {region: 0x124, script: 0x1f, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, - 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x1f, flags: 0x4}, - 65: {region: 0xc5, script: 0x1f, flags: 0x4}, - 66: {region: 0xae, script: 0x1f, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x21, flags: 0x4}, - 69: {region: 0xdb, script: 0x21, flags: 0x2}, - 70: {region: 0x137, script: 0x57, flags: 0x0}, - 71: {region: 0x24, script: 0x5, flags: 0x4}, - 72: {region: 0x53, script: 0x1f, flags: 0x4}, - 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x39, flags: 0x0}, - 75: {region: 0x53, script: 0x38, flags: 0x4}, - 76: {region: 0x53, script: 0x38, flags: 0x2}, - 77: {region: 0x53, script: 0x38, flags: 0x0}, - 78: {region: 0x2f, script: 0x39, flags: 0x4}, - 79: {region: 0x3e, script: 0x39, flags: 0x4}, - 80: {region: 0x7b, script: 0x39, flags: 0x4}, - 81: {region: 0x7e, script: 0x39, flags: 0x4}, - 82: {region: 0x8d, script: 0x39, flags: 0x4}, - 83: {region: 0x95, script: 0x39, flags: 0x4}, - 84: {region: 0xc6, script: 0x39, flags: 0x4}, - 85: {region: 0xd0, script: 0x39, flags: 0x4}, - 86: {region: 0xe2, script: 0x39, flags: 0x4}, - 87: {region: 0xe5, script: 0x39, flags: 0x4}, - 88: {region: 0xe7, script: 0x39, flags: 0x4}, - 89: {region: 0x116, script: 0x39, flags: 0x4}, - 90: {region: 0x123, script: 0x39, flags: 0x4}, - 91: {region: 0x12e, script: 0x39, flags: 0x4}, - 92: {region: 0x135, script: 0x39, flags: 0x4}, - 93: {region: 0x13e, script: 0x39, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x34, flags: 0x2}, - 96: {region: 0x12e, script: 0x39, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 1432 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x57, flags: 0x0}, - 35: {lang: 0x3a, script: 0x5, flags: 0x0}, - 36: {lang: 0x0, script: 0x2, flags: 0x1}, - 39: {lang: 0x2, script: 0x2, flags: 0x1}, - 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 43: {lang: 0x0, script: 0x57, flags: 0x0}, - 44: {lang: 0x13e, script: 0x57, flags: 0x0}, - 45: {lang: 0x41b, script: 0x57, flags: 0x0}, - 46: {lang: 0x10d, script: 0x57, flags: 0x0}, - 48: {lang: 0x367, script: 0x57, flags: 0x0}, - 49: {lang: 0x444, script: 0x57, flags: 0x0}, - 50: {lang: 0x58, script: 0x57, flags: 0x0}, - 51: {lang: 0x6, script: 0x2, flags: 0x1}, - 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x57, flags: 0x0}, - 55: {lang: 0x15e, script: 0x57, flags: 0x0}, - 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, - 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, - 59: {lang: 0x15e, script: 0x57, flags: 0x0}, - 60: {lang: 0x15e, script: 0x57, flags: 0x0}, - 62: {lang: 0x31f, script: 0x57, flags: 0x0}, - 63: {lang: 0x13e, script: 0x57, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x57, flags: 0x0}, - 71: {lang: 0x71, script: 0x1f, flags: 0x0}, - 73: {lang: 0x512, script: 0x3b, flags: 0x2}, - 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x57, flags: 0x0}, - 76: {lang: 0x15e, script: 0x57, flags: 0x0}, - 77: {lang: 0x15e, script: 0x57, flags: 0x0}, - 78: {lang: 0x10d, script: 0x57, flags: 0x0}, - 79: {lang: 0x15e, script: 0x57, flags: 0x0}, - 81: {lang: 0x13e, script: 0x57, flags: 0x0}, - 82: {lang: 0x15e, script: 0x57, flags: 0x0}, - 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x57, flags: 0x0}, - 85: {lang: 0x0, script: 0x57, flags: 0x0}, - 86: {lang: 0x13e, script: 0x57, flags: 0x0}, - 89: {lang: 0x13e, script: 0x57, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x57, flags: 0x0}, - 96: {lang: 0x10d, script: 0x57, flags: 0x0}, - 98: {lang: 0x1, script: 0x57, flags: 0x0}, - 99: {lang: 0x101, script: 0x57, flags: 0x0}, - 101: {lang: 0x13e, script: 0x57, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x57, flags: 0x0}, - 105: {lang: 0x13e, script: 0x57, flags: 0x0}, - 106: {lang: 0x140, script: 0x57, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, - 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x29, flags: 0x0}, - 110: {lang: 0x13e, script: 0x57, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x57, flags: 0x0}, - 114: {lang: 0x151, script: 0x57, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, - 118: {lang: 0x158, script: 0x57, flags: 0x0}, - 120: {lang: 0x15e, script: 0x57, flags: 0x0}, - 122: {lang: 0x15e, script: 0x57, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x57, flags: 0x0}, - 128: {lang: 0x21, script: 0x57, flags: 0x0}, - 130: {lang: 0x245, script: 0x57, flags: 0x0}, - 132: {lang: 0x15e, script: 0x57, flags: 0x0}, - 133: {lang: 0x15e, script: 0x57, flags: 0x0}, - 134: {lang: 0x13e, script: 0x57, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x57, flags: 0x0}, - 137: {lang: 0x13e, script: 0x57, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 141: {lang: 0x529, script: 0x39, flags: 0x0}, - 142: {lang: 0x0, script: 0x57, flags: 0x0}, - 143: {lang: 0x13e, script: 0x57, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, - 148: {lang: 0x13e, script: 0x57, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x46, flags: 0x0}, - 164: {lang: 0x445, script: 0x57, flags: 0x0}, - 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x50, flags: 0x0}, - 171: {lang: 0x254, script: 0x50, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x57, flags: 0x0}, - 179: {lang: 0x40c, script: 0xca, flags: 0x0}, - 181: {lang: 0x43b, script: 0x57, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, - 183: {lang: 0x15e, script: 0x57, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x57, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x57, flags: 0x0}, - 190: {lang: 0x15e, script: 0x57, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x57, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x57, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x57, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xde, flags: 0x0}, - 207: {lang: 0x13e, script: 0x57, flags: 0x0}, - 208: {lang: 0x31f, script: 0x57, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 210: {lang: 0x16, script: 0x57, flags: 0x0}, - 211: {lang: 0x15e, script: 0x57, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x57, flags: 0x0}, - 217: {lang: 0x367, script: 0x57, flags: 0x0}, - 218: {lang: 0x347, script: 0x57, flags: 0x0}, - 219: {lang: 0x351, script: 0x21, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x57, flags: 0x0}, - 228: {lang: 0x13e, script: 0x57, flags: 0x0}, - 229: {lang: 0x15e, script: 0x57, flags: 0x0}, - 230: {lang: 0x486, script: 0x57, flags: 0x0}, - 231: {lang: 0x153, script: 0x57, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, - 234: {lang: 0x15e, script: 0x57, flags: 0x0}, - 236: {lang: 0x13e, script: 0x57, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, - 241: {lang: 0x194, script: 0x57, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x57, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x1f, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x57, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x57, flags: 0x0}, - 272: {lang: 0x347, script: 0x57, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 276: {lang: 0x15e, script: 0x57, flags: 0x0}, - 277: {lang: 0x429, script: 0x57, flags: 0x0}, - 278: {lang: 0x367, script: 0x57, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 282: {lang: 0x13e, script: 0x57, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x57, flags: 0x0}, - 289: {lang: 0x15e, script: 0x57, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x57, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 295: {lang: 0x476, script: 0x57, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x57, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x57, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x57, flags: 0x0}, - 309: {lang: 0x512, script: 0x3b, flags: 0x2}, - 310: {lang: 0x13e, script: 0x57, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 315: {lang: 0x13e, script: 0x57, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, - 319: {lang: 0x8a, script: 0x57, flags: 0x0}, - 320: {lang: 0x15e, script: 0x57, flags: 0x0}, - 322: {lang: 0x41b, script: 0x57, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x57, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 372 bytes, 93 elements -var likelyRegionList = [93]likelyLangScript{ - 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x57, flags: 0x0}, - 2: {lang: 0x431, script: 0x57, flags: 0x0}, - 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x57, flags: 0x0}, - 6: {lang: 0xb7, script: 0x57, flags: 0x0}, - 7: {lang: 0x432, script: 0x1f, flags: 0x0}, - 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, - 9: {lang: 0x351, script: 0x21, flags: 0x0}, - 10: {lang: 0x529, script: 0x38, flags: 0x0}, - 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x57, flags: 0x0}, - 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, - 14: {lang: 0x136, script: 0x31, flags: 0x0}, - 15: {lang: 0x48a, script: 0x57, flags: 0x0}, - 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x57, flags: 0x0}, - 18: {lang: 0x27, script: 0x29, flags: 0x0}, - 19: {lang: 0x139, script: 0x57, flags: 0x0}, - 20: {lang: 0x26a, script: 0x5, flags: 0x2}, - 21: {lang: 0x512, script: 0x3b, flags: 0x2}, - 22: {lang: 0x210, script: 0x2b, flags: 0x0}, - 23: {lang: 0x5, script: 0x1f, flags: 0x0}, - 24: {lang: 0x274, script: 0x57, flags: 0x0}, - 25: {lang: 0x136, script: 0x31, flags: 0x0}, - 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, - 28: {lang: 0x31f, script: 0x5, flags: 0x0}, - 29: {lang: 0x1be, script: 0x21, flags: 0x0}, - 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x72, flags: 0x0}, - 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x57, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, - 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xdf, flags: 0x0}, - 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x57, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, - 40: {lang: 0x226, script: 0xdf, flags: 0x0}, - 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x57, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, - 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 46: {lang: 0x431, script: 0x57, flags: 0x0}, - 47: {lang: 0x331, script: 0x72, flags: 0x0}, - 48: {lang: 0x213, script: 0x57, flags: 0x0}, - 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, - 50: {lang: 0x242, script: 0x5, flags: 0x0}, - 51: {lang: 0x529, script: 0x39, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x57, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, - 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 57: {lang: 0x88, script: 0x21, flags: 0x0}, - 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 60: {lang: 0xbe, script: 0x21, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, - 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, - 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, - 64: {lang: 0x267, script: 0x57, flags: 0x0}, - 65: {lang: 0x444, script: 0x57, flags: 0x0}, - 66: {lang: 0x512, script: 0x3b, flags: 0x0}, - 67: {lang: 0x412, script: 0x57, flags: 0x0}, - 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x57, flags: 0x0}, - 71: {lang: 0x15e, script: 0x57, flags: 0x0}, - 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, - 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x72, flags: 0x0}, - 76: {lang: 0x467, script: 0x1f, flags: 0x0}, - 77: {lang: 0x148, script: 0x5, flags: 0x0}, - 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x57, flags: 0x0}, - 80: {lang: 0x48a, script: 0x57, flags: 0x0}, - 81: {lang: 0x58, script: 0x5, flags: 0x0}, - 82: {lang: 0x219, script: 0x1f, flags: 0x0}, - 83: {lang: 0x81, script: 0x31, flags: 0x0}, - 84: {lang: 0x529, script: 0x39, flags: 0x0}, - 85: {lang: 0x48c, script: 0x57, flags: 0x0}, - 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 87: {lang: 0x512, script: 0x3b, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, - 89: {lang: 0x431, script: 0x57, flags: 0x0}, - 90: {lang: 0x432, script: 0x1f, flags: 0x0}, - 91: {lang: 0x15e, script: 0x57, flags: 0x0}, - 92: {lang: 0x446, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint8 -} - -// Size: 198 bytes, 33 elements -var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x57}, - 2: {lang: 0x139, region: 0x135, script: 0x57}, - 3: {lang: 0x3c0, region: 0x41, script: 0x57}, - 4: {lang: 0x139, region: 0x2f, script: 0x57}, - 5: {lang: 0x139, region: 0xd6, script: 0x57}, - 6: {lang: 0x13e, region: 0xcf, script: 0x57}, - 7: {lang: 0x445, region: 0x12f, script: 0x57}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x57}, - 10: {lang: 0x139, region: 0x161, script: 0x57}, - 11: {lang: 0x139, region: 0x135, script: 0x57}, - 12: {lang: 0x139, region: 0x135, script: 0x57}, - 13: {lang: 0x13e, region: 0x59, script: 0x57}, - 14: {lang: 0x529, region: 0x53, script: 0x38}, - 15: {lang: 0x1be, region: 0x99, script: 0x21}, - 16: {lang: 0x1e1, region: 0x95, script: 0x57}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, - 18: {lang: 0x139, region: 0x2f, script: 0x57}, - 19: {lang: 0x139, region: 0xe6, script: 0x57}, - 20: {lang: 0x139, region: 0x8a, script: 0x57}, - 21: {lang: 0x41b, region: 0x142, script: 0x57}, - 22: {lang: 0x529, region: 0x53, script: 0x38}, - 23: {lang: 0x4bc, region: 0x137, script: 0x57}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, - 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, - 27: {lang: 0x139, region: 0x7b, script: 0x57}, - 28: {lang: 0x10d, region: 0x60, script: 0x57}, - 29: {lang: 0x139, region: 0xd6, script: 0x57}, - 30: {lang: 0x13e, region: 0x1f, script: 0x57}, - 31: {lang: 0x139, region: 0x9a, script: 0x57}, - 32: {lang: 0x139, region: 0x7b, script: 0x57}, -} - -// Size: 358 bytes, 358 elements -var regionToGroups = [358]uint8{ +var regionToGroups = []uint8{ // 357 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -3343,15 +98,14 @@ var regionToGroups = [358]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} + 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 381 bytes -// Size: 18 bytes, 3 elements -var paradigmLocales = [3][3]uint16{ +var paradigmLocales = [][3]uint16{ // 3 elements 0: [3]uint16{0x139, 0x0, 0x7b}, 1: [3]uint16{0x13e, 0x0, 0x1f}, 2: [3]uint16{0x3c0, 0x41, 0xee}, -} +} // Size: 42 bytes type mutualIntelligibility struct { want uint16 @@ -3359,7 +113,6 @@ type mutualIntelligibility struct { distance uint8 oneway bool } - type scriptIntelligibility struct { wantLang uint16 haveLang uint16 @@ -3367,7 +120,6 @@ type scriptIntelligibility struct { haveScript uint8 distance uint8 } - type regionIntelligibility struct { lang uint16 script uint8 @@ -3378,8 +130,7 @@ type regionIntelligibility struct { // matchLang holds pairs of langIDs of base languages that are typically // mutually intelligible. Each pair is associated with a confidence and // whether the intelligibility goes one or both ways. -// Size: 678 bytes, 113 elements -var matchLang = [113]mutualIntelligibility{ +var matchLang = []mutualIntelligibility{ // 113 elements 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, @@ -3493,12 +244,11 @@ var matchLang = [113]mutualIntelligibility{ 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, -} +} // Size: 702 bytes // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. -// Size: 208 bytes, 26 elements -var matchScript = [26]scriptIntelligibility{ +var matchScript = []scriptIntelligibility{ // 26 elements 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5}, 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5}, 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, @@ -3525,10 +275,9 @@ var matchScript = [26]scriptIntelligibility{ 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13}, -} +} // Size: 232 bytes -// Size: 90 bytes, 15 elements -var matchRegion = [15]regionIntelligibility{ +var matchRegion = []regionIntelligibility{ // 15 elements 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, @@ -3544,143 +293,6 @@ var matchRegion = [15]regionIntelligibility{ 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, 14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5}, -} - -// Size: 264 bytes, 33 elements -var regionContainment = [33]uint64{ - // Entry 0 - 1F - 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, - 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, - 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, - 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, - 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, - 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, - 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, - // Entry 20 - 3F - 0x0000000100000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, - 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, - 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, - 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, - // Entry 40 - 7F - 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, - 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, - // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, - // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, - // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 584 bytes, 73 elements -var regionInclusionBits = [73]uint64{ - // Entry 0 - 1F - 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, - 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, - 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, - 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, - 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, - 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, - 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, - 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, - // Entry 20 - 3F - 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, - 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, - 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, - 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, - 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, - 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, - 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, - // Entry 40 - 5F - 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, - 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, - 0x0000000102020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 73 bytes, 73 elements -var regionInclusionNext = [73]uint8{ - // Entry 0 - 3F - 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, - 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, - 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, - 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, - 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, - 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, - // Entry 40 - 7F - 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, - 0x43, -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, -} +} // Size: 114 bytes -// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5 +// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go index de30155a26..42ea792666 100644 --- a/vendor/golang.org/x/text/language/tags.go +++ b/vendor/golang.org/x/text/language/tags.go @@ -4,6 +4,8 @@ package language +import "golang.org/x/text/internal/language/compact" + // TODO: Various sets of commonly use tags and regions. // MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. @@ -61,83 +63,83 @@ var ( Und Tag = Tag{} - Afrikaans Tag = Tag{lang: _af} // af - Amharic Tag = Tag{lang: _am} // am - Arabic Tag = Tag{lang: _ar} // ar - ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001 - Azerbaijani Tag = Tag{lang: _az} // az - Bulgarian Tag = Tag{lang: _bg} // bg - Bengali Tag = Tag{lang: _bn} // bn - Catalan Tag = Tag{lang: _ca} // ca - Czech Tag = Tag{lang: _cs} // cs - Danish Tag = Tag{lang: _da} // da - German Tag = Tag{lang: _de} // de - Greek Tag = Tag{lang: _el} // el - English Tag = Tag{lang: _en} // en - AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US - BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB - Spanish Tag = Tag{lang: _es} // es - EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES - LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419 - Estonian Tag = Tag{lang: _et} // et - Persian Tag = Tag{lang: _fa} // fa - Finnish Tag = Tag{lang: _fi} // fi - Filipino Tag = Tag{lang: _fil} // fil - French Tag = Tag{lang: _fr} // fr - CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA - Gujarati Tag = Tag{lang: _gu} // gu - Hebrew Tag = Tag{lang: _he} // he - Hindi Tag = Tag{lang: _hi} // hi - Croatian Tag = Tag{lang: _hr} // hr - Hungarian Tag = Tag{lang: _hu} // hu - Armenian Tag = Tag{lang: _hy} // hy - Indonesian Tag = Tag{lang: _id} // id - Icelandic Tag = Tag{lang: _is} // is - Italian Tag = Tag{lang: _it} // it - Japanese Tag = Tag{lang: _ja} // ja - Georgian Tag = Tag{lang: _ka} // ka - Kazakh Tag = Tag{lang: _kk} // kk - Khmer Tag = Tag{lang: _km} // km - Kannada Tag = Tag{lang: _kn} // kn - Korean Tag = Tag{lang: _ko} // ko - Kirghiz Tag = Tag{lang: _ky} // ky - Lao Tag = Tag{lang: _lo} // lo - Lithuanian Tag = Tag{lang: _lt} // lt - Latvian Tag = Tag{lang: _lv} // lv - Macedonian Tag = Tag{lang: _mk} // mk - Malayalam Tag = Tag{lang: _ml} // ml - Mongolian Tag = Tag{lang: _mn} // mn - Marathi Tag = Tag{lang: _mr} // mr - Malay Tag = Tag{lang: _ms} // ms - Burmese Tag = Tag{lang: _my} // my - Nepali Tag = Tag{lang: _ne} // ne - Dutch Tag = Tag{lang: _nl} // nl - Norwegian Tag = Tag{lang: _no} // no - Punjabi Tag = Tag{lang: _pa} // pa - Polish Tag = Tag{lang: _pl} // pl - Portuguese Tag = Tag{lang: _pt} // pt - BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR - EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT - Romanian Tag = Tag{lang: _ro} // ro - Russian Tag = Tag{lang: _ru} // ru - Sinhala Tag = Tag{lang: _si} // si - Slovak Tag = Tag{lang: _sk} // sk - Slovenian Tag = Tag{lang: _sl} // sl - Albanian Tag = Tag{lang: _sq} // sq - Serbian Tag = Tag{lang: _sr} // sr - SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn - Swedish Tag = Tag{lang: _sv} // sv - Swahili Tag = Tag{lang: _sw} // sw - Tamil Tag = Tag{lang: _ta} // ta - Telugu Tag = Tag{lang: _te} // te - Thai Tag = Tag{lang: _th} // th - Turkish Tag = Tag{lang: _tr} // tr - Ukrainian Tag = Tag{lang: _uk} // uk - Urdu Tag = Tag{lang: _ur} // ur - Uzbek Tag = Tag{lang: _uz} // uz - Vietnamese Tag = Tag{lang: _vi} // vi - Chinese Tag = Tag{lang: _zh} // zh - SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans - TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant - Zulu Tag = Tag{lang: _zu} // zu + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) ) diff --git a/vendor/golang.org/x/text/transform/transform.go b/vendor/golang.org/x/text/transform/transform.go index fe47b9b35f..919e3d950e 100644 --- a/vendor/golang.org/x/text/transform/transform.go +++ b/vendor/golang.org/x/text/transform/transform.go @@ -78,8 +78,8 @@ type SpanningTransformer interface { // considering the error err. // // A nil error means that all input bytes are known to be identical to the - // output produced by the Transformer. A nil error can be be returned - // regardless of whether atEOF is true. If err is nil, then then n must + // output produced by the Transformer. A nil error can be returned + // regardless of whether atEOF is true. If err is nil, then n must // equal len(src); the converse is not necessarily true. // // ErrEndOfSpan means that the Transformer output may differ from the diff --git a/vendor/golang.org/x/text/unicode/bidi/bidi.go b/vendor/golang.org/x/text/unicode/bidi/bidi.go index 3fc4a62521..e8edc54cc2 100644 --- a/vendor/golang.org/x/text/unicode/bidi/bidi.go +++ b/vendor/golang.org/x/text/unicode/bidi/bidi.go @@ -6,7 +6,7 @@ // Package bidi contains functionality for bidirectional text support. // -// See http://www.unicode.org/reports/tr9. +// See https://www.unicode.org/reports/tr9. // // NOTE: UNDER CONSTRUCTION. This API may change in backwards incompatible ways // and without notice. diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go index 601e259203..1853939791 100644 --- a/vendor/golang.org/x/text/unicode/bidi/bracket.go +++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go @@ -12,7 +12,7 @@ import ( // This file contains a port of the reference implementation of the // Bidi Parentheses Algorithm: -// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java +// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java // // The implementation in this file covers definitions BD14-BD16 and rule N0 // of UAX#9. @@ -246,7 +246,7 @@ func (p *bracketPairer) getStrongTypeN0(index int) Class { // assuming the given embedding direction. // // It returns ON if no strong type is found. If a single strong type is found, -// it returns this this type. Otherwise it returns the embedding direction. +// it returns this type. Otherwise it returns the embedding direction. // // TODO: use separate type for "strong" directionality. func (p *bracketPairer) classifyPairContent(loc bracketPair, dirEmbed Class) Class { diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go index d4c1399f0d..48d144008a 100644 --- a/vendor/golang.org/x/text/unicode/bidi/core.go +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -7,7 +7,7 @@ package bidi import "log" // This implementation is a port based on the reference implementation found at: -// http://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/ +// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/ // // described in Unicode Bidirectional Algorithm (UAX #9). // diff --git a/vendor/golang.org/x/text/unicode/norm/composition.go b/vendor/golang.org/x/text/unicode/norm/composition.go index bab4c5de02..e2087bce52 100644 --- a/vendor/golang.org/x/text/unicode/norm/composition.go +++ b/vendor/golang.org/x/text/unicode/norm/composition.go @@ -407,7 +407,7 @@ func decomposeHangul(buf []byte, r rune) int { // decomposeHangul algorithmically decomposes a Hangul rune into // its Jamo components. -// See http://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul. +// See https://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul. func (rb *reorderBuffer) decomposeHangul(r rune) { r -= hangulBase x := r % jamoTCount @@ -420,7 +420,7 @@ func (rb *reorderBuffer) decomposeHangul(r rune) { } // combineHangul algorithmically combines Jamo character components into Hangul. -// See http://unicode.org/reports/tr15/#Hangul for details on combining Hangul. +// See https://unicode.org/reports/tr15/#Hangul for details on combining Hangul. func (rb *reorderBuffer) combineHangul(s, i, k int) { b := rb.rune[:] bn := rb.nrune @@ -461,6 +461,10 @@ func (rb *reorderBuffer) combineHangul(s, i, k int) { // It should only be used to recompose a single segment, as it will not // handle alternations between Hangul and non-Hangul characters correctly. func (rb *reorderBuffer) compose() { + // Lazily load the map used by the combine func below, but do + // it outside of the loop. + recompMapOnce.Do(buildRecompMap) + // UAX #15, section X5 , including Corrigendum #5 // "In any character sequence beginning with starter S, a character C is // blocked from S if and only if there is some character B between S diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index e67e7655c5..526c7033ac 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -4,6 +4,8 @@ package norm +import "encoding/binary" + // This file contains Form-specific logic and wrappers for data in tables.go. // Rune info is stored in a separate trie per composing form. A composing form @@ -178,6 +180,17 @@ func (p Properties) TrailCCC() uint8 { return ccc[p.tccc] } +func buildRecompMap() { + recompMap = make(map[uint32]rune, len(recompMapPacked)/8) + var buf [8]byte + for i := 0; i < len(recompMapPacked); i += 8 { + copy(buf[:], recompMapPacked[i:i+8]) + key := binary.BigEndian.Uint32(buf[:4]) + val := binary.BigEndian.Uint32(buf[4:]) + recompMap[key] = rune(val) + } +} + // Recomposition // We use 32-bit keys instead of 64-bit for the two codepoint keys. // This clips off the bits of three entries, but we know this will not @@ -186,8 +199,14 @@ func (p Properties) TrailCCC() uint8 { // Note that the recomposition map for NFC and NFKC are identical. // combine returns the combined rune or 0 if it doesn't exist. +// +// The caller is responsible for calling +// recompMapOnce.Do(buildRecompMap) sometime before this is called. func combine(a, b rune) rune { key := uint32(uint16(a))<<16 + uint32(uint16(b)) + if recompMap == nil { + panic("caller error") // see func comment + } return recompMap[key] } diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go index ce17f96c2e..417c6b2689 100644 --- a/vendor/golang.org/x/text/unicode/norm/iter.go +++ b/vendor/golang.org/x/text/unicode/norm/iter.go @@ -128,8 +128,9 @@ func (i *Iter) Next() []byte { func nextASCIIBytes(i *Iter) []byte { p := i.p + 1 if p >= i.rb.nsrc { + p0 := i.p i.setDone() - return i.rb.src.bytes[i.p:p] + return i.rb.src.bytes[p0:p] } if i.rb.src.bytes[p] < utf8.RuneSelf { p0 := i.p diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index e28ac641ac..95efcf26e8 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -29,8 +29,8 @@ import ( // proceed independently on both sides: // f(x) == append(f(x[0:n]), f(x[n:])...) // -// References: http://unicode.org/reports/tr15/ and -// http://unicode.org/notes/tn5/. +// References: https://unicode.org/reports/tr15/ and +// https://unicode.org/notes/tn5/. type Form int const ( diff --git a/vendor/golang.org/x/text/unicode/norm/readwriter.go b/vendor/golang.org/x/text/unicode/norm/readwriter.go index d926ee903e..b38096f5ca 100644 --- a/vendor/golang.org/x/text/unicode/norm/readwriter.go +++ b/vendor/golang.org/x/text/unicode/norm/readwriter.go @@ -60,8 +60,8 @@ func (w *normWriter) Close() error { } // Writer returns a new writer that implements Write(b) -// by writing f(b) to w. The returned writer may use an -// an internal buffer to maintain state across Write calls. +// by writing f(b) to w. The returned writer may use an +// internal buffer to maintain state across Write calls. // Calling its Close method writes any buffered data to w. func (f Form) Writer(w io.Writer) io.WriteCloser { wr := &normWriter{rb: reorderBuffer{}, w: w} diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go index 44dd3978ca..c48a97b0c2 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go @@ -4,6 +4,8 @@ package norm +import "sync" + const ( // Version is the Unicode edition from which the tables are derived. Version = "10.0.0" @@ -6707,947 +6709,949 @@ var nfkcSparseValues = [869]valueRange{ } // recompMap: 7520 bytes (entries only) -var recompMap = map[uint32]rune{ - 0x00410300: 0x00C0, - 0x00410301: 0x00C1, - 0x00410302: 0x00C2, - 0x00410303: 0x00C3, - 0x00410308: 0x00C4, - 0x0041030A: 0x00C5, - 0x00430327: 0x00C7, - 0x00450300: 0x00C8, - 0x00450301: 0x00C9, - 0x00450302: 0x00CA, - 0x00450308: 0x00CB, - 0x00490300: 0x00CC, - 0x00490301: 0x00CD, - 0x00490302: 0x00CE, - 0x00490308: 0x00CF, - 0x004E0303: 0x00D1, - 0x004F0300: 0x00D2, - 0x004F0301: 0x00D3, - 0x004F0302: 0x00D4, - 0x004F0303: 0x00D5, - 0x004F0308: 0x00D6, - 0x00550300: 0x00D9, - 0x00550301: 0x00DA, - 0x00550302: 0x00DB, - 0x00550308: 0x00DC, - 0x00590301: 0x00DD, - 0x00610300: 0x00E0, - 0x00610301: 0x00E1, - 0x00610302: 0x00E2, - 0x00610303: 0x00E3, - 0x00610308: 0x00E4, - 0x0061030A: 0x00E5, - 0x00630327: 0x00E7, - 0x00650300: 0x00E8, - 0x00650301: 0x00E9, - 0x00650302: 0x00EA, - 0x00650308: 0x00EB, - 0x00690300: 0x00EC, - 0x00690301: 0x00ED, - 0x00690302: 0x00EE, - 0x00690308: 0x00EF, - 0x006E0303: 0x00F1, - 0x006F0300: 0x00F2, - 0x006F0301: 0x00F3, - 0x006F0302: 0x00F4, - 0x006F0303: 0x00F5, - 0x006F0308: 0x00F6, - 0x00750300: 0x00F9, - 0x00750301: 0x00FA, - 0x00750302: 0x00FB, - 0x00750308: 0x00FC, - 0x00790301: 0x00FD, - 0x00790308: 0x00FF, - 0x00410304: 0x0100, - 0x00610304: 0x0101, - 0x00410306: 0x0102, - 0x00610306: 0x0103, - 0x00410328: 0x0104, - 0x00610328: 0x0105, - 0x00430301: 0x0106, - 0x00630301: 0x0107, - 0x00430302: 0x0108, - 0x00630302: 0x0109, - 0x00430307: 0x010A, - 0x00630307: 0x010B, - 0x0043030C: 0x010C, - 0x0063030C: 0x010D, - 0x0044030C: 0x010E, - 0x0064030C: 0x010F, - 0x00450304: 0x0112, - 0x00650304: 0x0113, - 0x00450306: 0x0114, - 0x00650306: 0x0115, - 0x00450307: 0x0116, - 0x00650307: 0x0117, - 0x00450328: 0x0118, - 0x00650328: 0x0119, - 0x0045030C: 0x011A, - 0x0065030C: 0x011B, - 0x00470302: 0x011C, - 0x00670302: 0x011D, - 0x00470306: 0x011E, - 0x00670306: 0x011F, - 0x00470307: 0x0120, - 0x00670307: 0x0121, - 0x00470327: 0x0122, - 0x00670327: 0x0123, - 0x00480302: 0x0124, - 0x00680302: 0x0125, - 0x00490303: 0x0128, - 0x00690303: 0x0129, - 0x00490304: 0x012A, - 0x00690304: 0x012B, - 0x00490306: 0x012C, - 0x00690306: 0x012D, - 0x00490328: 0x012E, - 0x00690328: 0x012F, - 0x00490307: 0x0130, - 0x004A0302: 0x0134, - 0x006A0302: 0x0135, - 0x004B0327: 0x0136, - 0x006B0327: 0x0137, - 0x004C0301: 0x0139, - 0x006C0301: 0x013A, - 0x004C0327: 0x013B, - 0x006C0327: 0x013C, - 0x004C030C: 0x013D, - 0x006C030C: 0x013E, - 0x004E0301: 0x0143, - 0x006E0301: 0x0144, - 0x004E0327: 0x0145, - 0x006E0327: 0x0146, - 0x004E030C: 0x0147, - 0x006E030C: 0x0148, - 0x004F0304: 0x014C, - 0x006F0304: 0x014D, - 0x004F0306: 0x014E, - 0x006F0306: 0x014F, - 0x004F030B: 0x0150, - 0x006F030B: 0x0151, - 0x00520301: 0x0154, - 0x00720301: 0x0155, - 0x00520327: 0x0156, - 0x00720327: 0x0157, - 0x0052030C: 0x0158, - 0x0072030C: 0x0159, - 0x00530301: 0x015A, - 0x00730301: 0x015B, - 0x00530302: 0x015C, - 0x00730302: 0x015D, - 0x00530327: 0x015E, - 0x00730327: 0x015F, - 0x0053030C: 0x0160, - 0x0073030C: 0x0161, - 0x00540327: 0x0162, - 0x00740327: 0x0163, - 0x0054030C: 0x0164, - 0x0074030C: 0x0165, - 0x00550303: 0x0168, - 0x00750303: 0x0169, - 0x00550304: 0x016A, - 0x00750304: 0x016B, - 0x00550306: 0x016C, - 0x00750306: 0x016D, - 0x0055030A: 0x016E, - 0x0075030A: 0x016F, - 0x0055030B: 0x0170, - 0x0075030B: 0x0171, - 0x00550328: 0x0172, - 0x00750328: 0x0173, - 0x00570302: 0x0174, - 0x00770302: 0x0175, - 0x00590302: 0x0176, - 0x00790302: 0x0177, - 0x00590308: 0x0178, - 0x005A0301: 0x0179, - 0x007A0301: 0x017A, - 0x005A0307: 0x017B, - 0x007A0307: 0x017C, - 0x005A030C: 0x017D, - 0x007A030C: 0x017E, - 0x004F031B: 0x01A0, - 0x006F031B: 0x01A1, - 0x0055031B: 0x01AF, - 0x0075031B: 0x01B0, - 0x0041030C: 0x01CD, - 0x0061030C: 0x01CE, - 0x0049030C: 0x01CF, - 0x0069030C: 0x01D0, - 0x004F030C: 0x01D1, - 0x006F030C: 0x01D2, - 0x0055030C: 0x01D3, - 0x0075030C: 0x01D4, - 0x00DC0304: 0x01D5, - 0x00FC0304: 0x01D6, - 0x00DC0301: 0x01D7, - 0x00FC0301: 0x01D8, - 0x00DC030C: 0x01D9, - 0x00FC030C: 0x01DA, - 0x00DC0300: 0x01DB, - 0x00FC0300: 0x01DC, - 0x00C40304: 0x01DE, - 0x00E40304: 0x01DF, - 0x02260304: 0x01E0, - 0x02270304: 0x01E1, - 0x00C60304: 0x01E2, - 0x00E60304: 0x01E3, - 0x0047030C: 0x01E6, - 0x0067030C: 0x01E7, - 0x004B030C: 0x01E8, - 0x006B030C: 0x01E9, - 0x004F0328: 0x01EA, - 0x006F0328: 0x01EB, - 0x01EA0304: 0x01EC, - 0x01EB0304: 0x01ED, - 0x01B7030C: 0x01EE, - 0x0292030C: 0x01EF, - 0x006A030C: 0x01F0, - 0x00470301: 0x01F4, - 0x00670301: 0x01F5, - 0x004E0300: 0x01F8, - 0x006E0300: 0x01F9, - 0x00C50301: 0x01FA, - 0x00E50301: 0x01FB, - 0x00C60301: 0x01FC, - 0x00E60301: 0x01FD, - 0x00D80301: 0x01FE, - 0x00F80301: 0x01FF, - 0x0041030F: 0x0200, - 0x0061030F: 0x0201, - 0x00410311: 0x0202, - 0x00610311: 0x0203, - 0x0045030F: 0x0204, - 0x0065030F: 0x0205, - 0x00450311: 0x0206, - 0x00650311: 0x0207, - 0x0049030F: 0x0208, - 0x0069030F: 0x0209, - 0x00490311: 0x020A, - 0x00690311: 0x020B, - 0x004F030F: 0x020C, - 0x006F030F: 0x020D, - 0x004F0311: 0x020E, - 0x006F0311: 0x020F, - 0x0052030F: 0x0210, - 0x0072030F: 0x0211, - 0x00520311: 0x0212, - 0x00720311: 0x0213, - 0x0055030F: 0x0214, - 0x0075030F: 0x0215, - 0x00550311: 0x0216, - 0x00750311: 0x0217, - 0x00530326: 0x0218, - 0x00730326: 0x0219, - 0x00540326: 0x021A, - 0x00740326: 0x021B, - 0x0048030C: 0x021E, - 0x0068030C: 0x021F, - 0x00410307: 0x0226, - 0x00610307: 0x0227, - 0x00450327: 0x0228, - 0x00650327: 0x0229, - 0x00D60304: 0x022A, - 0x00F60304: 0x022B, - 0x00D50304: 0x022C, - 0x00F50304: 0x022D, - 0x004F0307: 0x022E, - 0x006F0307: 0x022F, - 0x022E0304: 0x0230, - 0x022F0304: 0x0231, - 0x00590304: 0x0232, - 0x00790304: 0x0233, - 0x00A80301: 0x0385, - 0x03910301: 0x0386, - 0x03950301: 0x0388, - 0x03970301: 0x0389, - 0x03990301: 0x038A, - 0x039F0301: 0x038C, - 0x03A50301: 0x038E, - 0x03A90301: 0x038F, - 0x03CA0301: 0x0390, - 0x03990308: 0x03AA, - 0x03A50308: 0x03AB, - 0x03B10301: 0x03AC, - 0x03B50301: 0x03AD, - 0x03B70301: 0x03AE, - 0x03B90301: 0x03AF, - 0x03CB0301: 0x03B0, - 0x03B90308: 0x03CA, - 0x03C50308: 0x03CB, - 0x03BF0301: 0x03CC, - 0x03C50301: 0x03CD, - 0x03C90301: 0x03CE, - 0x03D20301: 0x03D3, - 0x03D20308: 0x03D4, - 0x04150300: 0x0400, - 0x04150308: 0x0401, - 0x04130301: 0x0403, - 0x04060308: 0x0407, - 0x041A0301: 0x040C, - 0x04180300: 0x040D, - 0x04230306: 0x040E, - 0x04180306: 0x0419, - 0x04380306: 0x0439, - 0x04350300: 0x0450, - 0x04350308: 0x0451, - 0x04330301: 0x0453, - 0x04560308: 0x0457, - 0x043A0301: 0x045C, - 0x04380300: 0x045D, - 0x04430306: 0x045E, - 0x0474030F: 0x0476, - 0x0475030F: 0x0477, - 0x04160306: 0x04C1, - 0x04360306: 0x04C2, - 0x04100306: 0x04D0, - 0x04300306: 0x04D1, - 0x04100308: 0x04D2, - 0x04300308: 0x04D3, - 0x04150306: 0x04D6, - 0x04350306: 0x04D7, - 0x04D80308: 0x04DA, - 0x04D90308: 0x04DB, - 0x04160308: 0x04DC, - 0x04360308: 0x04DD, - 0x04170308: 0x04DE, - 0x04370308: 0x04DF, - 0x04180304: 0x04E2, - 0x04380304: 0x04E3, - 0x04180308: 0x04E4, - 0x04380308: 0x04E5, - 0x041E0308: 0x04E6, - 0x043E0308: 0x04E7, - 0x04E80308: 0x04EA, - 0x04E90308: 0x04EB, - 0x042D0308: 0x04EC, - 0x044D0308: 0x04ED, - 0x04230304: 0x04EE, - 0x04430304: 0x04EF, - 0x04230308: 0x04F0, - 0x04430308: 0x04F1, - 0x0423030B: 0x04F2, - 0x0443030B: 0x04F3, - 0x04270308: 0x04F4, - 0x04470308: 0x04F5, - 0x042B0308: 0x04F8, - 0x044B0308: 0x04F9, - 0x06270653: 0x0622, - 0x06270654: 0x0623, - 0x06480654: 0x0624, - 0x06270655: 0x0625, - 0x064A0654: 0x0626, - 0x06D50654: 0x06C0, - 0x06C10654: 0x06C2, - 0x06D20654: 0x06D3, - 0x0928093C: 0x0929, - 0x0930093C: 0x0931, - 0x0933093C: 0x0934, - 0x09C709BE: 0x09CB, - 0x09C709D7: 0x09CC, - 0x0B470B56: 0x0B48, - 0x0B470B3E: 0x0B4B, - 0x0B470B57: 0x0B4C, - 0x0B920BD7: 0x0B94, - 0x0BC60BBE: 0x0BCA, - 0x0BC70BBE: 0x0BCB, - 0x0BC60BD7: 0x0BCC, - 0x0C460C56: 0x0C48, - 0x0CBF0CD5: 0x0CC0, - 0x0CC60CD5: 0x0CC7, - 0x0CC60CD6: 0x0CC8, - 0x0CC60CC2: 0x0CCA, - 0x0CCA0CD5: 0x0CCB, - 0x0D460D3E: 0x0D4A, - 0x0D470D3E: 0x0D4B, - 0x0D460D57: 0x0D4C, - 0x0DD90DCA: 0x0DDA, - 0x0DD90DCF: 0x0DDC, - 0x0DDC0DCA: 0x0DDD, - 0x0DD90DDF: 0x0DDE, - 0x1025102E: 0x1026, - 0x1B051B35: 0x1B06, - 0x1B071B35: 0x1B08, - 0x1B091B35: 0x1B0A, - 0x1B0B1B35: 0x1B0C, - 0x1B0D1B35: 0x1B0E, - 0x1B111B35: 0x1B12, - 0x1B3A1B35: 0x1B3B, - 0x1B3C1B35: 0x1B3D, - 0x1B3E1B35: 0x1B40, - 0x1B3F1B35: 0x1B41, - 0x1B421B35: 0x1B43, - 0x00410325: 0x1E00, - 0x00610325: 0x1E01, - 0x00420307: 0x1E02, - 0x00620307: 0x1E03, - 0x00420323: 0x1E04, - 0x00620323: 0x1E05, - 0x00420331: 0x1E06, - 0x00620331: 0x1E07, - 0x00C70301: 0x1E08, - 0x00E70301: 0x1E09, - 0x00440307: 0x1E0A, - 0x00640307: 0x1E0B, - 0x00440323: 0x1E0C, - 0x00640323: 0x1E0D, - 0x00440331: 0x1E0E, - 0x00640331: 0x1E0F, - 0x00440327: 0x1E10, - 0x00640327: 0x1E11, - 0x0044032D: 0x1E12, - 0x0064032D: 0x1E13, - 0x01120300: 0x1E14, - 0x01130300: 0x1E15, - 0x01120301: 0x1E16, - 0x01130301: 0x1E17, - 0x0045032D: 0x1E18, - 0x0065032D: 0x1E19, - 0x00450330: 0x1E1A, - 0x00650330: 0x1E1B, - 0x02280306: 0x1E1C, - 0x02290306: 0x1E1D, - 0x00460307: 0x1E1E, - 0x00660307: 0x1E1F, - 0x00470304: 0x1E20, - 0x00670304: 0x1E21, - 0x00480307: 0x1E22, - 0x00680307: 0x1E23, - 0x00480323: 0x1E24, - 0x00680323: 0x1E25, - 0x00480308: 0x1E26, - 0x00680308: 0x1E27, - 0x00480327: 0x1E28, - 0x00680327: 0x1E29, - 0x0048032E: 0x1E2A, - 0x0068032E: 0x1E2B, - 0x00490330: 0x1E2C, - 0x00690330: 0x1E2D, - 0x00CF0301: 0x1E2E, - 0x00EF0301: 0x1E2F, - 0x004B0301: 0x1E30, - 0x006B0301: 0x1E31, - 0x004B0323: 0x1E32, - 0x006B0323: 0x1E33, - 0x004B0331: 0x1E34, - 0x006B0331: 0x1E35, - 0x004C0323: 0x1E36, - 0x006C0323: 0x1E37, - 0x1E360304: 0x1E38, - 0x1E370304: 0x1E39, - 0x004C0331: 0x1E3A, - 0x006C0331: 0x1E3B, - 0x004C032D: 0x1E3C, - 0x006C032D: 0x1E3D, - 0x004D0301: 0x1E3E, - 0x006D0301: 0x1E3F, - 0x004D0307: 0x1E40, - 0x006D0307: 0x1E41, - 0x004D0323: 0x1E42, - 0x006D0323: 0x1E43, - 0x004E0307: 0x1E44, - 0x006E0307: 0x1E45, - 0x004E0323: 0x1E46, - 0x006E0323: 0x1E47, - 0x004E0331: 0x1E48, - 0x006E0331: 0x1E49, - 0x004E032D: 0x1E4A, - 0x006E032D: 0x1E4B, - 0x00D50301: 0x1E4C, - 0x00F50301: 0x1E4D, - 0x00D50308: 0x1E4E, - 0x00F50308: 0x1E4F, - 0x014C0300: 0x1E50, - 0x014D0300: 0x1E51, - 0x014C0301: 0x1E52, - 0x014D0301: 0x1E53, - 0x00500301: 0x1E54, - 0x00700301: 0x1E55, - 0x00500307: 0x1E56, - 0x00700307: 0x1E57, - 0x00520307: 0x1E58, - 0x00720307: 0x1E59, - 0x00520323: 0x1E5A, - 0x00720323: 0x1E5B, - 0x1E5A0304: 0x1E5C, - 0x1E5B0304: 0x1E5D, - 0x00520331: 0x1E5E, - 0x00720331: 0x1E5F, - 0x00530307: 0x1E60, - 0x00730307: 0x1E61, - 0x00530323: 0x1E62, - 0x00730323: 0x1E63, - 0x015A0307: 0x1E64, - 0x015B0307: 0x1E65, - 0x01600307: 0x1E66, - 0x01610307: 0x1E67, - 0x1E620307: 0x1E68, - 0x1E630307: 0x1E69, - 0x00540307: 0x1E6A, - 0x00740307: 0x1E6B, - 0x00540323: 0x1E6C, - 0x00740323: 0x1E6D, - 0x00540331: 0x1E6E, - 0x00740331: 0x1E6F, - 0x0054032D: 0x1E70, - 0x0074032D: 0x1E71, - 0x00550324: 0x1E72, - 0x00750324: 0x1E73, - 0x00550330: 0x1E74, - 0x00750330: 0x1E75, - 0x0055032D: 0x1E76, - 0x0075032D: 0x1E77, - 0x01680301: 0x1E78, - 0x01690301: 0x1E79, - 0x016A0308: 0x1E7A, - 0x016B0308: 0x1E7B, - 0x00560303: 0x1E7C, - 0x00760303: 0x1E7D, - 0x00560323: 0x1E7E, - 0x00760323: 0x1E7F, - 0x00570300: 0x1E80, - 0x00770300: 0x1E81, - 0x00570301: 0x1E82, - 0x00770301: 0x1E83, - 0x00570308: 0x1E84, - 0x00770308: 0x1E85, - 0x00570307: 0x1E86, - 0x00770307: 0x1E87, - 0x00570323: 0x1E88, - 0x00770323: 0x1E89, - 0x00580307: 0x1E8A, - 0x00780307: 0x1E8B, - 0x00580308: 0x1E8C, - 0x00780308: 0x1E8D, - 0x00590307: 0x1E8E, - 0x00790307: 0x1E8F, - 0x005A0302: 0x1E90, - 0x007A0302: 0x1E91, - 0x005A0323: 0x1E92, - 0x007A0323: 0x1E93, - 0x005A0331: 0x1E94, - 0x007A0331: 0x1E95, - 0x00680331: 0x1E96, - 0x00740308: 0x1E97, - 0x0077030A: 0x1E98, - 0x0079030A: 0x1E99, - 0x017F0307: 0x1E9B, - 0x00410323: 0x1EA0, - 0x00610323: 0x1EA1, - 0x00410309: 0x1EA2, - 0x00610309: 0x1EA3, - 0x00C20301: 0x1EA4, - 0x00E20301: 0x1EA5, - 0x00C20300: 0x1EA6, - 0x00E20300: 0x1EA7, - 0x00C20309: 0x1EA8, - 0x00E20309: 0x1EA9, - 0x00C20303: 0x1EAA, - 0x00E20303: 0x1EAB, - 0x1EA00302: 0x1EAC, - 0x1EA10302: 0x1EAD, - 0x01020301: 0x1EAE, - 0x01030301: 0x1EAF, - 0x01020300: 0x1EB0, - 0x01030300: 0x1EB1, - 0x01020309: 0x1EB2, - 0x01030309: 0x1EB3, - 0x01020303: 0x1EB4, - 0x01030303: 0x1EB5, - 0x1EA00306: 0x1EB6, - 0x1EA10306: 0x1EB7, - 0x00450323: 0x1EB8, - 0x00650323: 0x1EB9, - 0x00450309: 0x1EBA, - 0x00650309: 0x1EBB, - 0x00450303: 0x1EBC, - 0x00650303: 0x1EBD, - 0x00CA0301: 0x1EBE, - 0x00EA0301: 0x1EBF, - 0x00CA0300: 0x1EC0, - 0x00EA0300: 0x1EC1, - 0x00CA0309: 0x1EC2, - 0x00EA0309: 0x1EC3, - 0x00CA0303: 0x1EC4, - 0x00EA0303: 0x1EC5, - 0x1EB80302: 0x1EC6, - 0x1EB90302: 0x1EC7, - 0x00490309: 0x1EC8, - 0x00690309: 0x1EC9, - 0x00490323: 0x1ECA, - 0x00690323: 0x1ECB, - 0x004F0323: 0x1ECC, - 0x006F0323: 0x1ECD, - 0x004F0309: 0x1ECE, - 0x006F0309: 0x1ECF, - 0x00D40301: 0x1ED0, - 0x00F40301: 0x1ED1, - 0x00D40300: 0x1ED2, - 0x00F40300: 0x1ED3, - 0x00D40309: 0x1ED4, - 0x00F40309: 0x1ED5, - 0x00D40303: 0x1ED6, - 0x00F40303: 0x1ED7, - 0x1ECC0302: 0x1ED8, - 0x1ECD0302: 0x1ED9, - 0x01A00301: 0x1EDA, - 0x01A10301: 0x1EDB, - 0x01A00300: 0x1EDC, - 0x01A10300: 0x1EDD, - 0x01A00309: 0x1EDE, - 0x01A10309: 0x1EDF, - 0x01A00303: 0x1EE0, - 0x01A10303: 0x1EE1, - 0x01A00323: 0x1EE2, - 0x01A10323: 0x1EE3, - 0x00550323: 0x1EE4, - 0x00750323: 0x1EE5, - 0x00550309: 0x1EE6, - 0x00750309: 0x1EE7, - 0x01AF0301: 0x1EE8, - 0x01B00301: 0x1EE9, - 0x01AF0300: 0x1EEA, - 0x01B00300: 0x1EEB, - 0x01AF0309: 0x1EEC, - 0x01B00309: 0x1EED, - 0x01AF0303: 0x1EEE, - 0x01B00303: 0x1EEF, - 0x01AF0323: 0x1EF0, - 0x01B00323: 0x1EF1, - 0x00590300: 0x1EF2, - 0x00790300: 0x1EF3, - 0x00590323: 0x1EF4, - 0x00790323: 0x1EF5, - 0x00590309: 0x1EF6, - 0x00790309: 0x1EF7, - 0x00590303: 0x1EF8, - 0x00790303: 0x1EF9, - 0x03B10313: 0x1F00, - 0x03B10314: 0x1F01, - 0x1F000300: 0x1F02, - 0x1F010300: 0x1F03, - 0x1F000301: 0x1F04, - 0x1F010301: 0x1F05, - 0x1F000342: 0x1F06, - 0x1F010342: 0x1F07, - 0x03910313: 0x1F08, - 0x03910314: 0x1F09, - 0x1F080300: 0x1F0A, - 0x1F090300: 0x1F0B, - 0x1F080301: 0x1F0C, - 0x1F090301: 0x1F0D, - 0x1F080342: 0x1F0E, - 0x1F090342: 0x1F0F, - 0x03B50313: 0x1F10, - 0x03B50314: 0x1F11, - 0x1F100300: 0x1F12, - 0x1F110300: 0x1F13, - 0x1F100301: 0x1F14, - 0x1F110301: 0x1F15, - 0x03950313: 0x1F18, - 0x03950314: 0x1F19, - 0x1F180300: 0x1F1A, - 0x1F190300: 0x1F1B, - 0x1F180301: 0x1F1C, - 0x1F190301: 0x1F1D, - 0x03B70313: 0x1F20, - 0x03B70314: 0x1F21, - 0x1F200300: 0x1F22, - 0x1F210300: 0x1F23, - 0x1F200301: 0x1F24, - 0x1F210301: 0x1F25, - 0x1F200342: 0x1F26, - 0x1F210342: 0x1F27, - 0x03970313: 0x1F28, - 0x03970314: 0x1F29, - 0x1F280300: 0x1F2A, - 0x1F290300: 0x1F2B, - 0x1F280301: 0x1F2C, - 0x1F290301: 0x1F2D, - 0x1F280342: 0x1F2E, - 0x1F290342: 0x1F2F, - 0x03B90313: 0x1F30, - 0x03B90314: 0x1F31, - 0x1F300300: 0x1F32, - 0x1F310300: 0x1F33, - 0x1F300301: 0x1F34, - 0x1F310301: 0x1F35, - 0x1F300342: 0x1F36, - 0x1F310342: 0x1F37, - 0x03990313: 0x1F38, - 0x03990314: 0x1F39, - 0x1F380300: 0x1F3A, - 0x1F390300: 0x1F3B, - 0x1F380301: 0x1F3C, - 0x1F390301: 0x1F3D, - 0x1F380342: 0x1F3E, - 0x1F390342: 0x1F3F, - 0x03BF0313: 0x1F40, - 0x03BF0314: 0x1F41, - 0x1F400300: 0x1F42, - 0x1F410300: 0x1F43, - 0x1F400301: 0x1F44, - 0x1F410301: 0x1F45, - 0x039F0313: 0x1F48, - 0x039F0314: 0x1F49, - 0x1F480300: 0x1F4A, - 0x1F490300: 0x1F4B, - 0x1F480301: 0x1F4C, - 0x1F490301: 0x1F4D, - 0x03C50313: 0x1F50, - 0x03C50314: 0x1F51, - 0x1F500300: 0x1F52, - 0x1F510300: 0x1F53, - 0x1F500301: 0x1F54, - 0x1F510301: 0x1F55, - 0x1F500342: 0x1F56, - 0x1F510342: 0x1F57, - 0x03A50314: 0x1F59, - 0x1F590300: 0x1F5B, - 0x1F590301: 0x1F5D, - 0x1F590342: 0x1F5F, - 0x03C90313: 0x1F60, - 0x03C90314: 0x1F61, - 0x1F600300: 0x1F62, - 0x1F610300: 0x1F63, - 0x1F600301: 0x1F64, - 0x1F610301: 0x1F65, - 0x1F600342: 0x1F66, - 0x1F610342: 0x1F67, - 0x03A90313: 0x1F68, - 0x03A90314: 0x1F69, - 0x1F680300: 0x1F6A, - 0x1F690300: 0x1F6B, - 0x1F680301: 0x1F6C, - 0x1F690301: 0x1F6D, - 0x1F680342: 0x1F6E, - 0x1F690342: 0x1F6F, - 0x03B10300: 0x1F70, - 0x03B50300: 0x1F72, - 0x03B70300: 0x1F74, - 0x03B90300: 0x1F76, - 0x03BF0300: 0x1F78, - 0x03C50300: 0x1F7A, - 0x03C90300: 0x1F7C, - 0x1F000345: 0x1F80, - 0x1F010345: 0x1F81, - 0x1F020345: 0x1F82, - 0x1F030345: 0x1F83, - 0x1F040345: 0x1F84, - 0x1F050345: 0x1F85, - 0x1F060345: 0x1F86, - 0x1F070345: 0x1F87, - 0x1F080345: 0x1F88, - 0x1F090345: 0x1F89, - 0x1F0A0345: 0x1F8A, - 0x1F0B0345: 0x1F8B, - 0x1F0C0345: 0x1F8C, - 0x1F0D0345: 0x1F8D, - 0x1F0E0345: 0x1F8E, - 0x1F0F0345: 0x1F8F, - 0x1F200345: 0x1F90, - 0x1F210345: 0x1F91, - 0x1F220345: 0x1F92, - 0x1F230345: 0x1F93, - 0x1F240345: 0x1F94, - 0x1F250345: 0x1F95, - 0x1F260345: 0x1F96, - 0x1F270345: 0x1F97, - 0x1F280345: 0x1F98, - 0x1F290345: 0x1F99, - 0x1F2A0345: 0x1F9A, - 0x1F2B0345: 0x1F9B, - 0x1F2C0345: 0x1F9C, - 0x1F2D0345: 0x1F9D, - 0x1F2E0345: 0x1F9E, - 0x1F2F0345: 0x1F9F, - 0x1F600345: 0x1FA0, - 0x1F610345: 0x1FA1, - 0x1F620345: 0x1FA2, - 0x1F630345: 0x1FA3, - 0x1F640345: 0x1FA4, - 0x1F650345: 0x1FA5, - 0x1F660345: 0x1FA6, - 0x1F670345: 0x1FA7, - 0x1F680345: 0x1FA8, - 0x1F690345: 0x1FA9, - 0x1F6A0345: 0x1FAA, - 0x1F6B0345: 0x1FAB, - 0x1F6C0345: 0x1FAC, - 0x1F6D0345: 0x1FAD, - 0x1F6E0345: 0x1FAE, - 0x1F6F0345: 0x1FAF, - 0x03B10306: 0x1FB0, - 0x03B10304: 0x1FB1, - 0x1F700345: 0x1FB2, - 0x03B10345: 0x1FB3, - 0x03AC0345: 0x1FB4, - 0x03B10342: 0x1FB6, - 0x1FB60345: 0x1FB7, - 0x03910306: 0x1FB8, - 0x03910304: 0x1FB9, - 0x03910300: 0x1FBA, - 0x03910345: 0x1FBC, - 0x00A80342: 0x1FC1, - 0x1F740345: 0x1FC2, - 0x03B70345: 0x1FC3, - 0x03AE0345: 0x1FC4, - 0x03B70342: 0x1FC6, - 0x1FC60345: 0x1FC7, - 0x03950300: 0x1FC8, - 0x03970300: 0x1FCA, - 0x03970345: 0x1FCC, - 0x1FBF0300: 0x1FCD, - 0x1FBF0301: 0x1FCE, - 0x1FBF0342: 0x1FCF, - 0x03B90306: 0x1FD0, - 0x03B90304: 0x1FD1, - 0x03CA0300: 0x1FD2, - 0x03B90342: 0x1FD6, - 0x03CA0342: 0x1FD7, - 0x03990306: 0x1FD8, - 0x03990304: 0x1FD9, - 0x03990300: 0x1FDA, - 0x1FFE0300: 0x1FDD, - 0x1FFE0301: 0x1FDE, - 0x1FFE0342: 0x1FDF, - 0x03C50306: 0x1FE0, - 0x03C50304: 0x1FE1, - 0x03CB0300: 0x1FE2, - 0x03C10313: 0x1FE4, - 0x03C10314: 0x1FE5, - 0x03C50342: 0x1FE6, - 0x03CB0342: 0x1FE7, - 0x03A50306: 0x1FE8, - 0x03A50304: 0x1FE9, - 0x03A50300: 0x1FEA, - 0x03A10314: 0x1FEC, - 0x00A80300: 0x1FED, - 0x1F7C0345: 0x1FF2, - 0x03C90345: 0x1FF3, - 0x03CE0345: 0x1FF4, - 0x03C90342: 0x1FF6, - 0x1FF60345: 0x1FF7, - 0x039F0300: 0x1FF8, - 0x03A90300: 0x1FFA, - 0x03A90345: 0x1FFC, - 0x21900338: 0x219A, - 0x21920338: 0x219B, - 0x21940338: 0x21AE, - 0x21D00338: 0x21CD, - 0x21D40338: 0x21CE, - 0x21D20338: 0x21CF, - 0x22030338: 0x2204, - 0x22080338: 0x2209, - 0x220B0338: 0x220C, - 0x22230338: 0x2224, - 0x22250338: 0x2226, - 0x223C0338: 0x2241, - 0x22430338: 0x2244, - 0x22450338: 0x2247, - 0x22480338: 0x2249, - 0x003D0338: 0x2260, - 0x22610338: 0x2262, - 0x224D0338: 0x226D, - 0x003C0338: 0x226E, - 0x003E0338: 0x226F, - 0x22640338: 0x2270, - 0x22650338: 0x2271, - 0x22720338: 0x2274, - 0x22730338: 0x2275, - 0x22760338: 0x2278, - 0x22770338: 0x2279, - 0x227A0338: 0x2280, - 0x227B0338: 0x2281, - 0x22820338: 0x2284, - 0x22830338: 0x2285, - 0x22860338: 0x2288, - 0x22870338: 0x2289, - 0x22A20338: 0x22AC, - 0x22A80338: 0x22AD, - 0x22A90338: 0x22AE, - 0x22AB0338: 0x22AF, - 0x227C0338: 0x22E0, - 0x227D0338: 0x22E1, - 0x22910338: 0x22E2, - 0x22920338: 0x22E3, - 0x22B20338: 0x22EA, - 0x22B30338: 0x22EB, - 0x22B40338: 0x22EC, - 0x22B50338: 0x22ED, - 0x304B3099: 0x304C, - 0x304D3099: 0x304E, - 0x304F3099: 0x3050, - 0x30513099: 0x3052, - 0x30533099: 0x3054, - 0x30553099: 0x3056, - 0x30573099: 0x3058, - 0x30593099: 0x305A, - 0x305B3099: 0x305C, - 0x305D3099: 0x305E, - 0x305F3099: 0x3060, - 0x30613099: 0x3062, - 0x30643099: 0x3065, - 0x30663099: 0x3067, - 0x30683099: 0x3069, - 0x306F3099: 0x3070, - 0x306F309A: 0x3071, - 0x30723099: 0x3073, - 0x3072309A: 0x3074, - 0x30753099: 0x3076, - 0x3075309A: 0x3077, - 0x30783099: 0x3079, - 0x3078309A: 0x307A, - 0x307B3099: 0x307C, - 0x307B309A: 0x307D, - 0x30463099: 0x3094, - 0x309D3099: 0x309E, - 0x30AB3099: 0x30AC, - 0x30AD3099: 0x30AE, - 0x30AF3099: 0x30B0, - 0x30B13099: 0x30B2, - 0x30B33099: 0x30B4, - 0x30B53099: 0x30B6, - 0x30B73099: 0x30B8, - 0x30B93099: 0x30BA, - 0x30BB3099: 0x30BC, - 0x30BD3099: 0x30BE, - 0x30BF3099: 0x30C0, - 0x30C13099: 0x30C2, - 0x30C43099: 0x30C5, - 0x30C63099: 0x30C7, - 0x30C83099: 0x30C9, - 0x30CF3099: 0x30D0, - 0x30CF309A: 0x30D1, - 0x30D23099: 0x30D3, - 0x30D2309A: 0x30D4, - 0x30D53099: 0x30D6, - 0x30D5309A: 0x30D7, - 0x30D83099: 0x30D9, - 0x30D8309A: 0x30DA, - 0x30DB3099: 0x30DC, - 0x30DB309A: 0x30DD, - 0x30A63099: 0x30F4, - 0x30EF3099: 0x30F7, - 0x30F03099: 0x30F8, - 0x30F13099: 0x30F9, - 0x30F23099: 0x30FA, - 0x30FD3099: 0x30FE, - 0x109910BA: 0x1109A, - 0x109B10BA: 0x1109C, - 0x10A510BA: 0x110AB, - 0x11311127: 0x1112E, - 0x11321127: 0x1112F, - 0x1347133E: 0x1134B, - 0x13471357: 0x1134C, - 0x14B914BA: 0x114BB, - 0x14B914B0: 0x114BC, - 0x14B914BD: 0x114BE, - 0x15B815AF: 0x115BA, - 0x15B915AF: 0x115BB, -} +var recompMap map[uint32]rune +var recompMapOnce sync.Once -// Total size of tables: 53KB (54226 bytes) +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "" + // Total size of tables: 53KB (54226 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go index a01274a8e8..9429069291 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go @@ -4,6 +4,8 @@ package norm +import "sync" + const ( // Version is the Unicode edition from which the tables are derived. Version = "9.0.0" @@ -6687,947 +6689,949 @@ var nfkcSparseValues = [875]valueRange{ } // recompMap: 7520 bytes (entries only) -var recompMap = map[uint32]rune{ - 0x00410300: 0x00C0, - 0x00410301: 0x00C1, - 0x00410302: 0x00C2, - 0x00410303: 0x00C3, - 0x00410308: 0x00C4, - 0x0041030A: 0x00C5, - 0x00430327: 0x00C7, - 0x00450300: 0x00C8, - 0x00450301: 0x00C9, - 0x00450302: 0x00CA, - 0x00450308: 0x00CB, - 0x00490300: 0x00CC, - 0x00490301: 0x00CD, - 0x00490302: 0x00CE, - 0x00490308: 0x00CF, - 0x004E0303: 0x00D1, - 0x004F0300: 0x00D2, - 0x004F0301: 0x00D3, - 0x004F0302: 0x00D4, - 0x004F0303: 0x00D5, - 0x004F0308: 0x00D6, - 0x00550300: 0x00D9, - 0x00550301: 0x00DA, - 0x00550302: 0x00DB, - 0x00550308: 0x00DC, - 0x00590301: 0x00DD, - 0x00610300: 0x00E0, - 0x00610301: 0x00E1, - 0x00610302: 0x00E2, - 0x00610303: 0x00E3, - 0x00610308: 0x00E4, - 0x0061030A: 0x00E5, - 0x00630327: 0x00E7, - 0x00650300: 0x00E8, - 0x00650301: 0x00E9, - 0x00650302: 0x00EA, - 0x00650308: 0x00EB, - 0x00690300: 0x00EC, - 0x00690301: 0x00ED, - 0x00690302: 0x00EE, - 0x00690308: 0x00EF, - 0x006E0303: 0x00F1, - 0x006F0300: 0x00F2, - 0x006F0301: 0x00F3, - 0x006F0302: 0x00F4, - 0x006F0303: 0x00F5, - 0x006F0308: 0x00F6, - 0x00750300: 0x00F9, - 0x00750301: 0x00FA, - 0x00750302: 0x00FB, - 0x00750308: 0x00FC, - 0x00790301: 0x00FD, - 0x00790308: 0x00FF, - 0x00410304: 0x0100, - 0x00610304: 0x0101, - 0x00410306: 0x0102, - 0x00610306: 0x0103, - 0x00410328: 0x0104, - 0x00610328: 0x0105, - 0x00430301: 0x0106, - 0x00630301: 0x0107, - 0x00430302: 0x0108, - 0x00630302: 0x0109, - 0x00430307: 0x010A, - 0x00630307: 0x010B, - 0x0043030C: 0x010C, - 0x0063030C: 0x010D, - 0x0044030C: 0x010E, - 0x0064030C: 0x010F, - 0x00450304: 0x0112, - 0x00650304: 0x0113, - 0x00450306: 0x0114, - 0x00650306: 0x0115, - 0x00450307: 0x0116, - 0x00650307: 0x0117, - 0x00450328: 0x0118, - 0x00650328: 0x0119, - 0x0045030C: 0x011A, - 0x0065030C: 0x011B, - 0x00470302: 0x011C, - 0x00670302: 0x011D, - 0x00470306: 0x011E, - 0x00670306: 0x011F, - 0x00470307: 0x0120, - 0x00670307: 0x0121, - 0x00470327: 0x0122, - 0x00670327: 0x0123, - 0x00480302: 0x0124, - 0x00680302: 0x0125, - 0x00490303: 0x0128, - 0x00690303: 0x0129, - 0x00490304: 0x012A, - 0x00690304: 0x012B, - 0x00490306: 0x012C, - 0x00690306: 0x012D, - 0x00490328: 0x012E, - 0x00690328: 0x012F, - 0x00490307: 0x0130, - 0x004A0302: 0x0134, - 0x006A0302: 0x0135, - 0x004B0327: 0x0136, - 0x006B0327: 0x0137, - 0x004C0301: 0x0139, - 0x006C0301: 0x013A, - 0x004C0327: 0x013B, - 0x006C0327: 0x013C, - 0x004C030C: 0x013D, - 0x006C030C: 0x013E, - 0x004E0301: 0x0143, - 0x006E0301: 0x0144, - 0x004E0327: 0x0145, - 0x006E0327: 0x0146, - 0x004E030C: 0x0147, - 0x006E030C: 0x0148, - 0x004F0304: 0x014C, - 0x006F0304: 0x014D, - 0x004F0306: 0x014E, - 0x006F0306: 0x014F, - 0x004F030B: 0x0150, - 0x006F030B: 0x0151, - 0x00520301: 0x0154, - 0x00720301: 0x0155, - 0x00520327: 0x0156, - 0x00720327: 0x0157, - 0x0052030C: 0x0158, - 0x0072030C: 0x0159, - 0x00530301: 0x015A, - 0x00730301: 0x015B, - 0x00530302: 0x015C, - 0x00730302: 0x015D, - 0x00530327: 0x015E, - 0x00730327: 0x015F, - 0x0053030C: 0x0160, - 0x0073030C: 0x0161, - 0x00540327: 0x0162, - 0x00740327: 0x0163, - 0x0054030C: 0x0164, - 0x0074030C: 0x0165, - 0x00550303: 0x0168, - 0x00750303: 0x0169, - 0x00550304: 0x016A, - 0x00750304: 0x016B, - 0x00550306: 0x016C, - 0x00750306: 0x016D, - 0x0055030A: 0x016E, - 0x0075030A: 0x016F, - 0x0055030B: 0x0170, - 0x0075030B: 0x0171, - 0x00550328: 0x0172, - 0x00750328: 0x0173, - 0x00570302: 0x0174, - 0x00770302: 0x0175, - 0x00590302: 0x0176, - 0x00790302: 0x0177, - 0x00590308: 0x0178, - 0x005A0301: 0x0179, - 0x007A0301: 0x017A, - 0x005A0307: 0x017B, - 0x007A0307: 0x017C, - 0x005A030C: 0x017D, - 0x007A030C: 0x017E, - 0x004F031B: 0x01A0, - 0x006F031B: 0x01A1, - 0x0055031B: 0x01AF, - 0x0075031B: 0x01B0, - 0x0041030C: 0x01CD, - 0x0061030C: 0x01CE, - 0x0049030C: 0x01CF, - 0x0069030C: 0x01D0, - 0x004F030C: 0x01D1, - 0x006F030C: 0x01D2, - 0x0055030C: 0x01D3, - 0x0075030C: 0x01D4, - 0x00DC0304: 0x01D5, - 0x00FC0304: 0x01D6, - 0x00DC0301: 0x01D7, - 0x00FC0301: 0x01D8, - 0x00DC030C: 0x01D9, - 0x00FC030C: 0x01DA, - 0x00DC0300: 0x01DB, - 0x00FC0300: 0x01DC, - 0x00C40304: 0x01DE, - 0x00E40304: 0x01DF, - 0x02260304: 0x01E0, - 0x02270304: 0x01E1, - 0x00C60304: 0x01E2, - 0x00E60304: 0x01E3, - 0x0047030C: 0x01E6, - 0x0067030C: 0x01E7, - 0x004B030C: 0x01E8, - 0x006B030C: 0x01E9, - 0x004F0328: 0x01EA, - 0x006F0328: 0x01EB, - 0x01EA0304: 0x01EC, - 0x01EB0304: 0x01ED, - 0x01B7030C: 0x01EE, - 0x0292030C: 0x01EF, - 0x006A030C: 0x01F0, - 0x00470301: 0x01F4, - 0x00670301: 0x01F5, - 0x004E0300: 0x01F8, - 0x006E0300: 0x01F9, - 0x00C50301: 0x01FA, - 0x00E50301: 0x01FB, - 0x00C60301: 0x01FC, - 0x00E60301: 0x01FD, - 0x00D80301: 0x01FE, - 0x00F80301: 0x01FF, - 0x0041030F: 0x0200, - 0x0061030F: 0x0201, - 0x00410311: 0x0202, - 0x00610311: 0x0203, - 0x0045030F: 0x0204, - 0x0065030F: 0x0205, - 0x00450311: 0x0206, - 0x00650311: 0x0207, - 0x0049030F: 0x0208, - 0x0069030F: 0x0209, - 0x00490311: 0x020A, - 0x00690311: 0x020B, - 0x004F030F: 0x020C, - 0x006F030F: 0x020D, - 0x004F0311: 0x020E, - 0x006F0311: 0x020F, - 0x0052030F: 0x0210, - 0x0072030F: 0x0211, - 0x00520311: 0x0212, - 0x00720311: 0x0213, - 0x0055030F: 0x0214, - 0x0075030F: 0x0215, - 0x00550311: 0x0216, - 0x00750311: 0x0217, - 0x00530326: 0x0218, - 0x00730326: 0x0219, - 0x00540326: 0x021A, - 0x00740326: 0x021B, - 0x0048030C: 0x021E, - 0x0068030C: 0x021F, - 0x00410307: 0x0226, - 0x00610307: 0x0227, - 0x00450327: 0x0228, - 0x00650327: 0x0229, - 0x00D60304: 0x022A, - 0x00F60304: 0x022B, - 0x00D50304: 0x022C, - 0x00F50304: 0x022D, - 0x004F0307: 0x022E, - 0x006F0307: 0x022F, - 0x022E0304: 0x0230, - 0x022F0304: 0x0231, - 0x00590304: 0x0232, - 0x00790304: 0x0233, - 0x00A80301: 0x0385, - 0x03910301: 0x0386, - 0x03950301: 0x0388, - 0x03970301: 0x0389, - 0x03990301: 0x038A, - 0x039F0301: 0x038C, - 0x03A50301: 0x038E, - 0x03A90301: 0x038F, - 0x03CA0301: 0x0390, - 0x03990308: 0x03AA, - 0x03A50308: 0x03AB, - 0x03B10301: 0x03AC, - 0x03B50301: 0x03AD, - 0x03B70301: 0x03AE, - 0x03B90301: 0x03AF, - 0x03CB0301: 0x03B0, - 0x03B90308: 0x03CA, - 0x03C50308: 0x03CB, - 0x03BF0301: 0x03CC, - 0x03C50301: 0x03CD, - 0x03C90301: 0x03CE, - 0x03D20301: 0x03D3, - 0x03D20308: 0x03D4, - 0x04150300: 0x0400, - 0x04150308: 0x0401, - 0x04130301: 0x0403, - 0x04060308: 0x0407, - 0x041A0301: 0x040C, - 0x04180300: 0x040D, - 0x04230306: 0x040E, - 0x04180306: 0x0419, - 0x04380306: 0x0439, - 0x04350300: 0x0450, - 0x04350308: 0x0451, - 0x04330301: 0x0453, - 0x04560308: 0x0457, - 0x043A0301: 0x045C, - 0x04380300: 0x045D, - 0x04430306: 0x045E, - 0x0474030F: 0x0476, - 0x0475030F: 0x0477, - 0x04160306: 0x04C1, - 0x04360306: 0x04C2, - 0x04100306: 0x04D0, - 0x04300306: 0x04D1, - 0x04100308: 0x04D2, - 0x04300308: 0x04D3, - 0x04150306: 0x04D6, - 0x04350306: 0x04D7, - 0x04D80308: 0x04DA, - 0x04D90308: 0x04DB, - 0x04160308: 0x04DC, - 0x04360308: 0x04DD, - 0x04170308: 0x04DE, - 0x04370308: 0x04DF, - 0x04180304: 0x04E2, - 0x04380304: 0x04E3, - 0x04180308: 0x04E4, - 0x04380308: 0x04E5, - 0x041E0308: 0x04E6, - 0x043E0308: 0x04E7, - 0x04E80308: 0x04EA, - 0x04E90308: 0x04EB, - 0x042D0308: 0x04EC, - 0x044D0308: 0x04ED, - 0x04230304: 0x04EE, - 0x04430304: 0x04EF, - 0x04230308: 0x04F0, - 0x04430308: 0x04F1, - 0x0423030B: 0x04F2, - 0x0443030B: 0x04F3, - 0x04270308: 0x04F4, - 0x04470308: 0x04F5, - 0x042B0308: 0x04F8, - 0x044B0308: 0x04F9, - 0x06270653: 0x0622, - 0x06270654: 0x0623, - 0x06480654: 0x0624, - 0x06270655: 0x0625, - 0x064A0654: 0x0626, - 0x06D50654: 0x06C0, - 0x06C10654: 0x06C2, - 0x06D20654: 0x06D3, - 0x0928093C: 0x0929, - 0x0930093C: 0x0931, - 0x0933093C: 0x0934, - 0x09C709BE: 0x09CB, - 0x09C709D7: 0x09CC, - 0x0B470B56: 0x0B48, - 0x0B470B3E: 0x0B4B, - 0x0B470B57: 0x0B4C, - 0x0B920BD7: 0x0B94, - 0x0BC60BBE: 0x0BCA, - 0x0BC70BBE: 0x0BCB, - 0x0BC60BD7: 0x0BCC, - 0x0C460C56: 0x0C48, - 0x0CBF0CD5: 0x0CC0, - 0x0CC60CD5: 0x0CC7, - 0x0CC60CD6: 0x0CC8, - 0x0CC60CC2: 0x0CCA, - 0x0CCA0CD5: 0x0CCB, - 0x0D460D3E: 0x0D4A, - 0x0D470D3E: 0x0D4B, - 0x0D460D57: 0x0D4C, - 0x0DD90DCA: 0x0DDA, - 0x0DD90DCF: 0x0DDC, - 0x0DDC0DCA: 0x0DDD, - 0x0DD90DDF: 0x0DDE, - 0x1025102E: 0x1026, - 0x1B051B35: 0x1B06, - 0x1B071B35: 0x1B08, - 0x1B091B35: 0x1B0A, - 0x1B0B1B35: 0x1B0C, - 0x1B0D1B35: 0x1B0E, - 0x1B111B35: 0x1B12, - 0x1B3A1B35: 0x1B3B, - 0x1B3C1B35: 0x1B3D, - 0x1B3E1B35: 0x1B40, - 0x1B3F1B35: 0x1B41, - 0x1B421B35: 0x1B43, - 0x00410325: 0x1E00, - 0x00610325: 0x1E01, - 0x00420307: 0x1E02, - 0x00620307: 0x1E03, - 0x00420323: 0x1E04, - 0x00620323: 0x1E05, - 0x00420331: 0x1E06, - 0x00620331: 0x1E07, - 0x00C70301: 0x1E08, - 0x00E70301: 0x1E09, - 0x00440307: 0x1E0A, - 0x00640307: 0x1E0B, - 0x00440323: 0x1E0C, - 0x00640323: 0x1E0D, - 0x00440331: 0x1E0E, - 0x00640331: 0x1E0F, - 0x00440327: 0x1E10, - 0x00640327: 0x1E11, - 0x0044032D: 0x1E12, - 0x0064032D: 0x1E13, - 0x01120300: 0x1E14, - 0x01130300: 0x1E15, - 0x01120301: 0x1E16, - 0x01130301: 0x1E17, - 0x0045032D: 0x1E18, - 0x0065032D: 0x1E19, - 0x00450330: 0x1E1A, - 0x00650330: 0x1E1B, - 0x02280306: 0x1E1C, - 0x02290306: 0x1E1D, - 0x00460307: 0x1E1E, - 0x00660307: 0x1E1F, - 0x00470304: 0x1E20, - 0x00670304: 0x1E21, - 0x00480307: 0x1E22, - 0x00680307: 0x1E23, - 0x00480323: 0x1E24, - 0x00680323: 0x1E25, - 0x00480308: 0x1E26, - 0x00680308: 0x1E27, - 0x00480327: 0x1E28, - 0x00680327: 0x1E29, - 0x0048032E: 0x1E2A, - 0x0068032E: 0x1E2B, - 0x00490330: 0x1E2C, - 0x00690330: 0x1E2D, - 0x00CF0301: 0x1E2E, - 0x00EF0301: 0x1E2F, - 0x004B0301: 0x1E30, - 0x006B0301: 0x1E31, - 0x004B0323: 0x1E32, - 0x006B0323: 0x1E33, - 0x004B0331: 0x1E34, - 0x006B0331: 0x1E35, - 0x004C0323: 0x1E36, - 0x006C0323: 0x1E37, - 0x1E360304: 0x1E38, - 0x1E370304: 0x1E39, - 0x004C0331: 0x1E3A, - 0x006C0331: 0x1E3B, - 0x004C032D: 0x1E3C, - 0x006C032D: 0x1E3D, - 0x004D0301: 0x1E3E, - 0x006D0301: 0x1E3F, - 0x004D0307: 0x1E40, - 0x006D0307: 0x1E41, - 0x004D0323: 0x1E42, - 0x006D0323: 0x1E43, - 0x004E0307: 0x1E44, - 0x006E0307: 0x1E45, - 0x004E0323: 0x1E46, - 0x006E0323: 0x1E47, - 0x004E0331: 0x1E48, - 0x006E0331: 0x1E49, - 0x004E032D: 0x1E4A, - 0x006E032D: 0x1E4B, - 0x00D50301: 0x1E4C, - 0x00F50301: 0x1E4D, - 0x00D50308: 0x1E4E, - 0x00F50308: 0x1E4F, - 0x014C0300: 0x1E50, - 0x014D0300: 0x1E51, - 0x014C0301: 0x1E52, - 0x014D0301: 0x1E53, - 0x00500301: 0x1E54, - 0x00700301: 0x1E55, - 0x00500307: 0x1E56, - 0x00700307: 0x1E57, - 0x00520307: 0x1E58, - 0x00720307: 0x1E59, - 0x00520323: 0x1E5A, - 0x00720323: 0x1E5B, - 0x1E5A0304: 0x1E5C, - 0x1E5B0304: 0x1E5D, - 0x00520331: 0x1E5E, - 0x00720331: 0x1E5F, - 0x00530307: 0x1E60, - 0x00730307: 0x1E61, - 0x00530323: 0x1E62, - 0x00730323: 0x1E63, - 0x015A0307: 0x1E64, - 0x015B0307: 0x1E65, - 0x01600307: 0x1E66, - 0x01610307: 0x1E67, - 0x1E620307: 0x1E68, - 0x1E630307: 0x1E69, - 0x00540307: 0x1E6A, - 0x00740307: 0x1E6B, - 0x00540323: 0x1E6C, - 0x00740323: 0x1E6D, - 0x00540331: 0x1E6E, - 0x00740331: 0x1E6F, - 0x0054032D: 0x1E70, - 0x0074032D: 0x1E71, - 0x00550324: 0x1E72, - 0x00750324: 0x1E73, - 0x00550330: 0x1E74, - 0x00750330: 0x1E75, - 0x0055032D: 0x1E76, - 0x0075032D: 0x1E77, - 0x01680301: 0x1E78, - 0x01690301: 0x1E79, - 0x016A0308: 0x1E7A, - 0x016B0308: 0x1E7B, - 0x00560303: 0x1E7C, - 0x00760303: 0x1E7D, - 0x00560323: 0x1E7E, - 0x00760323: 0x1E7F, - 0x00570300: 0x1E80, - 0x00770300: 0x1E81, - 0x00570301: 0x1E82, - 0x00770301: 0x1E83, - 0x00570308: 0x1E84, - 0x00770308: 0x1E85, - 0x00570307: 0x1E86, - 0x00770307: 0x1E87, - 0x00570323: 0x1E88, - 0x00770323: 0x1E89, - 0x00580307: 0x1E8A, - 0x00780307: 0x1E8B, - 0x00580308: 0x1E8C, - 0x00780308: 0x1E8D, - 0x00590307: 0x1E8E, - 0x00790307: 0x1E8F, - 0x005A0302: 0x1E90, - 0x007A0302: 0x1E91, - 0x005A0323: 0x1E92, - 0x007A0323: 0x1E93, - 0x005A0331: 0x1E94, - 0x007A0331: 0x1E95, - 0x00680331: 0x1E96, - 0x00740308: 0x1E97, - 0x0077030A: 0x1E98, - 0x0079030A: 0x1E99, - 0x017F0307: 0x1E9B, - 0x00410323: 0x1EA0, - 0x00610323: 0x1EA1, - 0x00410309: 0x1EA2, - 0x00610309: 0x1EA3, - 0x00C20301: 0x1EA4, - 0x00E20301: 0x1EA5, - 0x00C20300: 0x1EA6, - 0x00E20300: 0x1EA7, - 0x00C20309: 0x1EA8, - 0x00E20309: 0x1EA9, - 0x00C20303: 0x1EAA, - 0x00E20303: 0x1EAB, - 0x1EA00302: 0x1EAC, - 0x1EA10302: 0x1EAD, - 0x01020301: 0x1EAE, - 0x01030301: 0x1EAF, - 0x01020300: 0x1EB0, - 0x01030300: 0x1EB1, - 0x01020309: 0x1EB2, - 0x01030309: 0x1EB3, - 0x01020303: 0x1EB4, - 0x01030303: 0x1EB5, - 0x1EA00306: 0x1EB6, - 0x1EA10306: 0x1EB7, - 0x00450323: 0x1EB8, - 0x00650323: 0x1EB9, - 0x00450309: 0x1EBA, - 0x00650309: 0x1EBB, - 0x00450303: 0x1EBC, - 0x00650303: 0x1EBD, - 0x00CA0301: 0x1EBE, - 0x00EA0301: 0x1EBF, - 0x00CA0300: 0x1EC0, - 0x00EA0300: 0x1EC1, - 0x00CA0309: 0x1EC2, - 0x00EA0309: 0x1EC3, - 0x00CA0303: 0x1EC4, - 0x00EA0303: 0x1EC5, - 0x1EB80302: 0x1EC6, - 0x1EB90302: 0x1EC7, - 0x00490309: 0x1EC8, - 0x00690309: 0x1EC9, - 0x00490323: 0x1ECA, - 0x00690323: 0x1ECB, - 0x004F0323: 0x1ECC, - 0x006F0323: 0x1ECD, - 0x004F0309: 0x1ECE, - 0x006F0309: 0x1ECF, - 0x00D40301: 0x1ED0, - 0x00F40301: 0x1ED1, - 0x00D40300: 0x1ED2, - 0x00F40300: 0x1ED3, - 0x00D40309: 0x1ED4, - 0x00F40309: 0x1ED5, - 0x00D40303: 0x1ED6, - 0x00F40303: 0x1ED7, - 0x1ECC0302: 0x1ED8, - 0x1ECD0302: 0x1ED9, - 0x01A00301: 0x1EDA, - 0x01A10301: 0x1EDB, - 0x01A00300: 0x1EDC, - 0x01A10300: 0x1EDD, - 0x01A00309: 0x1EDE, - 0x01A10309: 0x1EDF, - 0x01A00303: 0x1EE0, - 0x01A10303: 0x1EE1, - 0x01A00323: 0x1EE2, - 0x01A10323: 0x1EE3, - 0x00550323: 0x1EE4, - 0x00750323: 0x1EE5, - 0x00550309: 0x1EE6, - 0x00750309: 0x1EE7, - 0x01AF0301: 0x1EE8, - 0x01B00301: 0x1EE9, - 0x01AF0300: 0x1EEA, - 0x01B00300: 0x1EEB, - 0x01AF0309: 0x1EEC, - 0x01B00309: 0x1EED, - 0x01AF0303: 0x1EEE, - 0x01B00303: 0x1EEF, - 0x01AF0323: 0x1EF0, - 0x01B00323: 0x1EF1, - 0x00590300: 0x1EF2, - 0x00790300: 0x1EF3, - 0x00590323: 0x1EF4, - 0x00790323: 0x1EF5, - 0x00590309: 0x1EF6, - 0x00790309: 0x1EF7, - 0x00590303: 0x1EF8, - 0x00790303: 0x1EF9, - 0x03B10313: 0x1F00, - 0x03B10314: 0x1F01, - 0x1F000300: 0x1F02, - 0x1F010300: 0x1F03, - 0x1F000301: 0x1F04, - 0x1F010301: 0x1F05, - 0x1F000342: 0x1F06, - 0x1F010342: 0x1F07, - 0x03910313: 0x1F08, - 0x03910314: 0x1F09, - 0x1F080300: 0x1F0A, - 0x1F090300: 0x1F0B, - 0x1F080301: 0x1F0C, - 0x1F090301: 0x1F0D, - 0x1F080342: 0x1F0E, - 0x1F090342: 0x1F0F, - 0x03B50313: 0x1F10, - 0x03B50314: 0x1F11, - 0x1F100300: 0x1F12, - 0x1F110300: 0x1F13, - 0x1F100301: 0x1F14, - 0x1F110301: 0x1F15, - 0x03950313: 0x1F18, - 0x03950314: 0x1F19, - 0x1F180300: 0x1F1A, - 0x1F190300: 0x1F1B, - 0x1F180301: 0x1F1C, - 0x1F190301: 0x1F1D, - 0x03B70313: 0x1F20, - 0x03B70314: 0x1F21, - 0x1F200300: 0x1F22, - 0x1F210300: 0x1F23, - 0x1F200301: 0x1F24, - 0x1F210301: 0x1F25, - 0x1F200342: 0x1F26, - 0x1F210342: 0x1F27, - 0x03970313: 0x1F28, - 0x03970314: 0x1F29, - 0x1F280300: 0x1F2A, - 0x1F290300: 0x1F2B, - 0x1F280301: 0x1F2C, - 0x1F290301: 0x1F2D, - 0x1F280342: 0x1F2E, - 0x1F290342: 0x1F2F, - 0x03B90313: 0x1F30, - 0x03B90314: 0x1F31, - 0x1F300300: 0x1F32, - 0x1F310300: 0x1F33, - 0x1F300301: 0x1F34, - 0x1F310301: 0x1F35, - 0x1F300342: 0x1F36, - 0x1F310342: 0x1F37, - 0x03990313: 0x1F38, - 0x03990314: 0x1F39, - 0x1F380300: 0x1F3A, - 0x1F390300: 0x1F3B, - 0x1F380301: 0x1F3C, - 0x1F390301: 0x1F3D, - 0x1F380342: 0x1F3E, - 0x1F390342: 0x1F3F, - 0x03BF0313: 0x1F40, - 0x03BF0314: 0x1F41, - 0x1F400300: 0x1F42, - 0x1F410300: 0x1F43, - 0x1F400301: 0x1F44, - 0x1F410301: 0x1F45, - 0x039F0313: 0x1F48, - 0x039F0314: 0x1F49, - 0x1F480300: 0x1F4A, - 0x1F490300: 0x1F4B, - 0x1F480301: 0x1F4C, - 0x1F490301: 0x1F4D, - 0x03C50313: 0x1F50, - 0x03C50314: 0x1F51, - 0x1F500300: 0x1F52, - 0x1F510300: 0x1F53, - 0x1F500301: 0x1F54, - 0x1F510301: 0x1F55, - 0x1F500342: 0x1F56, - 0x1F510342: 0x1F57, - 0x03A50314: 0x1F59, - 0x1F590300: 0x1F5B, - 0x1F590301: 0x1F5D, - 0x1F590342: 0x1F5F, - 0x03C90313: 0x1F60, - 0x03C90314: 0x1F61, - 0x1F600300: 0x1F62, - 0x1F610300: 0x1F63, - 0x1F600301: 0x1F64, - 0x1F610301: 0x1F65, - 0x1F600342: 0x1F66, - 0x1F610342: 0x1F67, - 0x03A90313: 0x1F68, - 0x03A90314: 0x1F69, - 0x1F680300: 0x1F6A, - 0x1F690300: 0x1F6B, - 0x1F680301: 0x1F6C, - 0x1F690301: 0x1F6D, - 0x1F680342: 0x1F6E, - 0x1F690342: 0x1F6F, - 0x03B10300: 0x1F70, - 0x03B50300: 0x1F72, - 0x03B70300: 0x1F74, - 0x03B90300: 0x1F76, - 0x03BF0300: 0x1F78, - 0x03C50300: 0x1F7A, - 0x03C90300: 0x1F7C, - 0x1F000345: 0x1F80, - 0x1F010345: 0x1F81, - 0x1F020345: 0x1F82, - 0x1F030345: 0x1F83, - 0x1F040345: 0x1F84, - 0x1F050345: 0x1F85, - 0x1F060345: 0x1F86, - 0x1F070345: 0x1F87, - 0x1F080345: 0x1F88, - 0x1F090345: 0x1F89, - 0x1F0A0345: 0x1F8A, - 0x1F0B0345: 0x1F8B, - 0x1F0C0345: 0x1F8C, - 0x1F0D0345: 0x1F8D, - 0x1F0E0345: 0x1F8E, - 0x1F0F0345: 0x1F8F, - 0x1F200345: 0x1F90, - 0x1F210345: 0x1F91, - 0x1F220345: 0x1F92, - 0x1F230345: 0x1F93, - 0x1F240345: 0x1F94, - 0x1F250345: 0x1F95, - 0x1F260345: 0x1F96, - 0x1F270345: 0x1F97, - 0x1F280345: 0x1F98, - 0x1F290345: 0x1F99, - 0x1F2A0345: 0x1F9A, - 0x1F2B0345: 0x1F9B, - 0x1F2C0345: 0x1F9C, - 0x1F2D0345: 0x1F9D, - 0x1F2E0345: 0x1F9E, - 0x1F2F0345: 0x1F9F, - 0x1F600345: 0x1FA0, - 0x1F610345: 0x1FA1, - 0x1F620345: 0x1FA2, - 0x1F630345: 0x1FA3, - 0x1F640345: 0x1FA4, - 0x1F650345: 0x1FA5, - 0x1F660345: 0x1FA6, - 0x1F670345: 0x1FA7, - 0x1F680345: 0x1FA8, - 0x1F690345: 0x1FA9, - 0x1F6A0345: 0x1FAA, - 0x1F6B0345: 0x1FAB, - 0x1F6C0345: 0x1FAC, - 0x1F6D0345: 0x1FAD, - 0x1F6E0345: 0x1FAE, - 0x1F6F0345: 0x1FAF, - 0x03B10306: 0x1FB0, - 0x03B10304: 0x1FB1, - 0x1F700345: 0x1FB2, - 0x03B10345: 0x1FB3, - 0x03AC0345: 0x1FB4, - 0x03B10342: 0x1FB6, - 0x1FB60345: 0x1FB7, - 0x03910306: 0x1FB8, - 0x03910304: 0x1FB9, - 0x03910300: 0x1FBA, - 0x03910345: 0x1FBC, - 0x00A80342: 0x1FC1, - 0x1F740345: 0x1FC2, - 0x03B70345: 0x1FC3, - 0x03AE0345: 0x1FC4, - 0x03B70342: 0x1FC6, - 0x1FC60345: 0x1FC7, - 0x03950300: 0x1FC8, - 0x03970300: 0x1FCA, - 0x03970345: 0x1FCC, - 0x1FBF0300: 0x1FCD, - 0x1FBF0301: 0x1FCE, - 0x1FBF0342: 0x1FCF, - 0x03B90306: 0x1FD0, - 0x03B90304: 0x1FD1, - 0x03CA0300: 0x1FD2, - 0x03B90342: 0x1FD6, - 0x03CA0342: 0x1FD7, - 0x03990306: 0x1FD8, - 0x03990304: 0x1FD9, - 0x03990300: 0x1FDA, - 0x1FFE0300: 0x1FDD, - 0x1FFE0301: 0x1FDE, - 0x1FFE0342: 0x1FDF, - 0x03C50306: 0x1FE0, - 0x03C50304: 0x1FE1, - 0x03CB0300: 0x1FE2, - 0x03C10313: 0x1FE4, - 0x03C10314: 0x1FE5, - 0x03C50342: 0x1FE6, - 0x03CB0342: 0x1FE7, - 0x03A50306: 0x1FE8, - 0x03A50304: 0x1FE9, - 0x03A50300: 0x1FEA, - 0x03A10314: 0x1FEC, - 0x00A80300: 0x1FED, - 0x1F7C0345: 0x1FF2, - 0x03C90345: 0x1FF3, - 0x03CE0345: 0x1FF4, - 0x03C90342: 0x1FF6, - 0x1FF60345: 0x1FF7, - 0x039F0300: 0x1FF8, - 0x03A90300: 0x1FFA, - 0x03A90345: 0x1FFC, - 0x21900338: 0x219A, - 0x21920338: 0x219B, - 0x21940338: 0x21AE, - 0x21D00338: 0x21CD, - 0x21D40338: 0x21CE, - 0x21D20338: 0x21CF, - 0x22030338: 0x2204, - 0x22080338: 0x2209, - 0x220B0338: 0x220C, - 0x22230338: 0x2224, - 0x22250338: 0x2226, - 0x223C0338: 0x2241, - 0x22430338: 0x2244, - 0x22450338: 0x2247, - 0x22480338: 0x2249, - 0x003D0338: 0x2260, - 0x22610338: 0x2262, - 0x224D0338: 0x226D, - 0x003C0338: 0x226E, - 0x003E0338: 0x226F, - 0x22640338: 0x2270, - 0x22650338: 0x2271, - 0x22720338: 0x2274, - 0x22730338: 0x2275, - 0x22760338: 0x2278, - 0x22770338: 0x2279, - 0x227A0338: 0x2280, - 0x227B0338: 0x2281, - 0x22820338: 0x2284, - 0x22830338: 0x2285, - 0x22860338: 0x2288, - 0x22870338: 0x2289, - 0x22A20338: 0x22AC, - 0x22A80338: 0x22AD, - 0x22A90338: 0x22AE, - 0x22AB0338: 0x22AF, - 0x227C0338: 0x22E0, - 0x227D0338: 0x22E1, - 0x22910338: 0x22E2, - 0x22920338: 0x22E3, - 0x22B20338: 0x22EA, - 0x22B30338: 0x22EB, - 0x22B40338: 0x22EC, - 0x22B50338: 0x22ED, - 0x304B3099: 0x304C, - 0x304D3099: 0x304E, - 0x304F3099: 0x3050, - 0x30513099: 0x3052, - 0x30533099: 0x3054, - 0x30553099: 0x3056, - 0x30573099: 0x3058, - 0x30593099: 0x305A, - 0x305B3099: 0x305C, - 0x305D3099: 0x305E, - 0x305F3099: 0x3060, - 0x30613099: 0x3062, - 0x30643099: 0x3065, - 0x30663099: 0x3067, - 0x30683099: 0x3069, - 0x306F3099: 0x3070, - 0x306F309A: 0x3071, - 0x30723099: 0x3073, - 0x3072309A: 0x3074, - 0x30753099: 0x3076, - 0x3075309A: 0x3077, - 0x30783099: 0x3079, - 0x3078309A: 0x307A, - 0x307B3099: 0x307C, - 0x307B309A: 0x307D, - 0x30463099: 0x3094, - 0x309D3099: 0x309E, - 0x30AB3099: 0x30AC, - 0x30AD3099: 0x30AE, - 0x30AF3099: 0x30B0, - 0x30B13099: 0x30B2, - 0x30B33099: 0x30B4, - 0x30B53099: 0x30B6, - 0x30B73099: 0x30B8, - 0x30B93099: 0x30BA, - 0x30BB3099: 0x30BC, - 0x30BD3099: 0x30BE, - 0x30BF3099: 0x30C0, - 0x30C13099: 0x30C2, - 0x30C43099: 0x30C5, - 0x30C63099: 0x30C7, - 0x30C83099: 0x30C9, - 0x30CF3099: 0x30D0, - 0x30CF309A: 0x30D1, - 0x30D23099: 0x30D3, - 0x30D2309A: 0x30D4, - 0x30D53099: 0x30D6, - 0x30D5309A: 0x30D7, - 0x30D83099: 0x30D9, - 0x30D8309A: 0x30DA, - 0x30DB3099: 0x30DC, - 0x30DB309A: 0x30DD, - 0x30A63099: 0x30F4, - 0x30EF3099: 0x30F7, - 0x30F03099: 0x30F8, - 0x30F13099: 0x30F9, - 0x30F23099: 0x30FA, - 0x30FD3099: 0x30FE, - 0x109910BA: 0x1109A, - 0x109B10BA: 0x1109C, - 0x10A510BA: 0x110AB, - 0x11311127: 0x1112E, - 0x11321127: 0x1112F, - 0x1347133E: 0x1134B, - 0x13471357: 0x1134C, - 0x14B914BA: 0x114BB, - 0x14B914B0: 0x114BC, - 0x14B914BD: 0x114BE, - 0x15B815AF: 0x115BA, - 0x15B915AF: 0x115BB, -} +var recompMap map[uint32]rune +var recompMapOnce sync.Once -// Total size of tables: 53KB (54006 bytes) +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "" + // Total size of tables: 53KB (54006 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/transform.go b/vendor/golang.org/x/text/unicode/norm/transform.go index 9f47efbaf6..a1d366ae48 100644 --- a/vendor/golang.org/x/text/unicode/norm/transform.go +++ b/vendor/golang.org/x/text/unicode/norm/transform.go @@ -18,7 +18,6 @@ func (Form) Reset() {} // Users should either catch ErrShortDst and allow dst to grow or have dst be at // least of size MaxTransformChunkSize to be guaranteed of progress. func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - n := 0 // Cap the maximum number of src bytes to check. b := src eof := atEOF @@ -27,13 +26,14 @@ func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) eof = false b = b[:ns] } - i, ok := formTable[f].quickSpan(inputBytes(b), n, len(b), eof) - n += copy(dst[n:], b[n:i]) + i, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), eof) + n := copy(dst, b[:i]) if !ok { nDst, nSrc, err = f.transform(dst[n:], src[n:], atEOF) return nDst + n, nSrc + n, err } - if n < len(src) && !atEOF { + + if err == nil && n < len(src) && !atEOF { err = transform.ErrShortSrc } return n, n, err @@ -79,7 +79,7 @@ func (f Form) transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) nSrc += n nDst += n if ok { - if n < rb.nsrc && !atEOF { + if err == nil && n < rb.nsrc && !atEOF { err = transform.ErrShortSrc } return nDst, nSrc, err diff --git a/vendor/gopkg.in/yaml.v2/decode.go b/vendor/gopkg.in/yaml.v2/decode.go index e4e56e28e0..5310876555 100644 --- a/vendor/gopkg.in/yaml.v2/decode.go +++ b/vendor/gopkg.in/yaml.v2/decode.go @@ -229,6 +229,10 @@ type decoder struct { mapType reflect.Type terrors []string strict bool + + decodeCount int + aliasCount int + aliasDepth int } var ( @@ -314,7 +318,39 @@ func (d *decoder) prepare(n *node, out reflect.Value) (newout reflect.Value, unm return out, false, false } +const ( + // 400,000 decode operations is ~500kb of dense object declarations, or ~5kb of dense object declarations with 10000% alias expansion + alias_ratio_range_low = 400000 + // 4,000,000 decode operations is ~5MB of dense object declarations, or ~4.5MB of dense object declarations with 10% alias expansion + alias_ratio_range_high = 4000000 + // alias_ratio_range is the range over which we scale allowed alias ratios + alias_ratio_range = float64(alias_ratio_range_high - alias_ratio_range_low) +) + +func allowedAliasRatio(decodeCount int) float64 { + switch { + case decodeCount <= alias_ratio_range_low: + // allow 99% to come from alias expansion for small-to-medium documents + return 0.99 + case decodeCount >= alias_ratio_range_high: + // allow 10% to come from alias expansion for very large documents + return 0.10 + default: + // scale smoothly from 99% down to 10% over the range. + // this maps to 396,000 - 400,000 allowed alias-driven decodes over the range. + // 400,000 decode operations is ~100MB of allocations in worst-case scenarios (single-item maps). + return 0.99 - 0.89*(float64(decodeCount-alias_ratio_range_low)/alias_ratio_range) + } +} + func (d *decoder) unmarshal(n *node, out reflect.Value) (good bool) { + d.decodeCount++ + if d.aliasDepth > 0 { + d.aliasCount++ + } + if d.aliasCount > 100 && d.decodeCount > 1000 && float64(d.aliasCount)/float64(d.decodeCount) > allowedAliasRatio(d.decodeCount) { + failf("document contains excessive aliasing") + } switch n.kind { case documentNode: return d.document(n, out) @@ -353,7 +389,9 @@ func (d *decoder) alias(n *node, out reflect.Value) (good bool) { failf("anchor '%s' value contains itself", n.value) } d.aliases[n] = true + d.aliasDepth++ good = d.unmarshal(n.alias, out) + d.aliasDepth-- delete(d.aliases, n) return good } diff --git a/vendor/gopkg.in/yaml.v2/resolve.go b/vendor/gopkg.in/yaml.v2/resolve.go index 6c151db6fb..4120e0c916 100644 --- a/vendor/gopkg.in/yaml.v2/resolve.go +++ b/vendor/gopkg.in/yaml.v2/resolve.go @@ -81,7 +81,7 @@ func resolvableTag(tag string) bool { return false } -var yamlStyleFloat = regexp.MustCompile(`^[-+]?[0-9]*\.?[0-9]+([eE][-+][0-9]+)?$`) +var yamlStyleFloat = regexp.MustCompile(`^[-+]?(\.[0-9]+|[0-9]+(\.[0-9]*)?)([eE][-+]?[0-9]+)?$`) func resolve(tag string, in string) (rtag string, out interface{}) { if !resolvableTag(tag) { diff --git a/vendor/gopkg.in/yaml.v2/scannerc.go b/vendor/gopkg.in/yaml.v2/scannerc.go index 077fd1dd2d..570b8ecd10 100644 --- a/vendor/gopkg.in/yaml.v2/scannerc.go +++ b/vendor/gopkg.in/yaml.v2/scannerc.go @@ -906,6 +906,9 @@ func yaml_parser_remove_simple_key(parser *yaml_parser_t) bool { return true } +// max_flow_level limits the flow_level +const max_flow_level = 10000 + // Increase the flow level and resize the simple key list if needed. func yaml_parser_increase_flow_level(parser *yaml_parser_t) bool { // Reset the simple key on the next level. @@ -913,6 +916,11 @@ func yaml_parser_increase_flow_level(parser *yaml_parser_t) bool { // Increase the flow level. parser.flow_level++ + if parser.flow_level > max_flow_level { + return yaml_parser_set_scanner_error(parser, + "while increasing flow level", parser.simple_keys[len(parser.simple_keys)-1].mark, + fmt.Sprintf("exceeded max depth of %d", max_flow_level)) + } return true } @@ -925,6 +933,9 @@ func yaml_parser_decrease_flow_level(parser *yaml_parser_t) bool { return true } +// max_indents limits the indents stack size +const max_indents = 10000 + // Push the current indentation level to the stack and set the new level // the current column is greater than the indentation level. In this case, // append or insert the specified token into the token queue. @@ -939,6 +950,11 @@ func yaml_parser_roll_indent(parser *yaml_parser_t, column, number int, typ yaml // indentation level. parser.indents = append(parser.indents, parser.indent) parser.indent = column + if len(parser.indents) > max_indents { + return yaml_parser_set_scanner_error(parser, + "while increasing indent level", parser.simple_keys[len(parser.simple_keys)-1].mark, + fmt.Sprintf("exceeded max depth of %d", max_indents)) + } // Create a token and insert it into the queue. token := yaml_token_t{ diff --git a/vendor/k8s.io/apimachinery/pkg/api/errors/OWNERS b/vendor/k8s.io/apimachinery/pkg/api/errors/OWNERS index dc6a4c7242..63434030ca 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/errors/OWNERS +++ b/vendor/k8s.io/apimachinery/pkg/api/errors/OWNERS @@ -1,3 +1,5 @@ +# See the OWNERS docs at https://go.k8s.io/owners + reviewers: - thockin - lavalamp diff --git a/vendor/k8s.io/apimachinery/pkg/api/errors/errors.go b/vendor/k8s.io/apimachinery/pkg/api/errors/errors.go index 48c1104d99..f4201eb691 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/errors/errors.go +++ b/vendor/k8s.io/apimachinery/pkg/api/errors/errors.go @@ -184,6 +184,20 @@ func NewConflict(qualifiedResource schema.GroupResource, name string, err error) }} } +// NewApplyConflict returns an error including details on the requests apply conflicts +func NewApplyConflict(causes []metav1.StatusCause, message string) *StatusError { + return &StatusError{ErrStatus: metav1.Status{ + Status: metav1.StatusFailure, + Code: http.StatusConflict, + Reason: metav1.StatusReasonConflict, + Details: &metav1.StatusDetails{ + // TODO: Get obj details here? + Causes: causes, + }, + Message: message, + }} +} + // NewGone returns an error indicating the item no longer available at the server and no forwarding address is known. func NewGone(message string) *StatusError { return &StatusError{metav1.Status{ @@ -380,7 +394,11 @@ func NewGenericServerResponse(code int, verb string, qualifiedResource schema.Gr case http.StatusNotAcceptable: reason = metav1.StatusReasonNotAcceptable // the server message has details about what types are acceptable - message = serverMessage + if len(serverMessage) == 0 || serverMessage == "unknown" { + message = "the server was unable to respond with a content type that the client supports" + } else { + message = serverMessage + } case http.StatusUnsupportedMediaType: reason = metav1.StatusReasonUnsupportedMediaType // the server message has details about what types are acceptable @@ -603,3 +621,46 @@ func ReasonForError(err error) metav1.StatusReason { } return metav1.StatusReasonUnknown } + +// ErrorReporter converts generic errors into runtime.Object errors without +// requiring the caller to take a dependency on meta/v1 (where Status lives). +// This prevents circular dependencies in core watch code. +type ErrorReporter struct { + code int + verb string + reason string +} + +// NewClientErrorReporter will respond with valid v1.Status objects that report +// unexpected server responses. Primarily used by watch to report errors when +// we attempt to decode a response from the server and it is not in the form +// we expect. Because watch is a dependency of the core api, we can't return +// meta/v1.Status in that package and so much inject this interface to convert a +// generic error as appropriate. The reason is passed as a unique status cause +// on the returned status, otherwise the generic "ClientError" is returned. +func NewClientErrorReporter(code int, verb string, reason string) *ErrorReporter { + return &ErrorReporter{ + code: code, + verb: verb, + reason: reason, + } +} + +// AsObject returns a valid error runtime.Object (a v1.Status) for the given +// error, using the code and verb of the reporter type. The error is set to +// indicate that this was an unexpected server response. +func (r *ErrorReporter) AsObject(err error) runtime.Object { + status := NewGenericServerResponse(r.code, r.verb, schema.GroupResource{}, "", err.Error(), 0, true) + if status.ErrStatus.Details == nil { + status.ErrStatus.Details = &metav1.StatusDetails{} + } + reason := r.reason + if len(reason) == 0 { + reason = "ClientError" + } + status.ErrStatus.Details.Causes = append(status.ErrStatus.Details.Causes, metav1.StatusCause{ + Type: metav1.CauseType(reason), + Message: err.Error(), + }) + return &status.ErrStatus +} diff --git a/vendor/k8s.io/apimachinery/pkg/api/meta/OWNERS b/vendor/k8s.io/apimachinery/pkg/api/meta/OWNERS index 5f729ffe63..dd2c0cb614 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/meta/OWNERS +++ b/vendor/k8s.io/apimachinery/pkg/api/meta/OWNERS @@ -1,3 +1,5 @@ +# See the OWNERS docs at https://go.k8s.io/owners + reviewers: - thockin - smarterclayton diff --git a/vendor/k8s.io/apimachinery/pkg/api/meta/help.go b/vendor/k8s.io/apimachinery/pkg/api/meta/help.go index c70b3d2b6c..50468b5330 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/meta/help.go +++ b/vendor/k8s.io/apimachinery/pkg/api/meta/help.go @@ -17,30 +17,76 @@ limitations under the License. package meta import ( + "errors" "fmt" "reflect" + "sync" "k8s.io/apimachinery/pkg/conversion" "k8s.io/apimachinery/pkg/runtime" ) -// IsListType returns true if the provided Object has a slice called Items +var ( + // isListCache maintains a cache of types that are checked for lists + // which is used by IsListType. + // TODO: remove and replace with an interface check + isListCache = struct { + lock sync.RWMutex + byType map[reflect.Type]bool + }{ + byType: make(map[reflect.Type]bool, 1024), + } +) + +// IsListType returns true if the provided Object has a slice called Items. +// TODO: Replace the code in this check with an interface comparison by +// creating and enforcing that lists implement a list accessor. func IsListType(obj runtime.Object) bool { - // if we're a runtime.Unstructured, check whether this is a list. - // TODO: refactor GetItemsPtr to use an interface that returns []runtime.Object - if unstructured, ok := obj.(runtime.Unstructured); ok { - return unstructured.IsList() + switch t := obj.(type) { + case runtime.Unstructured: + return t.IsList() + } + t := reflect.TypeOf(obj) + + isListCache.lock.RLock() + ok, exists := isListCache.byType[t] + isListCache.lock.RUnlock() + + if !exists { + _, err := getItemsPtr(obj) + ok = err == nil + + // cache only the first 1024 types + isListCache.lock.Lock() + if len(isListCache.byType) < 1024 { + isListCache.byType[t] = ok + } + isListCache.lock.Unlock() } - _, err := GetItemsPtr(obj) - return err == nil + return ok } +var ( + errExpectFieldItems = errors.New("no Items field in this object") + errExpectSliceItems = errors.New("Items field must be a slice of objects") +) + // GetItemsPtr returns a pointer to the list object's Items member. // If 'list' doesn't have an Items member, it's not really a list type // and an error will be returned. // This function will either return a pointer to a slice, or an error, but not both. +// TODO: this will be replaced with an interface in the future func GetItemsPtr(list runtime.Object) (interface{}, error) { + obj, err := getItemsPtr(list) + if err != nil { + return nil, fmt.Errorf("%T is not a list: %v", list, err) + } + return obj, nil +} + +// getItemsPtr returns a pointer to the list object's Items member or an error. +func getItemsPtr(list runtime.Object) (interface{}, error) { v, err := conversion.EnforcePtr(list) if err != nil { return nil, err @@ -48,19 +94,19 @@ func GetItemsPtr(list runtime.Object) (interface{}, error) { items := v.FieldByName("Items") if !items.IsValid() { - return nil, fmt.Errorf("no Items field in %#v", list) + return nil, errExpectFieldItems } switch items.Kind() { case reflect.Interface, reflect.Ptr: target := reflect.TypeOf(items.Interface()).Elem() if target.Kind() != reflect.Slice { - return nil, fmt.Errorf("items: Expected slice, got %s", target.Kind()) + return nil, errExpectSliceItems } return items.Interface(), nil case reflect.Slice: return items.Addr().Interface(), nil default: - return nil, fmt.Errorf("items: Expected slice, got %s", items.Kind()) + return nil, errExpectSliceItems } } @@ -158,6 +204,19 @@ func ExtractList(obj runtime.Object) ([]runtime.Object, error) { // objectSliceType is the type of a slice of Objects var objectSliceType = reflect.TypeOf([]runtime.Object{}) +// LenList returns the length of this list or 0 if it is not a list. +func LenList(list runtime.Object) int { + itemsPtr, err := GetItemsPtr(list) + if err != nil { + return 0 + } + items, err := conversion.EnforcePtr(itemsPtr) + if err != nil { + return 0 + } + return items.Len() +} + // SetList sets the given list object's Items member have the elements given in // objects. // Returns an error if list is not a List type (does not have an Items member), diff --git a/vendor/k8s.io/apimachinery/pkg/api/meta/meta.go b/vendor/k8s.io/apimachinery/pkg/api/meta/meta.go index 6fe7458f6c..086bce04b0 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/meta/meta.go +++ b/vendor/k8s.io/apimachinery/pkg/api/meta/meta.go @@ -20,14 +20,12 @@ import ( "fmt" "reflect" - "k8s.io/klog" - metav1 "k8s.io/apimachinery/pkg/apis/meta/v1" - metav1beta1 "k8s.io/apimachinery/pkg/apis/meta/v1beta1" "k8s.io/apimachinery/pkg/conversion" "k8s.io/apimachinery/pkg/runtime" "k8s.io/apimachinery/pkg/runtime/schema" "k8s.io/apimachinery/pkg/types" + "k8s.io/klog" ) // errNotList is returned when an object implements the Object style interfaces but not the List style @@ -115,12 +113,12 @@ func Accessor(obj interface{}) (metav1.Object, error) { // AsPartialObjectMetadata takes the metav1 interface and returns a partial object. // TODO: consider making this solely a conversion action. -func AsPartialObjectMetadata(m metav1.Object) *metav1beta1.PartialObjectMetadata { +func AsPartialObjectMetadata(m metav1.Object) *metav1.PartialObjectMetadata { switch t := m.(type) { case *metav1.ObjectMeta: - return &metav1beta1.PartialObjectMetadata{ObjectMeta: *t} + return &metav1.PartialObjectMetadata{ObjectMeta: *t} default: - return &metav1beta1.PartialObjectMetadata{ + return &metav1.PartialObjectMetadata{ ObjectMeta: metav1.ObjectMeta{ Name: m.GetName(), GenerateName: m.GetGenerateName(), @@ -138,6 +136,7 @@ func AsPartialObjectMetadata(m metav1.Object) *metav1beta1.PartialObjectMetadata Finalizers: m.GetFinalizers(), ClusterName: m.GetClusterName(), Initializers: m.GetInitializers(), + ManagedFields: m.GetManagedFields(), }, } } diff --git a/vendor/k8s.io/apimachinery/pkg/api/resource/OWNERS b/vendor/k8s.io/apimachinery/pkg/api/resource/OWNERS index c430067f35..8454be55ed 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/resource/OWNERS +++ b/vendor/k8s.io/apimachinery/pkg/api/resource/OWNERS @@ -1,3 +1,5 @@ +# See the OWNERS docs at https://go.k8s.io/owners + reviewers: - thockin - lavalamp diff --git a/vendor/k8s.io/apimachinery/pkg/api/resource/generated.pb.go b/vendor/k8s.io/apimachinery/pkg/api/resource/generated.pb.go index 9d7835bc23..1b2cb05554 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/resource/generated.pb.go +++ b/vendor/k8s.io/apimachinery/pkg/api/resource/generated.pb.go @@ -28,9 +28,13 @@ It has these top-level messages: */ package resource -import proto "github.com/gogo/protobuf/proto" -import fmt "fmt" -import math "math" +import ( + fmt "fmt" + + proto "github.com/gogo/protobuf/proto" + + math "math" +) // Reference imports to suppress errors if they are not otherwise used. var _ = proto.Marshal diff --git a/vendor/k8s.io/apimachinery/pkg/api/resource/math.go b/vendor/k8s.io/apimachinery/pkg/api/resource/math.go index 72d3880c02..7f63175d3e 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/resource/math.go +++ b/vendor/k8s.io/apimachinery/pkg/api/resource/math.go @@ -194,9 +194,9 @@ func negativeScaleInt64(base int64, scale Scale) (result int64, exact bool) { } if fraction { if base > 0 { - value += 1 + value++ } else { - value += -1 + value-- } } return value, !fraction diff --git a/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go b/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go index b155a62a45..93a6c0c500 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go +++ b/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go @@ -584,6 +584,12 @@ func (q *Quantity) Neg() { q.d.Dec.Neg(q.d.Dec) } +// Equal checks equality of two Quantities. This is useful for testing with +// cmp.Equal. +func (q Quantity) Equal(v Quantity) bool { + return q.Cmp(v) == 0 +} + // int64QuantityExpectedBytes is the expected width in bytes of the canonical string representation // of most Quantity values. const int64QuantityExpectedBytes = 18 @@ -680,7 +686,7 @@ func NewScaledQuantity(value int64, scale Scale) *Quantity { } } -// Value returns the value of q; any fractional part will be lost. +// Value returns the unscaled value of q rounded up to the nearest integer away from 0. func (q *Quantity) Value() int64 { return q.ScaledValue(0) } diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/OWNERS b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/OWNERS index cdb125a0dd..44929b1c00 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/OWNERS +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/OWNERS @@ -1,3 +1,5 @@ +# See the OWNERS docs at https://go.k8s.io/owners + reviewers: - thockin - smarterclayton diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/conversion.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/conversion.go index 5c36f82c12..d07069ef24 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/conversion.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/conversion.go @@ -77,6 +77,8 @@ func AddConversionFuncs(scheme *runtime.Scheme) error { Convert_Slice_string_To_Slice_int32, Convert_Slice_string_To_v1_DeletionPropagation, + + Convert_Slice_string_To_v1_IncludeObjectPolicy, ) } @@ -317,3 +319,11 @@ func Convert_Slice_string_To_v1_DeletionPropagation(input *[]string, out *Deleti } return nil } + +// Convert_Slice_string_To_v1_IncludeObjectPolicy allows converting a URL query parameter value +func Convert_Slice_string_To_v1_IncludeObjectPolicy(input *[]string, out *IncludeObjectPolicy, s conversion.Scope) error { + if len(*input) > 0 { + *out = IncludeObjectPolicy((*input)[0]) + } + return nil +} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/deepcopy.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/deepcopy.go similarity index 91% rename from vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/deepcopy.go rename to vendor/k8s.io/apimachinery/pkg/apis/meta/v1/deepcopy.go index 3b2bedd923..8751d0524f 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/deepcopy.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/deepcopy.go @@ -1,5 +1,5 @@ /* -Copyright 2017 The Kubernetes Authors. +Copyright 2019 The Kubernetes Authors. Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. @@ -14,9 +14,11 @@ See the License for the specific language governing permissions and limitations under the License. */ -package v1beta1 +package v1 -import "k8s.io/apimachinery/pkg/runtime" +import ( + "k8s.io/apimachinery/pkg/runtime" +) func (in *TableRow) DeepCopy() *TableRow { if in == nil { diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/duration.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/duration.go index 2eaabf0794..babe8a8b53 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/duration.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/duration.go @@ -48,3 +48,13 @@ func (d *Duration) UnmarshalJSON(b []byte) error { func (d Duration) MarshalJSON() ([]byte, error) { return json.Marshal(d.Duration.String()) } + +// OpenAPISchemaType is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +// +// See: https://github.com/kubernetes/kube-openapi/tree/master/pkg/generators +func (_ Duration) OpenAPISchemaType() []string { return []string{"string"} } + +// OpenAPISchemaFormat is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +func (_ Duration) OpenAPISchemaFormat() string { return "" } diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.pb.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.pb.go index 81320c9c88..034eaaa8ae 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.pb.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.pb.go @@ -33,6 +33,7 @@ limitations under the License. DeleteOptions Duration ExportOptions + Fields GetOptions GroupKind GroupResource @@ -47,16 +48,21 @@ limitations under the License. List ListMeta ListOptions + ManagedFieldsEntry MicroTime ObjectMeta OwnerReference + PartialObjectMetadata + PartialObjectMetadataList Patch + PatchOptions Preconditions RootPaths ServerAddressByClientCIDR Status StatusCause StatusDetails + TableOptions Time Timestamp TypeMeta @@ -66,21 +72,27 @@ limitations under the License. */ package v1 -import proto "github.com/gogo/protobuf/proto" -import fmt "fmt" -import math "math" +import ( + fmt "fmt" -import k8s_io_apimachinery_pkg_runtime "k8s.io/apimachinery/pkg/runtime" + proto "github.com/gogo/protobuf/proto" -import time "time" -import k8s_io_apimachinery_pkg_types "k8s.io/apimachinery/pkg/types" + math "math" -import github_com_gogo_protobuf_sortkeys "github.com/gogo/protobuf/sortkeys" + k8s_io_apimachinery_pkg_runtime "k8s.io/apimachinery/pkg/runtime" -import strings "strings" -import reflect "reflect" + time "time" -import io "io" + k8s_io_apimachinery_pkg_types "k8s.io/apimachinery/pkg/types" + + github_com_gogo_protobuf_sortkeys "github.com/gogo/protobuf/sortkeys" + + strings "strings" + + reflect "reflect" + + io "io" +) // Reference imports to suppress errors if they are not otherwise used. var _ = proto.Marshal @@ -130,131 +142,157 @@ func (m *ExportOptions) Reset() { *m = ExportOptions{} } func (*ExportOptions) ProtoMessage() {} func (*ExportOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{8} } +func (m *Fields) Reset() { *m = Fields{} } +func (*Fields) ProtoMessage() {} +func (*Fields) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{9} } + func (m *GetOptions) Reset() { *m = GetOptions{} } func (*GetOptions) ProtoMessage() {} -func (*GetOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{9} } +func (*GetOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{10} } func (m *GroupKind) Reset() { *m = GroupKind{} } func (*GroupKind) ProtoMessage() {} -func (*GroupKind) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{10} } +func (*GroupKind) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{11} } func (m *GroupResource) Reset() { *m = GroupResource{} } func (*GroupResource) ProtoMessage() {} -func (*GroupResource) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{11} } +func (*GroupResource) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{12} } func (m *GroupVersion) Reset() { *m = GroupVersion{} } func (*GroupVersion) ProtoMessage() {} -func (*GroupVersion) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{12} } +func (*GroupVersion) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{13} } func (m *GroupVersionForDiscovery) Reset() { *m = GroupVersionForDiscovery{} } func (*GroupVersionForDiscovery) ProtoMessage() {} func (*GroupVersionForDiscovery) Descriptor() ([]byte, []int) { - return fileDescriptorGenerated, []int{13} + return fileDescriptorGenerated, []int{14} } func (m *GroupVersionKind) Reset() { *m = GroupVersionKind{} } func (*GroupVersionKind) ProtoMessage() {} -func (*GroupVersionKind) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{14} } +func (*GroupVersionKind) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{15} } func (m *GroupVersionResource) Reset() { *m = GroupVersionResource{} } func (*GroupVersionResource) ProtoMessage() {} -func (*GroupVersionResource) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{15} } +func (*GroupVersionResource) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{16} } func (m *Initializer) Reset() { *m = Initializer{} } func (*Initializer) ProtoMessage() {} -func (*Initializer) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{16} } +func (*Initializer) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{17} } func (m *Initializers) Reset() { *m = Initializers{} } func (*Initializers) ProtoMessage() {} -func (*Initializers) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{17} } +func (*Initializers) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{18} } func (m *LabelSelector) Reset() { *m = LabelSelector{} } func (*LabelSelector) ProtoMessage() {} -func (*LabelSelector) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{18} } +func (*LabelSelector) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{19} } func (m *LabelSelectorRequirement) Reset() { *m = LabelSelectorRequirement{} } func (*LabelSelectorRequirement) ProtoMessage() {} func (*LabelSelectorRequirement) Descriptor() ([]byte, []int) { - return fileDescriptorGenerated, []int{19} + return fileDescriptorGenerated, []int{20} } func (m *List) Reset() { *m = List{} } func (*List) ProtoMessage() {} -func (*List) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{20} } +func (*List) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{21} } func (m *ListMeta) Reset() { *m = ListMeta{} } func (*ListMeta) ProtoMessage() {} -func (*ListMeta) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{21} } +func (*ListMeta) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{22} } func (m *ListOptions) Reset() { *m = ListOptions{} } func (*ListOptions) ProtoMessage() {} -func (*ListOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{22} } +func (*ListOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{23} } + +func (m *ManagedFieldsEntry) Reset() { *m = ManagedFieldsEntry{} } +func (*ManagedFieldsEntry) ProtoMessage() {} +func (*ManagedFieldsEntry) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{24} } func (m *MicroTime) Reset() { *m = MicroTime{} } func (*MicroTime) ProtoMessage() {} -func (*MicroTime) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{23} } +func (*MicroTime) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{25} } func (m *ObjectMeta) Reset() { *m = ObjectMeta{} } func (*ObjectMeta) ProtoMessage() {} -func (*ObjectMeta) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{24} } +func (*ObjectMeta) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{26} } func (m *OwnerReference) Reset() { *m = OwnerReference{} } func (*OwnerReference) ProtoMessage() {} -func (*OwnerReference) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{25} } +func (*OwnerReference) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{27} } + +func (m *PartialObjectMetadata) Reset() { *m = PartialObjectMetadata{} } +func (*PartialObjectMetadata) ProtoMessage() {} +func (*PartialObjectMetadata) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{28} } + +func (m *PartialObjectMetadataList) Reset() { *m = PartialObjectMetadataList{} } +func (*PartialObjectMetadataList) ProtoMessage() {} +func (*PartialObjectMetadataList) Descriptor() ([]byte, []int) { + return fileDescriptorGenerated, []int{29} +} func (m *Patch) Reset() { *m = Patch{} } func (*Patch) ProtoMessage() {} -func (*Patch) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{26} } +func (*Patch) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{30} } + +func (m *PatchOptions) Reset() { *m = PatchOptions{} } +func (*PatchOptions) ProtoMessage() {} +func (*PatchOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{31} } func (m *Preconditions) Reset() { *m = Preconditions{} } func (*Preconditions) ProtoMessage() {} -func (*Preconditions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{27} } +func (*Preconditions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{32} } func (m *RootPaths) Reset() { *m = RootPaths{} } func (*RootPaths) ProtoMessage() {} -func (*RootPaths) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{28} } +func (*RootPaths) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{33} } func (m *ServerAddressByClientCIDR) Reset() { *m = ServerAddressByClientCIDR{} } func (*ServerAddressByClientCIDR) ProtoMessage() {} func (*ServerAddressByClientCIDR) Descriptor() ([]byte, []int) { - return fileDescriptorGenerated, []int{29} + return fileDescriptorGenerated, []int{34} } func (m *Status) Reset() { *m = Status{} } func (*Status) ProtoMessage() {} -func (*Status) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{30} } +func (*Status) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{35} } func (m *StatusCause) Reset() { *m = StatusCause{} } func (*StatusCause) ProtoMessage() {} -func (*StatusCause) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{31} } +func (*StatusCause) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{36} } func (m *StatusDetails) Reset() { *m = StatusDetails{} } func (*StatusDetails) ProtoMessage() {} -func (*StatusDetails) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{32} } +func (*StatusDetails) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{37} } + +func (m *TableOptions) Reset() { *m = TableOptions{} } +func (*TableOptions) ProtoMessage() {} +func (*TableOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{38} } func (m *Time) Reset() { *m = Time{} } func (*Time) ProtoMessage() {} -func (*Time) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{33} } +func (*Time) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{39} } func (m *Timestamp) Reset() { *m = Timestamp{} } func (*Timestamp) ProtoMessage() {} -func (*Timestamp) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{34} } +func (*Timestamp) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{40} } func (m *TypeMeta) Reset() { *m = TypeMeta{} } func (*TypeMeta) ProtoMessage() {} -func (*TypeMeta) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{35} } +func (*TypeMeta) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{41} } func (m *UpdateOptions) Reset() { *m = UpdateOptions{} } func (*UpdateOptions) ProtoMessage() {} -func (*UpdateOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{36} } +func (*UpdateOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{42} } func (m *Verbs) Reset() { *m = Verbs{} } func (*Verbs) ProtoMessage() {} -func (*Verbs) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{37} } +func (*Verbs) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{43} } func (m *WatchEvent) Reset() { *m = WatchEvent{} } func (*WatchEvent) ProtoMessage() {} -func (*WatchEvent) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{38} } +func (*WatchEvent) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{44} } func init() { proto.RegisterType((*APIGroup)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.APIGroup") @@ -266,6 +304,7 @@ func init() { proto.RegisterType((*DeleteOptions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.DeleteOptions") proto.RegisterType((*Duration)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.Duration") proto.RegisterType((*ExportOptions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.ExportOptions") + proto.RegisterType((*Fields)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.Fields") proto.RegisterType((*GetOptions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.GetOptions") proto.RegisterType((*GroupKind)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.GroupKind") proto.RegisterType((*GroupResource)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.GroupResource") @@ -280,16 +319,21 @@ func init() { proto.RegisterType((*List)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.List") proto.RegisterType((*ListMeta)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.ListMeta") proto.RegisterType((*ListOptions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.ListOptions") + proto.RegisterType((*ManagedFieldsEntry)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.ManagedFieldsEntry") proto.RegisterType((*MicroTime)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.MicroTime") proto.RegisterType((*ObjectMeta)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.ObjectMeta") proto.RegisterType((*OwnerReference)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.OwnerReference") + proto.RegisterType((*PartialObjectMetadata)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.PartialObjectMetadata") + proto.RegisterType((*PartialObjectMetadataList)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.PartialObjectMetadataList") proto.RegisterType((*Patch)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.Patch") + proto.RegisterType((*PatchOptions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.PatchOptions") proto.RegisterType((*Preconditions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.Preconditions") proto.RegisterType((*RootPaths)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.RootPaths") proto.RegisterType((*ServerAddressByClientCIDR)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.ServerAddressByClientCIDR") proto.RegisterType((*Status)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.Status") proto.RegisterType((*StatusCause)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.StatusCause") proto.RegisterType((*StatusDetails)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.StatusDetails") + proto.RegisterType((*TableOptions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.TableOptions") proto.RegisterType((*Time)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.Time") proto.RegisterType((*Timestamp)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.Timestamp") proto.RegisterType((*TypeMeta)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1.TypeMeta") @@ -464,6 +508,10 @@ func (m *APIResource) MarshalTo(dAtA []byte) (int, error) { i++ i = encodeVarintGenerated(dAtA, i, uint64(len(m.Version))) i += copy(dAtA[i:], m.Version) + dAtA[i] = 0x52 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(m.StorageVersionHash))) + i += copy(dAtA[i:], m.StorageVersionHash) return i, nil } @@ -576,14 +624,10 @@ func (m *CreateOptions) MarshalTo(dAtA []byte) (int, error) { i += copy(dAtA[i:], s) } } - dAtA[i] = 0x10 - i++ - if m.IncludeUninitialized { - dAtA[i] = 1 - } else { - dAtA[i] = 0 - } + dAtA[i] = 0x1a i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(m.FieldManager))) + i += copy(dAtA[i:], m.FieldManager) return i, nil } @@ -706,6 +750,55 @@ func (m *ExportOptions) MarshalTo(dAtA []byte) (int, error) { return i, nil } +func (m *Fields) Marshal() (dAtA []byte, err error) { + size := m.Size() + dAtA = make([]byte, size) + n, err := m.MarshalTo(dAtA) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *Fields) MarshalTo(dAtA []byte) (int, error) { + var i int + _ = i + var l int + _ = l + if len(m.Map) > 0 { + keysForMap := make([]string, 0, len(m.Map)) + for k := range m.Map { + keysForMap = append(keysForMap, string(k)) + } + github_com_gogo_protobuf_sortkeys.Strings(keysForMap) + for _, k := range keysForMap { + dAtA[i] = 0xa + i++ + v := m.Map[string(k)] + msgSize := 0 + if (&v) != nil { + msgSize = (&v).Size() + msgSize += 1 + sovGenerated(uint64(msgSize)) + } + mapSize := 1 + len(k) + sovGenerated(uint64(len(k))) + msgSize + i = encodeVarintGenerated(dAtA, i, uint64(mapSize)) + dAtA[i] = 0xa + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(k))) + i += copy(dAtA[i:], k) + dAtA[i] = 0x12 + i++ + i = encodeVarintGenerated(dAtA, i, uint64((&v).Size())) + n4, err := (&v).MarshalTo(dAtA[i:]) + if err != nil { + return 0, err + } + i += n4 + } + } + return i, nil +} + func (m *GetOptions) Marshal() (dAtA []byte, err error) { size := m.Size() dAtA = make([]byte, size) @@ -725,14 +818,6 @@ func (m *GetOptions) MarshalTo(dAtA []byte) (int, error) { i++ i = encodeVarintGenerated(dAtA, i, uint64(len(m.ResourceVersion))) i += copy(dAtA[i:], m.ResourceVersion) - dAtA[i] = 0x10 - i++ - if m.IncludeUninitialized { - dAtA[i] = 1 - } else { - dAtA[i] = 0 - } - i++ return i, nil } @@ -953,11 +1038,11 @@ func (m *Initializers) MarshalTo(dAtA []byte) (int, error) { dAtA[i] = 0x12 i++ i = encodeVarintGenerated(dAtA, i, uint64(m.Result.Size())) - n4, err := m.Result.MarshalTo(dAtA[i:]) + n5, err := m.Result.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n4 + i += n5 } return i, nil } @@ -1073,11 +1158,11 @@ func (m *List) MarshalTo(dAtA []byte) (int, error) { dAtA[i] = 0xa i++ i = encodeVarintGenerated(dAtA, i, uint64(m.ListMeta.Size())) - n5, err := m.ListMeta.MarshalTo(dAtA[i:]) + n6, err := m.ListMeta.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n5 + i += n6 if len(m.Items) > 0 { for _, msg := range m.Items { dAtA[i] = 0x12 @@ -1120,6 +1205,11 @@ func (m *ListMeta) MarshalTo(dAtA []byte) (int, error) { i++ i = encodeVarintGenerated(dAtA, i, uint64(len(m.Continue))) i += copy(dAtA[i:], m.Continue) + if m.RemainingItemCount != nil { + dAtA[i] = 0x20 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(*m.RemainingItemCount)) + } return i, nil } @@ -1163,21 +1253,71 @@ func (m *ListOptions) MarshalTo(dAtA []byte) (int, error) { i++ i = encodeVarintGenerated(dAtA, i, uint64(*m.TimeoutSeconds)) } - dAtA[i] = 0x30 + dAtA[i] = 0x38 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(m.Limit)) + dAtA[i] = 0x42 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(m.Continue))) + i += copy(dAtA[i:], m.Continue) + dAtA[i] = 0x48 i++ - if m.IncludeUninitialized { + if m.AllowWatchBookmarks { dAtA[i] = 1 } else { dAtA[i] = 0 } i++ - dAtA[i] = 0x38 + return i, nil +} + +func (m *ManagedFieldsEntry) Marshal() (dAtA []byte, err error) { + size := m.Size() + dAtA = make([]byte, size) + n, err := m.MarshalTo(dAtA) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *ManagedFieldsEntry) MarshalTo(dAtA []byte) (int, error) { + var i int + _ = i + var l int + _ = l + dAtA[i] = 0xa i++ - i = encodeVarintGenerated(dAtA, i, uint64(m.Limit)) - dAtA[i] = 0x42 + i = encodeVarintGenerated(dAtA, i, uint64(len(m.Manager))) + i += copy(dAtA[i:], m.Manager) + dAtA[i] = 0x12 i++ - i = encodeVarintGenerated(dAtA, i, uint64(len(m.Continue))) - i += copy(dAtA[i:], m.Continue) + i = encodeVarintGenerated(dAtA, i, uint64(len(m.Operation))) + i += copy(dAtA[i:], m.Operation) + dAtA[i] = 0x1a + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(m.APIVersion))) + i += copy(dAtA[i:], m.APIVersion) + if m.Time != nil { + dAtA[i] = 0x22 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(m.Time.Size())) + n7, err := m.Time.MarshalTo(dAtA[i:]) + if err != nil { + return 0, err + } + i += n7 + } + if m.Fields != nil { + dAtA[i] = 0x2a + i++ + i = encodeVarintGenerated(dAtA, i, uint64(m.Fields.Size())) + n8, err := m.Fields.MarshalTo(dAtA[i:]) + if err != nil { + return 0, err + } + i += n8 + } return i, nil } @@ -1226,20 +1366,20 @@ func (m *ObjectMeta) MarshalTo(dAtA []byte) (int, error) { dAtA[i] = 0x42 i++ i = encodeVarintGenerated(dAtA, i, uint64(m.CreationTimestamp.Size())) - n6, err := m.CreationTimestamp.MarshalTo(dAtA[i:]) + n9, err := m.CreationTimestamp.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n6 + i += n9 if m.DeletionTimestamp != nil { dAtA[i] = 0x4a i++ i = encodeVarintGenerated(dAtA, i, uint64(m.DeletionTimestamp.Size())) - n7, err := m.DeletionTimestamp.MarshalTo(dAtA[i:]) + n10, err := m.DeletionTimestamp.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n7 + i += n10 } if m.DeletionGracePeriodSeconds != nil { dAtA[i] = 0x50 @@ -1327,11 +1467,25 @@ func (m *ObjectMeta) MarshalTo(dAtA []byte) (int, error) { dAtA[i] = 0x1 i++ i = encodeVarintGenerated(dAtA, i, uint64(m.Initializers.Size())) - n8, err := m.Initializers.MarshalTo(dAtA[i:]) + n11, err := m.Initializers.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n8 + i += n11 + } + if len(m.ManagedFields) > 0 { + for _, msg := range m.ManagedFields { + dAtA[i] = 0x8a + i++ + dAtA[i] = 0x1 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(msg.Size())) + n, err := msg.MarshalTo(dAtA[i:]) + if err != nil { + return 0, err + } + i += n + } } return i, nil } @@ -1390,6 +1544,70 @@ func (m *OwnerReference) MarshalTo(dAtA []byte) (int, error) { return i, nil } +func (m *PartialObjectMetadata) Marshal() (dAtA []byte, err error) { + size := m.Size() + dAtA = make([]byte, size) + n, err := m.MarshalTo(dAtA) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *PartialObjectMetadata) MarshalTo(dAtA []byte) (int, error) { + var i int + _ = i + var l int + _ = l + dAtA[i] = 0xa + i++ + i = encodeVarintGenerated(dAtA, i, uint64(m.ObjectMeta.Size())) + n12, err := m.ObjectMeta.MarshalTo(dAtA[i:]) + if err != nil { + return 0, err + } + i += n12 + return i, nil +} + +func (m *PartialObjectMetadataList) Marshal() (dAtA []byte, err error) { + size := m.Size() + dAtA = make([]byte, size) + n, err := m.MarshalTo(dAtA) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *PartialObjectMetadataList) MarshalTo(dAtA []byte) (int, error) { + var i int + _ = i + var l int + _ = l + dAtA[i] = 0xa + i++ + i = encodeVarintGenerated(dAtA, i, uint64(m.ListMeta.Size())) + n13, err := m.ListMeta.MarshalTo(dAtA[i:]) + if err != nil { + return 0, err + } + i += n13 + if len(m.Items) > 0 { + for _, msg := range m.Items { + dAtA[i] = 0x12 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(msg.Size())) + n, err := msg.MarshalTo(dAtA[i:]) + if err != nil { + return 0, err + } + i += n + } + } + return i, nil +} + func (m *Patch) Marshal() (dAtA []byte, err error) { size := m.Size() dAtA = make([]byte, size) @@ -1408,6 +1626,53 @@ func (m *Patch) MarshalTo(dAtA []byte) (int, error) { return i, nil } +func (m *PatchOptions) Marshal() (dAtA []byte, err error) { + size := m.Size() + dAtA = make([]byte, size) + n, err := m.MarshalTo(dAtA) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *PatchOptions) MarshalTo(dAtA []byte) (int, error) { + var i int + _ = i + var l int + _ = l + if len(m.DryRun) > 0 { + for _, s := range m.DryRun { + dAtA[i] = 0xa + i++ + l = len(s) + for l >= 1<<7 { + dAtA[i] = uint8(uint64(l)&0x7f | 0x80) + l >>= 7 + i++ + } + dAtA[i] = uint8(l) + i++ + i += copy(dAtA[i:], s) + } + } + if m.Force != nil { + dAtA[i] = 0x10 + i++ + if *m.Force { + dAtA[i] = 1 + } else { + dAtA[i] = 0 + } + i++ + } + dAtA[i] = 0x1a + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(m.FieldManager))) + i += copy(dAtA[i:], m.FieldManager) + return i, nil +} + func (m *Preconditions) Marshal() (dAtA []byte, err error) { size := m.Size() dAtA = make([]byte, size) @@ -1429,6 +1694,12 @@ func (m *Preconditions) MarshalTo(dAtA []byte) (int, error) { i = encodeVarintGenerated(dAtA, i, uint64(len(*m.UID))) i += copy(dAtA[i:], *m.UID) } + if m.ResourceVersion != nil { + dAtA[i] = 0x12 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(*m.ResourceVersion))) + i += copy(dAtA[i:], *m.ResourceVersion) + } return i, nil } @@ -1509,11 +1780,11 @@ func (m *Status) MarshalTo(dAtA []byte) (int, error) { dAtA[i] = 0xa i++ i = encodeVarintGenerated(dAtA, i, uint64(m.ListMeta.Size())) - n9, err := m.ListMeta.MarshalTo(dAtA[i:]) + n14, err := m.ListMeta.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n9 + i += n14 dAtA[i] = 0x12 i++ i = encodeVarintGenerated(dAtA, i, uint64(len(m.Status))) @@ -1530,11 +1801,11 @@ func (m *Status) MarshalTo(dAtA []byte) (int, error) { dAtA[i] = 0x2a i++ i = encodeVarintGenerated(dAtA, i, uint64(m.Details.Size())) - n10, err := m.Details.MarshalTo(dAtA[i:]) + n15, err := m.Details.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n10 + i += n15 } dAtA[i] = 0x30 i++ @@ -1621,6 +1892,28 @@ func (m *StatusDetails) MarshalTo(dAtA []byte) (int, error) { return i, nil } +func (m *TableOptions) Marshal() (dAtA []byte, err error) { + size := m.Size() + dAtA = make([]byte, size) + n, err := m.MarshalTo(dAtA) + if err != nil { + return nil, err + } + return dAtA[:n], nil +} + +func (m *TableOptions) MarshalTo(dAtA []byte) (int, error) { + var i int + _ = i + var l int + _ = l + dAtA[i] = 0xa + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(m.IncludeObject))) + i += copy(dAtA[i:], m.IncludeObject) + return i, nil +} + func (m *Timestamp) Marshal() (dAtA []byte, err error) { size := m.Size() dAtA = make([]byte, size) @@ -1701,6 +1994,10 @@ func (m *UpdateOptions) MarshalTo(dAtA []byte) (int, error) { i += copy(dAtA[i:], s) } } + dAtA[i] = 0x12 + i++ + i = encodeVarintGenerated(dAtA, i, uint64(len(m.FieldManager))) + i += copy(dAtA[i:], m.FieldManager) return i, nil } @@ -1759,11 +2056,11 @@ func (m *WatchEvent) MarshalTo(dAtA []byte) (int, error) { dAtA[i] = 0x12 i++ i = encodeVarintGenerated(dAtA, i, uint64(m.Object.Size())) - n11, err := m.Object.MarshalTo(dAtA[i:]) + n16, err := m.Object.MarshalTo(dAtA[i:]) if err != nil { return 0, err } - i += n11 + i += n16 return i, nil } @@ -1840,6 +2137,8 @@ func (m *APIResource) Size() (n int) { n += 1 + l + sovGenerated(uint64(l)) l = len(m.Version) n += 1 + l + sovGenerated(uint64(l)) + l = len(m.StorageVersionHash) + n += 1 + l + sovGenerated(uint64(l)) return n } @@ -1884,7 +2183,8 @@ func (m *CreateOptions) Size() (n int) { n += 1 + l + sovGenerated(uint64(l)) } } - n += 2 + l = len(m.FieldManager) + n += 1 + l + sovGenerated(uint64(l)) return n } @@ -1929,13 +2229,27 @@ func (m *ExportOptions) Size() (n int) { return n } -func (m *GetOptions) Size() (n int) { +func (m *Fields) Size() (n int) { var l int _ = l - l = len(m.ResourceVersion) - n += 1 + l + sovGenerated(uint64(l)) - n += 2 - return n + if len(m.Map) > 0 { + for k, v := range m.Map { + _ = k + _ = v + l = v.Size() + mapEntrySize := 1 + len(k) + sovGenerated(uint64(len(k))) + 1 + l + sovGenerated(uint64(l)) + n += mapEntrySize + 1 + sovGenerated(uint64(mapEntrySize)) + } + } + return n +} + +func (m *GetOptions) Size() (n int) { + var l int + _ = l + l = len(m.ResourceVersion) + n += 1 + l + sovGenerated(uint64(l)) + return n } func (m *GroupKind) Size() (n int) { @@ -2085,6 +2399,9 @@ func (m *ListMeta) Size() (n int) { n += 1 + l + sovGenerated(uint64(l)) l = len(m.Continue) n += 1 + l + sovGenerated(uint64(l)) + if m.RemainingItemCount != nil { + n += 1 + sovGenerated(uint64(*m.RemainingItemCount)) + } return n } @@ -2101,10 +2418,30 @@ func (m *ListOptions) Size() (n int) { if m.TimeoutSeconds != nil { n += 1 + sovGenerated(uint64(*m.TimeoutSeconds)) } - n += 2 n += 1 + sovGenerated(uint64(m.Limit)) l = len(m.Continue) n += 1 + l + sovGenerated(uint64(l)) + n += 2 + return n +} + +func (m *ManagedFieldsEntry) Size() (n int) { + var l int + _ = l + l = len(m.Manager) + n += 1 + l + sovGenerated(uint64(l)) + l = len(m.Operation) + n += 1 + l + sovGenerated(uint64(l)) + l = len(m.APIVersion) + n += 1 + l + sovGenerated(uint64(l)) + if m.Time != nil { + l = m.Time.Size() + n += 1 + l + sovGenerated(uint64(l)) + } + if m.Fields != nil { + l = m.Fields.Size() + n += 1 + l + sovGenerated(uint64(l)) + } return n } @@ -2167,6 +2504,12 @@ func (m *ObjectMeta) Size() (n int) { l = m.Initializers.Size() n += 2 + l + sovGenerated(uint64(l)) } + if len(m.ManagedFields) > 0 { + for _, e := range m.ManagedFields { + l = e.Size() + n += 2 + l + sovGenerated(uint64(l)) + } + } return n } @@ -2190,12 +2533,51 @@ func (m *OwnerReference) Size() (n int) { return n } +func (m *PartialObjectMetadata) Size() (n int) { + var l int + _ = l + l = m.ObjectMeta.Size() + n += 1 + l + sovGenerated(uint64(l)) + return n +} + +func (m *PartialObjectMetadataList) Size() (n int) { + var l int + _ = l + l = m.ListMeta.Size() + n += 1 + l + sovGenerated(uint64(l)) + if len(m.Items) > 0 { + for _, e := range m.Items { + l = e.Size() + n += 1 + l + sovGenerated(uint64(l)) + } + } + return n +} + func (m *Patch) Size() (n int) { var l int _ = l return n } +func (m *PatchOptions) Size() (n int) { + var l int + _ = l + if len(m.DryRun) > 0 { + for _, s := range m.DryRun { + l = len(s) + n += 1 + l + sovGenerated(uint64(l)) + } + } + if m.Force != nil { + n += 2 + } + l = len(m.FieldManager) + n += 1 + l + sovGenerated(uint64(l)) + return n +} + func (m *Preconditions) Size() (n int) { var l int _ = l @@ -2203,6 +2585,10 @@ func (m *Preconditions) Size() (n int) { l = len(*m.UID) n += 1 + l + sovGenerated(uint64(l)) } + if m.ResourceVersion != nil { + l = len(*m.ResourceVersion) + n += 1 + l + sovGenerated(uint64(l)) + } return n } @@ -2280,6 +2666,14 @@ func (m *StatusDetails) Size() (n int) { return n } +func (m *TableOptions) Size() (n int) { + var l int + _ = l + l = len(m.IncludeObject) + n += 1 + l + sovGenerated(uint64(l)) + return n +} + func (m *Timestamp) Size() (n int) { var l int _ = l @@ -2307,6 +2701,8 @@ func (m *UpdateOptions) Size() (n int) { n += 1 + l + sovGenerated(uint64(l)) } } + l = len(m.FieldManager) + n += 1 + l + sovGenerated(uint64(l)) return n } @@ -2382,6 +2778,7 @@ func (this *APIResource) String() string { `Categories:` + fmt.Sprintf("%v", this.Categories) + `,`, `Group:` + fmt.Sprintf("%v", this.Group) + `,`, `Version:` + fmt.Sprintf("%v", this.Version) + `,`, + `StorageVersionHash:` + fmt.Sprintf("%v", this.StorageVersionHash) + `,`, `}`, }, "") return s @@ -2403,7 +2800,7 @@ func (this *CreateOptions) String() string { } s := strings.Join([]string{`&CreateOptions{`, `DryRun:` + fmt.Sprintf("%v", this.DryRun) + `,`, - `IncludeUninitialized:` + fmt.Sprintf("%v", this.IncludeUninitialized) + `,`, + `FieldManager:` + fmt.Sprintf("%v", this.FieldManager) + `,`, `}`, }, "") return s @@ -2443,13 +2840,32 @@ func (this *ExportOptions) String() string { }, "") return s } +func (this *Fields) String() string { + if this == nil { + return "nil" + } + keysForMap := make([]string, 0, len(this.Map)) + for k := range this.Map { + keysForMap = append(keysForMap, k) + } + github_com_gogo_protobuf_sortkeys.Strings(keysForMap) + mapStringForMap := "map[string]Fields{" + for _, k := range keysForMap { + mapStringForMap += fmt.Sprintf("%v: %v,", k, this.Map[k]) + } + mapStringForMap += "}" + s := strings.Join([]string{`&Fields{`, + `Map:` + mapStringForMap + `,`, + `}`, + }, "") + return s +} func (this *GetOptions) String() string { if this == nil { return "nil" } s := strings.Join([]string{`&GetOptions{`, `ResourceVersion:` + fmt.Sprintf("%v", this.ResourceVersion) + `,`, - `IncludeUninitialized:` + fmt.Sprintf("%v", this.IncludeUninitialized) + `,`, `}`, }, "") return s @@ -2538,6 +2954,7 @@ func (this *ListMeta) String() string { `SelfLink:` + fmt.Sprintf("%v", this.SelfLink) + `,`, `ResourceVersion:` + fmt.Sprintf("%v", this.ResourceVersion) + `,`, `Continue:` + fmt.Sprintf("%v", this.Continue) + `,`, + `RemainingItemCount:` + valueToStringGenerated(this.RemainingItemCount) + `,`, `}`, }, "") return s @@ -2552,9 +2969,23 @@ func (this *ListOptions) String() string { `Watch:` + fmt.Sprintf("%v", this.Watch) + `,`, `ResourceVersion:` + fmt.Sprintf("%v", this.ResourceVersion) + `,`, `TimeoutSeconds:` + valueToStringGenerated(this.TimeoutSeconds) + `,`, - `IncludeUninitialized:` + fmt.Sprintf("%v", this.IncludeUninitialized) + `,`, `Limit:` + fmt.Sprintf("%v", this.Limit) + `,`, `Continue:` + fmt.Sprintf("%v", this.Continue) + `,`, + `AllowWatchBookmarks:` + fmt.Sprintf("%v", this.AllowWatchBookmarks) + `,`, + `}`, + }, "") + return s +} +func (this *ManagedFieldsEntry) String() string { + if this == nil { + return "nil" + } + s := strings.Join([]string{`&ManagedFieldsEntry{`, + `Manager:` + fmt.Sprintf("%v", this.Manager) + `,`, + `Operation:` + fmt.Sprintf("%v", this.Operation) + `,`, + `APIVersion:` + fmt.Sprintf("%v", this.APIVersion) + `,`, + `Time:` + strings.Replace(fmt.Sprintf("%v", this.Time), "Time", "Time", 1) + `,`, + `Fields:` + strings.Replace(fmt.Sprintf("%v", this.Fields), "Fields", "Fields", 1) + `,`, `}`, }, "") return s @@ -2600,6 +3031,7 @@ func (this *ObjectMeta) String() string { `Finalizers:` + fmt.Sprintf("%v", this.Finalizers) + `,`, `ClusterName:` + fmt.Sprintf("%v", this.ClusterName) + `,`, `Initializers:` + strings.Replace(fmt.Sprintf("%v", this.Initializers), "Initializers", "Initializers", 1) + `,`, + `ManagedFields:` + strings.Replace(strings.Replace(fmt.Sprintf("%v", this.ManagedFields), "ManagedFieldsEntry", "ManagedFieldsEntry", 1), `&`, ``, 1) + `,`, `}`, }, "") return s @@ -2619,6 +3051,27 @@ func (this *OwnerReference) String() string { }, "") return s } +func (this *PartialObjectMetadata) String() string { + if this == nil { + return "nil" + } + s := strings.Join([]string{`&PartialObjectMetadata{`, + `ObjectMeta:` + strings.Replace(strings.Replace(this.ObjectMeta.String(), "ObjectMeta", "ObjectMeta", 1), `&`, ``, 1) + `,`, + `}`, + }, "") + return s +} +func (this *PartialObjectMetadataList) String() string { + if this == nil { + return "nil" + } + s := strings.Join([]string{`&PartialObjectMetadataList{`, + `ListMeta:` + strings.Replace(strings.Replace(this.ListMeta.String(), "ListMeta", "ListMeta", 1), `&`, ``, 1) + `,`, + `Items:` + strings.Replace(strings.Replace(fmt.Sprintf("%v", this.Items), "PartialObjectMetadata", "PartialObjectMetadata", 1), `&`, ``, 1) + `,`, + `}`, + }, "") + return s +} func (this *Patch) String() string { if this == nil { return "nil" @@ -2628,12 +3081,25 @@ func (this *Patch) String() string { }, "") return s } +func (this *PatchOptions) String() string { + if this == nil { + return "nil" + } + s := strings.Join([]string{`&PatchOptions{`, + `DryRun:` + fmt.Sprintf("%v", this.DryRun) + `,`, + `Force:` + valueToStringGenerated(this.Force) + `,`, + `FieldManager:` + fmt.Sprintf("%v", this.FieldManager) + `,`, + `}`, + }, "") + return s +} func (this *Preconditions) String() string { if this == nil { return "nil" } s := strings.Join([]string{`&Preconditions{`, `UID:` + valueToStringGenerated(this.UID) + `,`, + `ResourceVersion:` + valueToStringGenerated(this.ResourceVersion) + `,`, `}`, }, "") return s @@ -2701,6 +3167,16 @@ func (this *StatusDetails) String() string { }, "") return s } +func (this *TableOptions) String() string { + if this == nil { + return "nil" + } + s := strings.Join([]string{`&TableOptions{`, + `IncludeObject:` + fmt.Sprintf("%v", this.IncludeObject) + `,`, + `}`, + }, "") + return s +} func (this *Timestamp) String() string { if this == nil { return "nil" @@ -2729,6 +3205,7 @@ func (this *UpdateOptions) String() string { } s := strings.Join([]string{`&UpdateOptions{`, `DryRun:` + fmt.Sprintf("%v", this.DryRun) + `,`, + `FieldManager:` + fmt.Sprintf("%v", this.FieldManager) + `,`, `}`, }, "") return s @@ -3289,6 +3766,35 @@ func (m *APIResource) Unmarshal(dAtA []byte) error { } m.Version = string(dAtA[iNdEx:postIndex]) iNdEx = postIndex + case 10: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field StorageVersionHash", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.StorageVersionHash = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -3588,11 +4094,11 @@ func (m *CreateOptions) Unmarshal(dAtA []byte) error { } m.DryRun = append(m.DryRun, string(dAtA[iNdEx:postIndex])) iNdEx = postIndex - case 2: - if wireType != 0 { - return fmt.Errorf("proto: wrong wireType = %d for field IncludeUninitialized", wireType) + case 3: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field FieldManager", wireType) } - var v int + var stringLen uint64 for shift := uint(0); ; shift += 7 { if shift >= 64 { return ErrIntOverflowGenerated @@ -3602,12 +4108,21 @@ func (m *CreateOptions) Unmarshal(dAtA []byte) error { } b := dAtA[iNdEx] iNdEx++ - v |= (int(b) & 0x7F) << shift + stringLen |= (uint64(b) & 0x7F) << shift if b < 0x80 { break } } - m.IncludeUninitialized = bool(v != 0) + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.FieldManager = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -3971,7 +4486,7 @@ func (m *ExportOptions) Unmarshal(dAtA []byte) error { } return nil } -func (m *GetOptions) Unmarshal(dAtA []byte) error { +func (m *Fields) Unmarshal(dAtA []byte) error { l := len(dAtA) iNdEx := 0 for iNdEx < l { @@ -3994,17 +4509,17 @@ func (m *GetOptions) Unmarshal(dAtA []byte) error { fieldNum := int32(wire >> 3) wireType := int(wire & 0x7) if wireType == 4 { - return fmt.Errorf("proto: GetOptions: wiretype end group for non-group") + return fmt.Errorf("proto: Fields: wiretype end group for non-group") } if fieldNum <= 0 { - return fmt.Errorf("proto: GetOptions: illegal tag %d (wire type %d)", fieldNum, wire) + return fmt.Errorf("proto: Fields: illegal tag %d (wire type %d)", fieldNum, wire) } switch fieldNum { case 1: if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field ResourceVersion", wireType) + return fmt.Errorf("proto: wrong wireType = %d for field Map", wireType) } - var stringLen uint64 + var msglen int for shift := uint(0); ; shift += 7 { if shift >= 64 { return ErrIntOverflowGenerated @@ -4014,83 +4529,236 @@ func (m *GetOptions) Unmarshal(dAtA []byte) error { } b := dAtA[iNdEx] iNdEx++ - stringLen |= (uint64(b) & 0x7F) << shift + msglen |= (int(b) & 0x7F) << shift if b < 0x80 { break } } - intStringLen := int(stringLen) - if intStringLen < 0 { + if msglen < 0 { return ErrInvalidLengthGenerated } - postIndex := iNdEx + intStringLen + postIndex := iNdEx + msglen if postIndex > l { return io.ErrUnexpectedEOF } - m.ResourceVersion = string(dAtA[iNdEx:postIndex]) - iNdEx = postIndex - case 2: - if wireType != 0 { - return fmt.Errorf("proto: wrong wireType = %d for field IncludeUninitialized", wireType) + if m.Map == nil { + m.Map = make(map[string]Fields) } - var v int - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - v |= (int(b) & 0x7F) << shift - if b < 0x80 { - break + var mapkey string + mapvalue := &Fields{} + for iNdEx < postIndex { + entryPreIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } } - } - m.IncludeUninitialized = bool(v != 0) - default: - iNdEx = preIndex - skippy, err := skipGenerated(dAtA[iNdEx:]) - if err != nil { - return err - } - if skippy < 0 { - return ErrInvalidLengthGenerated - } - if (iNdEx + skippy) > l { - return io.ErrUnexpectedEOF - } - iNdEx += skippy - } - } - - if iNdEx > l { - return io.ErrUnexpectedEOF - } - return nil -} -func (m *GroupKind) Unmarshal(dAtA []byte) error { - l := len(dAtA) - iNdEx := 0 - for iNdEx < l { - preIndex := iNdEx - var wire uint64 - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - wire |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - fieldNum := int32(wire >> 3) + fieldNum := int32(wire >> 3) + if fieldNum == 1 { + var stringLenmapkey uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLenmapkey |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLenmapkey := int(stringLenmapkey) + if intStringLenmapkey < 0 { + return ErrInvalidLengthGenerated + } + postStringIndexmapkey := iNdEx + intStringLenmapkey + if postStringIndexmapkey > l { + return io.ErrUnexpectedEOF + } + mapkey = string(dAtA[iNdEx:postStringIndexmapkey]) + iNdEx = postStringIndexmapkey + } else if fieldNum == 2 { + var mapmsglen int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + mapmsglen |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + if mapmsglen < 0 { + return ErrInvalidLengthGenerated + } + postmsgIndex := iNdEx + mapmsglen + if mapmsglen < 0 { + return ErrInvalidLengthGenerated + } + if postmsgIndex > l { + return io.ErrUnexpectedEOF + } + mapvalue = &Fields{} + if err := mapvalue.Unmarshal(dAtA[iNdEx:postmsgIndex]); err != nil { + return err + } + iNdEx = postmsgIndex + } else { + iNdEx = entryPreIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > postIndex { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + m.Map[mapkey] = *mapvalue + iNdEx = postIndex + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} +func (m *GetOptions) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: GetOptions: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: GetOptions: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + case 1: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field ResourceVersion", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.ResourceVersion = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} +func (m *GroupKind) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) wireType := int(wire & 0x7) if wireType == 4 { return fmt.Errorf("proto: GroupKind: wiretype end group for non-group") @@ -5532,6 +6200,26 @@ func (m *ListMeta) Unmarshal(dAtA []byte) error { } m.Continue = string(dAtA[iNdEx:postIndex]) iNdEx = postIndex + case 4: + if wireType != 0 { + return fmt.Errorf("proto: wrong wireType = %d for field RemainingItemCount", wireType) + } + var v int64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + v |= (int64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + m.RemainingItemCount = &v default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -5709,26 +6397,6 @@ func (m *ListOptions) Unmarshal(dAtA []byte) error { } } m.TimeoutSeconds = &v - case 6: - if wireType != 0 { - return fmt.Errorf("proto: wrong wireType = %d for field IncludeUninitialized", wireType) - } - var v int - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - v |= (int(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - m.IncludeUninitialized = bool(v != 0) case 7: if wireType != 0 { return fmt.Errorf("proto: wrong wireType = %d for field Limit", wireType) @@ -5777,6 +6445,26 @@ func (m *ListOptions) Unmarshal(dAtA []byte) error { } m.Continue = string(dAtA[iNdEx:postIndex]) iNdEx = postIndex + case 9: + if wireType != 0 { + return fmt.Errorf("proto: wrong wireType = %d for field AllowWatchBookmarks", wireType) + } + var v int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + v |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + m.AllowWatchBookmarks = bool(v != 0) default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -5798,7 +6486,7 @@ func (m *ListOptions) Unmarshal(dAtA []byte) error { } return nil } -func (m *ObjectMeta) Unmarshal(dAtA []byte) error { +func (m *ManagedFieldsEntry) Unmarshal(dAtA []byte) error { l := len(dAtA) iNdEx := 0 for iNdEx < l { @@ -5821,15 +6509,15 @@ func (m *ObjectMeta) Unmarshal(dAtA []byte) error { fieldNum := int32(wire >> 3) wireType := int(wire & 0x7) if wireType == 4 { - return fmt.Errorf("proto: ObjectMeta: wiretype end group for non-group") + return fmt.Errorf("proto: ManagedFieldsEntry: wiretype end group for non-group") } if fieldNum <= 0 { - return fmt.Errorf("proto: ObjectMeta: illegal tag %d (wire type %d)", fieldNum, wire) + return fmt.Errorf("proto: ManagedFieldsEntry: illegal tag %d (wire type %d)", fieldNum, wire) } switch fieldNum { case 1: if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field Name", wireType) + return fmt.Errorf("proto: wrong wireType = %d for field Manager", wireType) } var stringLen uint64 for shift := uint(0); ; shift += 7 { @@ -5854,11 +6542,11 @@ func (m *ObjectMeta) Unmarshal(dAtA []byte) error { if postIndex > l { return io.ErrUnexpectedEOF } - m.Name = string(dAtA[iNdEx:postIndex]) + m.Manager = string(dAtA[iNdEx:postIndex]) iNdEx = postIndex case 2: if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field GenerateName", wireType) + return fmt.Errorf("proto: wrong wireType = %d for field Operation", wireType) } var stringLen uint64 for shift := uint(0); ; shift += 7 { @@ -5883,11 +6571,11 @@ func (m *ObjectMeta) Unmarshal(dAtA []byte) error { if postIndex > l { return io.ErrUnexpectedEOF } - m.GenerateName = string(dAtA[iNdEx:postIndex]) + m.Operation = ManagedFieldsOperationType(dAtA[iNdEx:postIndex]) iNdEx = postIndex case 3: if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field Namespace", wireType) + return fmt.Errorf("proto: wrong wireType = %d for field APIVersion", wireType) } var stringLen uint64 for shift := uint(0); ; shift += 7 { @@ -5912,13 +6600,13 @@ func (m *ObjectMeta) Unmarshal(dAtA []byte) error { if postIndex > l { return io.ErrUnexpectedEOF } - m.Namespace = string(dAtA[iNdEx:postIndex]) + m.APIVersion = string(dAtA[iNdEx:postIndex]) iNdEx = postIndex case 4: if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field SelfLink", wireType) + return fmt.Errorf("proto: wrong wireType = %d for field Time", wireType) } - var stringLen uint64 + var msglen int for shift := uint(0); ; shift += 7 { if shift >= 64 { return ErrIntOverflowGenerated @@ -5928,7 +6616,210 @@ func (m *ObjectMeta) Unmarshal(dAtA []byte) error { } b := dAtA[iNdEx] iNdEx++ - stringLen |= (uint64(b) & 0x7F) << shift + msglen |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + if msglen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + msglen + if postIndex > l { + return io.ErrUnexpectedEOF + } + if m.Time == nil { + m.Time = &Time{} + } + if err := m.Time.Unmarshal(dAtA[iNdEx:postIndex]); err != nil { + return err + } + iNdEx = postIndex + case 5: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field Fields", wireType) + } + var msglen int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + msglen |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + if msglen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + msglen + if postIndex > l { + return io.ErrUnexpectedEOF + } + if m.Fields == nil { + m.Fields = &Fields{} + } + if err := m.Fields.Unmarshal(dAtA[iNdEx:postIndex]); err != nil { + return err + } + iNdEx = postIndex + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} +func (m *ObjectMeta) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: ObjectMeta: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: ObjectMeta: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + case 1: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field Name", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.Name = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + case 2: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field GenerateName", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.GenerateName = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + case 3: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field Namespace", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.Namespace = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + case 4: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field SelfLink", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift if b < 0x80 { break } @@ -6461,6 +7352,37 @@ func (m *ObjectMeta) Unmarshal(dAtA []byte) error { return err } iNdEx = postIndex + case 17: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field ManagedFields", wireType) + } + var msglen int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + msglen |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + if msglen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + msglen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.ManagedFields = append(m.ManagedFields, ManagedFieldsEntry{}) + if err := m.ManagedFields[len(m.ManagedFields)-1].Unmarshal(dAtA[iNdEx:postIndex]); err != nil { + return err + } + iNdEx = postIndex default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -6588,19 +7510,381 @@ func (m *OwnerReference) Unmarshal(dAtA []byte) error { break } } - intStringLen := int(stringLen) - if intStringLen < 0 { + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.UID = k8s_io_apimachinery_pkg_types.UID(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + case 5: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field APIVersion", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.APIVersion = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + case 6: + if wireType != 0 { + return fmt.Errorf("proto: wrong wireType = %d for field Controller", wireType) + } + var v int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + v |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + b := bool(v != 0) + m.Controller = &b + case 7: + if wireType != 0 { + return fmt.Errorf("proto: wrong wireType = %d for field BlockOwnerDeletion", wireType) + } + var v int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + v |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + b := bool(v != 0) + m.BlockOwnerDeletion = &b + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} +func (m *PartialObjectMetadata) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: PartialObjectMetadata: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: PartialObjectMetadata: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + case 1: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field ObjectMeta", wireType) + } + var msglen int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + msglen |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + if msglen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + msglen + if postIndex > l { + return io.ErrUnexpectedEOF + } + if err := m.ObjectMeta.Unmarshal(dAtA[iNdEx:postIndex]); err != nil { + return err + } + iNdEx = postIndex + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} +func (m *PartialObjectMetadataList) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: PartialObjectMetadataList: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: PartialObjectMetadataList: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + case 1: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field ListMeta", wireType) + } + var msglen int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + msglen |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + if msglen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + msglen + if postIndex > l { + return io.ErrUnexpectedEOF + } + if err := m.ListMeta.Unmarshal(dAtA[iNdEx:postIndex]); err != nil { + return err + } + iNdEx = postIndex + case 2: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field Items", wireType) + } + var msglen int + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + msglen |= (int(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + if msglen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + msglen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.Items = append(m.Items, PartialObjectMetadata{}) + if err := m.Items[len(m.Items)-1].Unmarshal(dAtA[iNdEx:postIndex]); err != nil { + return err + } + iNdEx = postIndex + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} +func (m *Patch) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: Patch: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: Patch: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { return ErrInvalidLengthGenerated } - postIndex := iNdEx + intStringLen - if postIndex > l { + if (iNdEx + skippy) > l { return io.ErrUnexpectedEOF } - m.UID = k8s_io_apimachinery_pkg_types.UID(dAtA[iNdEx:postIndex]) - iNdEx = postIndex - case 5: + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} +func (m *PatchOptions) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: PatchOptions: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: PatchOptions: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + case 1: if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field APIVersion", wireType) + return fmt.Errorf("proto: wrong wireType = %d for field DryRun", wireType) } var stringLen uint64 for shift := uint(0); ; shift += 7 { @@ -6625,11 +7909,11 @@ func (m *OwnerReference) Unmarshal(dAtA []byte) error { if postIndex > l { return io.ErrUnexpectedEOF } - m.APIVersion = string(dAtA[iNdEx:postIndex]) + m.DryRun = append(m.DryRun, string(dAtA[iNdEx:postIndex])) iNdEx = postIndex - case 6: + case 2: if wireType != 0 { - return fmt.Errorf("proto: wrong wireType = %d for field Controller", wireType) + return fmt.Errorf("proto: wrong wireType = %d for field Force", wireType) } var v int for shift := uint(0); ; shift += 7 { @@ -6647,12 +7931,12 @@ func (m *OwnerReference) Unmarshal(dAtA []byte) error { } } b := bool(v != 0) - m.Controller = &b - case 7: - if wireType != 0 { - return fmt.Errorf("proto: wrong wireType = %d for field BlockOwnerDeletion", wireType) + m.Force = &b + case 3: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field FieldManager", wireType) } - var v int + var stringLen uint64 for shift := uint(0); ; shift += 7 { if shift >= 64 { return ErrIntOverflowGenerated @@ -6662,63 +7946,21 @@ func (m *OwnerReference) Unmarshal(dAtA []byte) error { } b := dAtA[iNdEx] iNdEx++ - v |= (int(b) & 0x7F) << shift + stringLen |= (uint64(b) & 0x7F) << shift if b < 0x80 { break } } - b := bool(v != 0) - m.BlockOwnerDeletion = &b - default: - iNdEx = preIndex - skippy, err := skipGenerated(dAtA[iNdEx:]) - if err != nil { - return err - } - if skippy < 0 { + intStringLen := int(stringLen) + if intStringLen < 0 { return ErrInvalidLengthGenerated } - if (iNdEx + skippy) > l { - return io.ErrUnexpectedEOF - } - iNdEx += skippy - } - } - - if iNdEx > l { - return io.ErrUnexpectedEOF - } - return nil -} -func (m *Patch) Unmarshal(dAtA []byte) error { - l := len(dAtA) - iNdEx := 0 - for iNdEx < l { - preIndex := iNdEx - var wire uint64 - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { + postIndex := iNdEx + intStringLen + if postIndex > l { return io.ErrUnexpectedEOF } - b := dAtA[iNdEx] - iNdEx++ - wire |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - fieldNum := int32(wire >> 3) - wireType := int(wire & 0x7) - if wireType == 4 { - return fmt.Errorf("proto: Patch: wiretype end group for non-group") - } - if fieldNum <= 0 { - return fmt.Errorf("proto: Patch: illegal tag %d (wire type %d)", fieldNum, wire) - } - switch fieldNum { + m.FieldManager = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -6799,6 +8041,36 @@ func (m *Preconditions) Unmarshal(dAtA []byte) error { s := k8s_io_apimachinery_pkg_types.UID(dAtA[iNdEx:postIndex]) m.UID = &s iNdEx = postIndex + case 2: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field ResourceVersion", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + s := string(dAtA[iNdEx:postIndex]) + m.ResourceVersion = &s + iNdEx = postIndex default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -7579,6 +8851,85 @@ func (m *StatusDetails) Unmarshal(dAtA []byte) error { } return nil } +func (m *TableOptions) Unmarshal(dAtA []byte) error { + l := len(dAtA) + iNdEx := 0 + for iNdEx < l { + preIndex := iNdEx + var wire uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + wire |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + fieldNum := int32(wire >> 3) + wireType := int(wire & 0x7) + if wireType == 4 { + return fmt.Errorf("proto: TableOptions: wiretype end group for non-group") + } + if fieldNum <= 0 { + return fmt.Errorf("proto: TableOptions: illegal tag %d (wire type %d)", fieldNum, wire) + } + switch fieldNum { + case 1: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field IncludeObject", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.IncludeObject = IncludeObjectPolicy(dAtA[iNdEx:postIndex]) + iNdEx = postIndex + default: + iNdEx = preIndex + skippy, err := skipGenerated(dAtA[iNdEx:]) + if err != nil { + return err + } + if skippy < 0 { + return ErrInvalidLengthGenerated + } + if (iNdEx + skippy) > l { + return io.ErrUnexpectedEOF + } + iNdEx += skippy + } + } + + if iNdEx > l { + return io.ErrUnexpectedEOF + } + return nil +} func (m *Timestamp) Unmarshal(dAtA []byte) error { l := len(dAtA) iNdEx := 0 @@ -7833,6 +9184,35 @@ func (m *UpdateOptions) Unmarshal(dAtA []byte) error { } m.DryRun = append(m.DryRun, string(dAtA[iNdEx:postIndex])) iNdEx = postIndex + case 2: + if wireType != 2 { + return fmt.Errorf("proto: wrong wireType = %d for field FieldManager", wireType) + } + var stringLen uint64 + for shift := uint(0); ; shift += 7 { + if shift >= 64 { + return ErrIntOverflowGenerated + } + if iNdEx >= l { + return io.ErrUnexpectedEOF + } + b := dAtA[iNdEx] + iNdEx++ + stringLen |= (uint64(b) & 0x7F) << shift + if b < 0x80 { + break + } + } + intStringLen := int(stringLen) + if intStringLen < 0 { + return ErrInvalidLengthGenerated + } + postIndex := iNdEx + intStringLen + if postIndex > l { + return io.ErrUnexpectedEOF + } + m.FieldManager = string(dAtA[iNdEx:postIndex]) + iNdEx = postIndex default: iNdEx = preIndex skippy, err := skipGenerated(dAtA[iNdEx:]) @@ -8152,160 +9532,182 @@ func init() { } var fileDescriptorGenerated = []byte{ - // 2465 bytes of a gzipped FileDescriptorProto - 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0xcc, 0x59, 0x4d, 0x6c, 0x23, 0x49, - 0xf5, 0x4f, 0xdb, 0xb1, 0x63, 0x3f, 0xc7, 0xf9, 0xa8, 0xcd, 0xfe, 0xff, 0xde, 0x08, 0xec, 0x6c, - 0x2f, 0x5a, 0x65, 0x61, 0xd6, 0x26, 0x59, 0x58, 0x0d, 0x03, 0x2c, 0xc4, 0x71, 0x66, 0x14, 0xed, - 0x64, 0xc6, 0xaa, 0xec, 0x0c, 0x62, 0x18, 0x21, 0x3a, 0xdd, 0x15, 0xa7, 0x49, 0xbb, 0xdb, 0x5b, - 0xd5, 0xce, 0x8c, 0xe1, 0xc0, 0x1e, 0x40, 0x70, 0x40, 0x68, 0x8e, 0x9c, 0xd0, 0x8e, 0xe0, 0xc2, - 0x95, 0x13, 0x17, 0x38, 0x21, 0x31, 0xc7, 0x91, 0xb8, 0xec, 0x01, 0x59, 0x3b, 0xe6, 0xc0, 0x09, - 0x71, 0xcf, 0x09, 0x55, 0x75, 0x75, 0x75, 0xb7, 0x1d, 0x4f, 0xda, 0x3b, 0xbb, 0x88, 0x53, 0xd2, - 0xef, 0xe3, 0xf7, 0x5e, 0x55, 0xbd, 0x7a, 0xef, 0xd5, 0x33, 0x1c, 0x9c, 0x5e, 0x65, 0x75, 0xdb, - 0x6b, 0x9c, 0xf6, 0x8f, 0x08, 0x75, 0x89, 0x4f, 0x58, 0xe3, 0x8c, 0xb8, 0x96, 0x47, 0x1b, 0x92, - 0x61, 0xf4, 0xec, 0xae, 0x61, 0x9e, 0xd8, 0x2e, 0xa1, 0x83, 0x46, 0xef, 0xb4, 0xc3, 0x09, 0xac, - 0xd1, 0x25, 0xbe, 0xd1, 0x38, 0xdb, 0x6a, 0x74, 0x88, 0x4b, 0xa8, 0xe1, 0x13, 0xab, 0xde, 0xa3, - 0x9e, 0xef, 0xa1, 0x2f, 0x04, 0x5a, 0xf5, 0xb8, 0x56, 0xbd, 0x77, 0xda, 0xe1, 0x04, 0x56, 0xe7, - 0x5a, 0xf5, 0xb3, 0xad, 0xf5, 0x37, 0x3b, 0xb6, 0x7f, 0xd2, 0x3f, 0xaa, 0x9b, 0x5e, 0xb7, 0xd1, - 0xf1, 0x3a, 0x5e, 0x43, 0x28, 0x1f, 0xf5, 0x8f, 0xc5, 0x97, 0xf8, 0x10, 0xff, 0x05, 0xa0, 0xeb, - 0x53, 0x5d, 0xa1, 0x7d, 0xd7, 0xb7, 0xbb, 0x64, 0xdc, 0x8b, 0xf5, 0xb7, 0x2f, 0x53, 0x60, 0xe6, - 0x09, 0xe9, 0x1a, 0xe3, 0x7a, 0xfa, 0x5f, 0xb3, 0x50, 0xd8, 0x69, 0xef, 0xdf, 0xa0, 0x5e, 0xbf, - 0x87, 0x36, 0x60, 0xde, 0x35, 0xba, 0xa4, 0xa2, 0x6d, 0x68, 0x9b, 0xc5, 0xe6, 0xe2, 0x93, 0x61, - 0x6d, 0x6e, 0x34, 0xac, 0xcd, 0xdf, 0x32, 0xba, 0x04, 0x0b, 0x0e, 0x72, 0xa0, 0x70, 0x46, 0x28, - 0xb3, 0x3d, 0x97, 0x55, 0x32, 0x1b, 0xd9, 0xcd, 0xd2, 0xf6, 0x3b, 0xf5, 0x34, 0xeb, 0xaf, 0x0b, - 0x03, 0x77, 0x03, 0xd5, 0xeb, 0x1e, 0x6d, 0xd9, 0xcc, 0xf4, 0xce, 0x08, 0x1d, 0x34, 0x57, 0xa4, - 0x95, 0x82, 0x64, 0x32, 0xac, 0x2c, 0xa0, 0x9f, 0x6a, 0xb0, 0xd2, 0xa3, 0xe4, 0x98, 0x50, 0x4a, - 0x2c, 0xc9, 0xaf, 0x64, 0x37, 0xb4, 0x4f, 0xc1, 0x6c, 0x45, 0x9a, 0x5d, 0x69, 0x8f, 0xe1, 0xe3, - 0x09, 0x8b, 0xe8, 0xb7, 0x1a, 0xac, 0x33, 0x42, 0xcf, 0x08, 0xdd, 0xb1, 0x2c, 0x4a, 0x18, 0x6b, - 0x0e, 0x76, 0x1d, 0x9b, 0xb8, 0xfe, 0xee, 0x7e, 0x0b, 0xb3, 0xca, 0xbc, 0xd8, 0x87, 0x6f, 0xa5, - 0x73, 0xe8, 0x70, 0x1a, 0x4e, 0x53, 0x97, 0x1e, 0xad, 0x4f, 0x15, 0x61, 0xf8, 0x39, 0x6e, 0xe8, - 0xc7, 0xb0, 0x18, 0x1e, 0xe4, 0x4d, 0x9b, 0xf9, 0xe8, 0x2e, 0xe4, 0x3b, 0xfc, 0x83, 0x55, 0x34, - 0xe1, 0x60, 0x3d, 0x9d, 0x83, 0x21, 0x46, 0x73, 0x49, 0xfa, 0x93, 0x17, 0x9f, 0x0c, 0x4b, 0x34, - 0xfd, 0x4f, 0x59, 0x28, 0xed, 0xb4, 0xf7, 0x31, 0x61, 0x5e, 0x9f, 0x9a, 0x24, 0x45, 0xd0, 0x6c, - 0x03, 0xf0, 0xbf, 0xac, 0x67, 0x98, 0xc4, 0xaa, 0x64, 0x36, 0xb4, 0xcd, 0x42, 0x13, 0x49, 0x39, - 0xb8, 0xa5, 0x38, 0x38, 0x26, 0xc5, 0x51, 0x4f, 0x6d, 0xd7, 0x12, 0xa7, 0x1d, 0x43, 0x7d, 0xd7, - 0x76, 0x2d, 0x2c, 0x38, 0xe8, 0x26, 0xe4, 0xce, 0x08, 0x3d, 0xe2, 0xfb, 0xcf, 0x03, 0xe2, 0x4b, - 0xe9, 0x96, 0x77, 0x97, 0xab, 0x34, 0x8b, 0xa3, 0x61, 0x2d, 0x27, 0xfe, 0xc5, 0x01, 0x08, 0xaa, - 0x03, 0xb0, 0x13, 0x8f, 0xfa, 0xc2, 0x9d, 0x4a, 0x6e, 0x23, 0xbb, 0x59, 0x6c, 0x2e, 0x71, 0xff, - 0x0e, 0x15, 0x15, 0xc7, 0x24, 0xd0, 0x55, 0x58, 0x64, 0xb6, 0xdb, 0xe9, 0x3b, 0x06, 0xe5, 0x84, - 0x4a, 0x5e, 0xf8, 0xb9, 0x26, 0xfd, 0x5c, 0x3c, 0x8c, 0xf1, 0x70, 0x42, 0x92, 0x5b, 0x32, 0x0d, - 0x9f, 0x74, 0x3c, 0x6a, 0x13, 0x56, 0x59, 0x88, 0x2c, 0xed, 0x2a, 0x2a, 0x8e, 0x49, 0xa0, 0xd7, - 0x20, 0x27, 0x76, 0xbe, 0x52, 0x10, 0x26, 0xca, 0xd2, 0x44, 0x4e, 0x1c, 0x0b, 0x0e, 0x78, 0xe8, - 0x0d, 0x58, 0x90, 0xb7, 0xa6, 0x52, 0x14, 0x62, 0xcb, 0x52, 0x6c, 0x21, 0x0c, 0xeb, 0x90, 0xaf, - 0xff, 0x41, 0x83, 0xe5, 0xd8, 0xf9, 0x89, 0x58, 0xb9, 0x0a, 0x8b, 0x9d, 0xd8, 0x4d, 0x91, 0x67, - 0xa9, 0x56, 0x13, 0xbf, 0x45, 0x38, 0x21, 0x89, 0x08, 0x14, 0xa9, 0x44, 0x0a, 0x33, 0xc2, 0x56, - 0xea, 0x40, 0x0b, 0x7d, 0x88, 0x2c, 0xc5, 0x88, 0x0c, 0x47, 0xc8, 0xfa, 0x3f, 0x35, 0x11, 0x74, - 0x61, 0x8e, 0x40, 0x9b, 0xb1, 0x3c, 0xa4, 0x89, 0x2d, 0x5c, 0x9c, 0x92, 0x43, 0x2e, 0xb9, 0xbc, - 0x99, 0xff, 0x89, 0xcb, 0x7b, 0xad, 0xf0, 0xeb, 0x0f, 0x6b, 0x73, 0x1f, 0xfc, 0x7d, 0x63, 0x4e, - 0xff, 0x99, 0x06, 0xe5, 0x5d, 0x4a, 0x0c, 0x9f, 0xdc, 0xee, 0xf9, 0x62, 0x05, 0x3a, 0xe4, 0x2d, - 0x3a, 0xc0, 0x7d, 0x57, 0xae, 0x14, 0xf8, 0xa5, 0x6c, 0x09, 0x0a, 0x96, 0x1c, 0xd4, 0x86, 0x35, - 0xdb, 0x35, 0x9d, 0xbe, 0x45, 0xee, 0xb8, 0xb6, 0x6b, 0xfb, 0xb6, 0xe1, 0xd8, 0x3f, 0x52, 0x97, - 0xed, 0x73, 0xd2, 0xbb, 0xb5, 0xfd, 0x0b, 0x64, 0xf0, 0x85, 0x9a, 0xfa, 0xcf, 0xb3, 0x50, 0x6e, - 0x11, 0x87, 0x44, 0x7e, 0x5c, 0x07, 0xd4, 0xa1, 0x86, 0x49, 0xda, 0x84, 0xda, 0x9e, 0x75, 0x48, - 0x4c, 0xcf, 0xb5, 0x98, 0x08, 0x95, 0x6c, 0xf3, 0xff, 0x46, 0xc3, 0x1a, 0xba, 0x31, 0xc1, 0xc5, - 0x17, 0x68, 0x20, 0x07, 0xca, 0x3d, 0x2a, 0xfe, 0xb7, 0x7d, 0x59, 0x48, 0xf8, 0x05, 0x7e, 0x2b, - 0xdd, 0x19, 0xb4, 0xe3, 0xaa, 0xcd, 0xd5, 0xd1, 0xb0, 0x56, 0x4e, 0x90, 0x70, 0x12, 0x1c, 0x7d, - 0x1b, 0x56, 0x3c, 0xda, 0x3b, 0x31, 0xdc, 0x16, 0xe9, 0x11, 0xd7, 0x22, 0xae, 0xcf, 0x44, 0x52, - 0x29, 0x34, 0xd7, 0x78, 0xfa, 0xbf, 0x3d, 0xc6, 0xc3, 0x13, 0xd2, 0xe8, 0x1e, 0xac, 0xf6, 0xa8, - 0xd7, 0x33, 0x3a, 0x06, 0x47, 0x6c, 0x7b, 0x8e, 0x6d, 0x0e, 0x44, 0xd2, 0x29, 0x36, 0xaf, 0x8c, - 0x86, 0xb5, 0xd5, 0xf6, 0x38, 0xf3, 0x7c, 0x58, 0x7b, 0x49, 0x6c, 0x1d, 0xa7, 0x44, 0x4c, 0x3c, - 0x09, 0x13, 0x3b, 0xdb, 0xdc, 0xb4, 0xb3, 0xd5, 0xf7, 0xa1, 0xd0, 0xea, 0x53, 0xa1, 0x85, 0xbe, - 0x09, 0x05, 0x4b, 0xfe, 0x2f, 0x77, 0xfe, 0xd5, 0xb0, 0x7e, 0x86, 0x32, 0xe7, 0xc3, 0x5a, 0x99, - 0x57, 0xfc, 0x7a, 0x48, 0xc0, 0x4a, 0x45, 0xbf, 0x0f, 0xe5, 0xbd, 0x87, 0x3d, 0x8f, 0xfa, 0xe1, - 0x99, 0xbe, 0x0e, 0x79, 0x22, 0x08, 0x02, 0xad, 0x10, 0x25, 0xfd, 0x40, 0x0c, 0x4b, 0x2e, 0x4f, - 0x42, 0xe4, 0xa1, 0x61, 0xfa, 0x32, 0xa0, 0x54, 0x12, 0xda, 0xe3, 0x44, 0x1c, 0xf0, 0xf4, 0xc7, - 0x1a, 0xc0, 0x0d, 0xa2, 0xb0, 0x77, 0x60, 0x39, 0xbc, 0xc0, 0xc9, 0xbc, 0xf2, 0xff, 0x52, 0x7b, - 0x19, 0x27, 0xd9, 0x78, 0x5c, 0xfe, 0x33, 0x08, 0xeb, 0xfb, 0x50, 0x14, 0xd9, 0x8c, 0x17, 0x92, - 0x28, 0xb5, 0x6a, 0xcf, 0x49, 0xad, 0x61, 0x25, 0xca, 0x4c, 0xab, 0x44, 0xb1, 0xcb, 0xeb, 0x40, - 0x39, 0xd0, 0x0d, 0x8b, 0x63, 0x2a, 0x0b, 0x57, 0xa0, 0x10, 0x2e, 0x5c, 0x5a, 0x51, 0x4d, 0x51, - 0x08, 0x84, 0x95, 0x44, 0xcc, 0xda, 0x09, 0x24, 0x32, 0x73, 0x3a, 0x63, 0xb1, 0x4a, 0x91, 0x79, - 0x7e, 0xa5, 0x88, 0x59, 0xfa, 0x09, 0x54, 0xa6, 0x75, 0x52, 0x2f, 0x50, 0x3b, 0xd2, 0xbb, 0xa2, - 0xff, 0x4a, 0x83, 0x95, 0x38, 0x52, 0xfa, 0xe3, 0x4b, 0x6f, 0xe4, 0xf2, 0x9e, 0x23, 0xb6, 0x23, - 0xbf, 0xd1, 0x60, 0x2d, 0xb1, 0xb4, 0x99, 0x4e, 0x7c, 0x06, 0xa7, 0xe2, 0xc1, 0x91, 0x9d, 0x21, - 0x38, 0x1a, 0x50, 0xda, 0x57, 0x71, 0x4f, 0x2f, 0xef, 0xd2, 0xf4, 0x3f, 0x6b, 0xb0, 0x18, 0xd3, - 0x60, 0xe8, 0x3e, 0x2c, 0xf0, 0x1c, 0x68, 0xbb, 0x1d, 0xd9, 0x41, 0xa6, 0x2c, 0xec, 0x31, 0x90, - 0x68, 0x5d, 0xed, 0x00, 0x09, 0x87, 0x90, 0xa8, 0x0d, 0x79, 0x4a, 0x58, 0xdf, 0xf1, 0x65, 0xfa, - 0xbf, 0x92, 0xb2, 0x04, 0xfb, 0x86, 0xdf, 0x67, 0x41, 0x9e, 0xc4, 0x42, 0x1f, 0x4b, 0x1c, 0xfd, - 0x6f, 0x19, 0x28, 0xdf, 0x34, 0x8e, 0x88, 0x73, 0x48, 0x1c, 0x62, 0xfa, 0x1e, 0x45, 0x3f, 0x86, - 0x52, 0xd7, 0xf0, 0xcd, 0x13, 0x41, 0x0d, 0xfb, 0xe0, 0x56, 0x3a, 0x43, 0x09, 0xa4, 0xfa, 0x41, - 0x04, 0xb3, 0xe7, 0xfa, 0x74, 0xd0, 0x7c, 0x49, 0x2e, 0xac, 0x14, 0xe3, 0xe0, 0xb8, 0x35, 0xf1, - 0x78, 0x11, 0xdf, 0x7b, 0x0f, 0x7b, 0xbc, 0xe0, 0xcf, 0xfe, 0x66, 0x4a, 0xb8, 0x80, 0xc9, 0xfb, - 0x7d, 0x9b, 0x92, 0x2e, 0x71, 0xfd, 0xe8, 0xf1, 0x72, 0x30, 0x86, 0x8f, 0x27, 0x2c, 0xae, 0xbf, - 0x03, 0x2b, 0xe3, 0xce, 0xa3, 0x15, 0xc8, 0x9e, 0x92, 0x41, 0x10, 0x0b, 0x98, 0xff, 0x8b, 0xd6, - 0x20, 0x77, 0x66, 0x38, 0x7d, 0x99, 0x7f, 0x70, 0xf0, 0x71, 0x2d, 0x73, 0x55, 0xd3, 0x7f, 0xa7, - 0x41, 0x65, 0x9a, 0x23, 0xe8, 0xf3, 0x31, 0xa0, 0x66, 0x49, 0x7a, 0x95, 0x7d, 0x97, 0x0c, 0x02, - 0xd4, 0x3d, 0x28, 0x78, 0x3d, 0xfe, 0xdc, 0xf4, 0xa8, 0x8c, 0xf3, 0x37, 0xc2, 0xd8, 0xbd, 0x2d, - 0xe9, 0xe7, 0xc3, 0xda, 0xcb, 0x09, 0xf8, 0x90, 0x81, 0x95, 0x2a, 0x2f, 0x92, 0xc2, 0x1f, 0x5e, - 0xb8, 0x55, 0x91, 0xbc, 0x2b, 0x28, 0x58, 0x72, 0xf4, 0x3f, 0x6a, 0x30, 0x2f, 0x5a, 0xd9, 0xfb, - 0x50, 0xe0, 0xfb, 0x67, 0x19, 0xbe, 0x21, 0xfc, 0x4a, 0xfd, 0xf0, 0xe1, 0xda, 0x07, 0xc4, 0x37, - 0xa2, 0xfb, 0x15, 0x52, 0xb0, 0x42, 0x44, 0x18, 0x72, 0xb6, 0x4f, 0xba, 0xe1, 0x41, 0xbe, 0x39, - 0x15, 0x5a, 0x3e, 0xbb, 0xeb, 0xd8, 0x78, 0xb0, 0xf7, 0xd0, 0x27, 0x2e, 0x3f, 0x8c, 0x28, 0x19, - 0xec, 0x73, 0x0c, 0x1c, 0x40, 0xe9, 0xbf, 0xd7, 0x40, 0x99, 0xe2, 0xd7, 0x9d, 0x11, 0xe7, 0xf8, - 0xa6, 0xed, 0x9e, 0xca, 0x6d, 0x55, 0xee, 0x1c, 0x4a, 0x3a, 0x56, 0x12, 0x17, 0x95, 0xd8, 0xcc, - 0x8c, 0x25, 0xf6, 0x0a, 0x14, 0x4c, 0xcf, 0xf5, 0x6d, 0xb7, 0x3f, 0x91, 0x5f, 0x76, 0x25, 0x1d, - 0x2b, 0x09, 0xfd, 0x69, 0x16, 0x4a, 0xdc, 0xd7, 0xb0, 0xc6, 0x7f, 0x1d, 0xca, 0x4e, 0xfc, 0xf4, - 0xa4, 0xcf, 0x2f, 0x4b, 0x88, 0xe4, 0x7d, 0xc4, 0x49, 0x59, 0xae, 0x7c, 0x6c, 0x13, 0xc7, 0x52, - 0xca, 0x99, 0xa4, 0xf2, 0xf5, 0x38, 0x13, 0x27, 0x65, 0x79, 0x9e, 0x7d, 0xc0, 0xe3, 0x5a, 0x36, - 0x73, 0x6a, 0x6b, 0xbf, 0xc3, 0x89, 0x38, 0xe0, 0x5d, 0xb4, 0x3f, 0xf3, 0x33, 0xee, 0xcf, 0x35, - 0x58, 0xe2, 0x07, 0xe9, 0xf5, 0xfd, 0xb0, 0xe3, 0xcd, 0x89, 0xbe, 0x0b, 0x8d, 0x86, 0xb5, 0xa5, - 0xf7, 0x12, 0x1c, 0x3c, 0x26, 0x39, 0xb5, 0x7d, 0xc9, 0x7f, 0xd2, 0xf6, 0x85, 0xaf, 0xda, 0xb1, - 0xbb, 0xb6, 0x5f, 0x59, 0x10, 0x4e, 0xa8, 0x55, 0xdf, 0xe4, 0x44, 0x1c, 0xf0, 0x12, 0x47, 0x5a, - 0xb8, 0xf4, 0x48, 0xdf, 0x87, 0xe2, 0x81, 0x6d, 0x52, 0x8f, 0xaf, 0x85, 0x17, 0x26, 0x96, 0x68, - 0xec, 0x55, 0x02, 0x0f, 0xd7, 0x18, 0xf2, 0xb9, 0x2b, 0xae, 0xe1, 0x7a, 0x41, 0xfb, 0x9e, 0x8b, - 0x5c, 0xb9, 0xc5, 0x89, 0x38, 0xe0, 0x5d, 0x5b, 0xe3, 0xf5, 0xe8, 0x17, 0x8f, 0x6b, 0x73, 0x8f, - 0x1e, 0xd7, 0xe6, 0x3e, 0x7c, 0x2c, 0x6b, 0xd3, 0xbf, 0x00, 0xe0, 0xf6, 0xd1, 0x0f, 0x89, 0x19, - 0xc4, 0xfc, 0xe5, 0x13, 0x04, 0xde, 0x63, 0xc8, 0xc1, 0x95, 0x78, 0x6d, 0x67, 0xc6, 0x7a, 0x8c, - 0x18, 0x0f, 0x27, 0x24, 0x51, 0x03, 0x8a, 0x6a, 0xaa, 0x20, 0xe3, 0x7b, 0x55, 0xaa, 0x15, 0xd5, - 0xe8, 0x01, 0x47, 0x32, 0x89, 0x0b, 0x38, 0x7f, 0xe9, 0x05, 0x6c, 0x42, 0xb6, 0x6f, 0x5b, 0x22, - 0x24, 0x8a, 0xcd, 0x2f, 0x87, 0x09, 0xf0, 0xce, 0x7e, 0xeb, 0x7c, 0x58, 0x7b, 0x75, 0xda, 0x48, - 0xce, 0x1f, 0xf4, 0x08, 0xab, 0xdf, 0xd9, 0x6f, 0x61, 0xae, 0x7c, 0x51, 0x90, 0xe6, 0x67, 0x0c, - 0xd2, 0x6d, 0x00, 0xb9, 0x6a, 0xae, 0x1d, 0xc4, 0x86, 0x9a, 0xb0, 0xdc, 0x50, 0x1c, 0x1c, 0x93, - 0x42, 0x0c, 0x56, 0x4d, 0xfe, 0xce, 0xb4, 0x3d, 0x97, 0x1f, 0x3d, 0xf3, 0x8d, 0x6e, 0x30, 0x63, - 0x28, 0x6d, 0x7f, 0x31, 0x5d, 0xc6, 0xe4, 0x6a, 0xcd, 0x57, 0xa4, 0x99, 0xd5, 0xdd, 0x71, 0x30, - 0x3c, 0x89, 0x8f, 0x3c, 0x58, 0xb5, 0xe4, 0xcb, 0x28, 0x32, 0x5a, 0x9c, 0xd9, 0xe8, 0xcb, 0xdc, - 0x60, 0x6b, 0x1c, 0x08, 0x4f, 0x62, 0xa3, 0xef, 0xc3, 0x7a, 0x48, 0x9c, 0x7c, 0x9e, 0x56, 0x40, - 0xec, 0x54, 0x95, 0x3f, 0xdc, 0x5b, 0x53, 0xa5, 0xf0, 0x73, 0x10, 0x90, 0x05, 0x79, 0x27, 0xe8, - 0x2e, 0x4a, 0xa2, 0x22, 0x7c, 0x23, 0xdd, 0x2a, 0xa2, 0xe8, 0xaf, 0xc7, 0xbb, 0x0a, 0xf5, 0xfc, - 0x92, 0x0d, 0x85, 0xc4, 0x46, 0x0f, 0xa1, 0x64, 0xb8, 0xae, 0xe7, 0x1b, 0xc1, 0x83, 0x79, 0x51, - 0x98, 0xda, 0x99, 0xd9, 0xd4, 0x4e, 0x84, 0x31, 0xd6, 0xc5, 0xc4, 0x38, 0x38, 0x6e, 0x0a, 0x3d, - 0x80, 0x65, 0xef, 0x81, 0x4b, 0x28, 0x26, 0xc7, 0x84, 0x12, 0xd7, 0x24, 0xac, 0x52, 0x16, 0xd6, - 0xbf, 0x92, 0xd2, 0x7a, 0x42, 0x39, 0x0a, 0xe9, 0x24, 0x9d, 0xe1, 0x71, 0x2b, 0xa8, 0x0e, 0x70, - 0x6c, 0xbb, 0xb2, 0x17, 0xad, 0x2c, 0x45, 0x63, 0xb2, 0xeb, 0x8a, 0x8a, 0x63, 0x12, 0xe8, 0xab, - 0x50, 0x32, 0x9d, 0x3e, 0xf3, 0x49, 0x30, 0x8f, 0x5b, 0x16, 0x37, 0x48, 0xad, 0x6f, 0x37, 0x62, - 0xe1, 0xb8, 0x1c, 0x3a, 0x81, 0x45, 0x3b, 0xd6, 0xf4, 0x56, 0x56, 0x44, 0x2c, 0x6e, 0xcf, 0xdc, - 0xe9, 0xb2, 0xe6, 0x0a, 0xcf, 0x44, 0x71, 0x0a, 0x4e, 0x20, 0xaf, 0x7f, 0x0d, 0x4a, 0x9f, 0xb0, - 0x07, 0xe3, 0x3d, 0xdc, 0xf8, 0xd1, 0xcd, 0xd4, 0xc3, 0xfd, 0x25, 0x03, 0x4b, 0xc9, 0x0d, 0x57, - 0x6f, 0x1d, 0x6d, 0xea, 0x7c, 0x35, 0xcc, 0xca, 0xd9, 0xa9, 0x59, 0x59, 0x26, 0xbf, 0xf9, 0x17, - 0x49, 0x7e, 0xdb, 0x00, 0x46, 0xcf, 0x0e, 0xf3, 0x5e, 0x90, 0x47, 0x55, 0xe6, 0x8a, 0x26, 0x7e, - 0x38, 0x26, 0x25, 0x26, 0xa8, 0x9e, 0xeb, 0x53, 0xcf, 0x71, 0x08, 0x95, 0xc5, 0x34, 0x98, 0xa0, - 0x2a, 0x2a, 0x8e, 0x49, 0xa0, 0xeb, 0x80, 0x8e, 0x1c, 0xcf, 0x3c, 0x15, 0x5b, 0x10, 0xde, 0x73, - 0x91, 0x25, 0x0b, 0xc1, 0xe0, 0xaa, 0x39, 0xc1, 0xc5, 0x17, 0x68, 0xe8, 0x0b, 0x90, 0x6b, 0xf3, - 0xb6, 0x42, 0xbf, 0x0d, 0xc9, 0x99, 0x13, 0x7a, 0x27, 0xd8, 0x09, 0x4d, 0x0d, 0x85, 0x66, 0xdb, - 0x05, 0xfd, 0x0a, 0x14, 0xb1, 0xe7, 0xf9, 0x6d, 0xc3, 0x3f, 0x61, 0xa8, 0x06, 0xb9, 0x1e, 0xff, - 0x47, 0x8e, 0xfb, 0xc4, 0xac, 0x5a, 0x70, 0x70, 0x40, 0xd7, 0x7f, 0xa9, 0xc1, 0x2b, 0x53, 0xe7, - 0x8c, 0x7c, 0x47, 0x4d, 0xf5, 0x25, 0x5d, 0x52, 0x3b, 0x1a, 0xc9, 0xe1, 0x98, 0x14, 0xef, 0xc4, - 0x12, 0xc3, 0xc9, 0xf1, 0x4e, 0x2c, 0x61, 0x0d, 0x27, 0x65, 0xf5, 0x7f, 0x67, 0x20, 0x1f, 0x3c, - 0xcb, 0x3e, 0xe3, 0xe6, 0xfb, 0x75, 0xc8, 0x33, 0x61, 0x47, 0xba, 0xa7, 0xb2, 0x65, 0x60, 0x1d, - 0x4b, 0x2e, 0x6f, 0x62, 0xba, 0x84, 0x31, 0xa3, 0x13, 0x06, 0xaf, 0x6a, 0x62, 0x0e, 0x02, 0x32, - 0x0e, 0xf9, 0xe8, 0x6d, 0xfe, 0x0a, 0x35, 0x98, 0xea, 0x0b, 0xab, 0x21, 0x24, 0x16, 0xd4, 0xf3, - 0x61, 0x6d, 0x51, 0x82, 0x8b, 0x6f, 0x2c, 0xa5, 0xd1, 0x3d, 0x58, 0xb0, 0x88, 0x6f, 0xd8, 0x4e, - 0xd0, 0x0e, 0xa6, 0x9e, 0x5e, 0x06, 0x60, 0xad, 0x40, 0xb5, 0x59, 0xe2, 0x3e, 0xc9, 0x0f, 0x1c, - 0x02, 0xf2, 0x8b, 0x67, 0x7a, 0x56, 0xf0, 0x93, 0x42, 0x2e, 0xba, 0x78, 0xbb, 0x9e, 0x45, 0xb0, - 0xe0, 0xe8, 0x8f, 0x34, 0x28, 0x05, 0x48, 0xbb, 0x46, 0x9f, 0x11, 0xb4, 0xa5, 0x56, 0x11, 0x1c, - 0x77, 0x58, 0x93, 0xe7, 0xdf, 0x1b, 0xf4, 0xc8, 0xf9, 0xb0, 0x56, 0x14, 0x62, 0xfc, 0x43, 0x2d, - 0x20, 0xb6, 0x47, 0x99, 0x4b, 0xf6, 0xe8, 0x35, 0xc8, 0x89, 0xd6, 0x5b, 0x6e, 0xa6, 0x6a, 0xf4, - 0x44, 0x7b, 0x8e, 0x03, 0x9e, 0xfe, 0x71, 0x06, 0xca, 0x89, 0xc5, 0xa5, 0xe8, 0xea, 0xd4, 0xa8, - 0x24, 0x93, 0x62, 0xfc, 0x36, 0xfd, 0x87, 0xa0, 0xef, 0x42, 0xde, 0xe4, 0xeb, 0x0b, 0x7f, 0x89, - 0xdb, 0x9a, 0xe5, 0x28, 0xc4, 0xce, 0x44, 0x91, 0x24, 0x3e, 0x19, 0x96, 0x80, 0xe8, 0x06, 0xac, - 0x52, 0xe2, 0xd3, 0xc1, 0xce, 0xb1, 0x4f, 0x68, 0xbc, 0xff, 0xcf, 0x45, 0x7d, 0x0f, 0x1e, 0x17, - 0xc0, 0x93, 0x3a, 0x61, 0xaa, 0xcc, 0xbf, 0x40, 0xaa, 0xd4, 0x1d, 0x98, 0xff, 0x2f, 0xf6, 0xe8, - 0xdf, 0x83, 0x62, 0xd4, 0x45, 0x7d, 0xca, 0x26, 0xf5, 0x1f, 0x40, 0x81, 0x47, 0x63, 0xd8, 0xfd, - 0x5f, 0x52, 0x89, 0x92, 0x35, 0x22, 0x93, 0xa6, 0x46, 0xe8, 0x6f, 0x41, 0xf9, 0x4e, 0xcf, 0x9a, - 0xed, 0x57, 0x14, 0x7d, 0x1b, 0x82, 0x1f, 0x05, 0x79, 0x0a, 0x0e, 0x9e, 0xf9, 0xb1, 0x14, 0x1c, - 0x7f, 0xb3, 0x27, 0x7f, 0xaf, 0x01, 0xf1, 0xe6, 0xdc, 0x3b, 0x23, 0xae, 0xcf, 0x57, 0xc3, 0x8f, - 0x6d, 0x7c, 0x35, 0xe2, 0xee, 0x09, 0x0e, 0xba, 0x03, 0x79, 0x4f, 0xb4, 0x64, 0x72, 0xf0, 0x35, - 0xe3, 0x0c, 0x41, 0x85, 0x6a, 0xd0, 0xd7, 0x61, 0x09, 0xd6, 0xdc, 0x7c, 0xf2, 0xac, 0x3a, 0xf7, - 0xf4, 0x59, 0x75, 0xee, 0xa3, 0x67, 0xd5, 0xb9, 0x0f, 0x46, 0x55, 0xed, 0xc9, 0xa8, 0xaa, 0x3d, - 0x1d, 0x55, 0xb5, 0x8f, 0x46, 0x55, 0xed, 0xe3, 0x51, 0x55, 0x7b, 0xf4, 0x8f, 0xea, 0xdc, 0xbd, - 0xcc, 0xd9, 0xd6, 0x7f, 0x02, 0x00, 0x00, 0xff, 0xff, 0xab, 0xec, 0x02, 0x4a, 0x00, 0x21, 0x00, - 0x00, + // 2820 bytes of a gzipped FileDescriptorProto + 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0xcc, 0x1a, 0xcf, 0x6f, 0x1c, 0x57, + 0xd9, 0xb3, 0xeb, 0x5d, 0xef, 0x7e, 0xeb, 0x4d, 0xec, 0x97, 0x04, 0xb6, 0x46, 0x78, 0xdd, 0x29, + 0xaa, 0x52, 0x48, 0xd7, 0x4d, 0x4a, 0xab, 0x90, 0xd2, 0x82, 0xd7, 0x76, 0x52, 0xd3, 0xb8, 0xb1, + 0x9e, 0x93, 0x20, 0x42, 0x84, 0x3a, 0xde, 0x79, 0x5e, 0x0f, 0x9e, 0x9d, 0x99, 0xbe, 0x37, 0xeb, + 0xc4, 0x70, 0xa0, 0x07, 0x10, 0x20, 0x41, 0xd5, 0x23, 0x27, 0xd4, 0x0a, 0xfe, 0x02, 0x4e, 0x9c, + 0x38, 0x55, 0xa2, 0x17, 0xa4, 0x4a, 0x5c, 0x2a, 0x81, 0x56, 0xad, 0x41, 0x82, 0x1b, 0xe2, 0xea, + 0x13, 0x7a, 0xbf, 0x66, 0xde, 0xec, 0x7a, 0xe3, 0x59, 0x52, 0x2a, 0x4e, 0x3b, 0xf3, 0xfd, 0x7e, + 0xef, 0x7d, 0xef, 0xfb, 0x35, 0x0b, 0x9b, 0xfb, 0x57, 0x59, 0xcb, 0x0b, 0x97, 0xf7, 0xfb, 0x3b, + 0x84, 0x06, 0x24, 0x26, 0x6c, 0xf9, 0x80, 0x04, 0x6e, 0x48, 0x97, 0x15, 0xc2, 0x89, 0xbc, 0x9e, + 0xd3, 0xd9, 0xf3, 0x02, 0x42, 0x0f, 0x97, 0xa3, 0xfd, 0x2e, 0x07, 0xb0, 0xe5, 0x1e, 0x89, 0x9d, + 0xe5, 0x83, 0xcb, 0xcb, 0x5d, 0x12, 0x10, 0xea, 0xc4, 0xc4, 0x6d, 0x45, 0x34, 0x8c, 0x43, 0xf4, + 0x25, 0xc9, 0xd5, 0x32, 0xb9, 0x5a, 0xd1, 0x7e, 0x97, 0x03, 0x58, 0x8b, 0x73, 0xb5, 0x0e, 0x2e, + 0x2f, 0x3c, 0xdb, 0xf5, 0xe2, 0xbd, 0xfe, 0x4e, 0xab, 0x13, 0xf6, 0x96, 0xbb, 0x61, 0x37, 0x5c, + 0x16, 0xcc, 0x3b, 0xfd, 0x5d, 0xf1, 0x26, 0x5e, 0xc4, 0x93, 0x14, 0xba, 0x30, 0xd6, 0x14, 0xda, + 0x0f, 0x62, 0xaf, 0x47, 0x86, 0xad, 0x58, 0x78, 0xf1, 0x34, 0x06, 0xd6, 0xd9, 0x23, 0x3d, 0x67, + 0x98, 0xcf, 0xfe, 0x63, 0x11, 0x2a, 0x2b, 0x5b, 0x1b, 0x37, 0x68, 0xd8, 0x8f, 0xd0, 0x12, 0x4c, + 0x07, 0x4e, 0x8f, 0x34, 0xac, 0x25, 0xeb, 0x62, 0xb5, 0x3d, 0xfb, 0xc1, 0xa0, 0x39, 0x75, 0x34, + 0x68, 0x4e, 0xbf, 0xee, 0xf4, 0x08, 0x16, 0x18, 0xe4, 0x43, 0xe5, 0x80, 0x50, 0xe6, 0x85, 0x01, + 0x6b, 0x14, 0x96, 0x8a, 0x17, 0x6b, 0x57, 0x5e, 0x69, 0xe5, 0x59, 0x7f, 0x4b, 0x28, 0xb8, 0x2b, + 0x59, 0xaf, 0x87, 0x74, 0xcd, 0x63, 0x9d, 0xf0, 0x80, 0xd0, 0xc3, 0xf6, 0x9c, 0xd2, 0x52, 0x51, + 0x48, 0x86, 0x13, 0x0d, 0xe8, 0xc7, 0x16, 0xcc, 0x45, 0x94, 0xec, 0x12, 0x4a, 0x89, 0xab, 0xf0, + 0x8d, 0xe2, 0x92, 0xf5, 0x29, 0xa8, 0x6d, 0x28, 0xb5, 0x73, 0x5b, 0x43, 0xf2, 0xf1, 0x88, 0x46, + 0xf4, 0x1b, 0x0b, 0x16, 0x18, 0xa1, 0x07, 0x84, 0xae, 0xb8, 0x2e, 0x25, 0x8c, 0xb5, 0x0f, 0x57, + 0x7d, 0x8f, 0x04, 0xf1, 0xea, 0xc6, 0x1a, 0x66, 0x8d, 0x69, 0xb1, 0x0f, 0xdf, 0xc8, 0x67, 0xd0, + 0xf6, 0x38, 0x39, 0x6d, 0x5b, 0x59, 0xb4, 0x30, 0x96, 0x84, 0xe1, 0x47, 0x98, 0x61, 0xef, 0xc2, + 0xac, 0x3e, 0xc8, 0x9b, 0x1e, 0x8b, 0xd1, 0x5d, 0x28, 0x77, 0xf9, 0x0b, 0x6b, 0x58, 0xc2, 0xc0, + 0x56, 0x3e, 0x03, 0xb5, 0x8c, 0xf6, 0x19, 0x65, 0x4f, 0x59, 0xbc, 0x32, 0xac, 0xa4, 0xd9, 0x3f, + 0x9f, 0x86, 0xda, 0xca, 0xd6, 0x06, 0x26, 0x2c, 0xec, 0xd3, 0x0e, 0xc9, 0xe1, 0x34, 0x57, 0x00, + 0xf8, 0x2f, 0x8b, 0x9c, 0x0e, 0x71, 0x1b, 0x85, 0x25, 0xeb, 0x62, 0xa5, 0x8d, 0x14, 0x1d, 0xbc, + 0x9e, 0x60, 0xb0, 0x41, 0xc5, 0xa5, 0xee, 0x7b, 0x81, 0x2b, 0x4e, 0xdb, 0x90, 0xfa, 0x9a, 0x17, + 0xb8, 0x58, 0x60, 0xd0, 0x4d, 0x28, 0x1d, 0x10, 0xba, 0xc3, 0xf7, 0x9f, 0x3b, 0xc4, 0x57, 0xf2, + 0x2d, 0xef, 0x2e, 0x67, 0x69, 0x57, 0x8f, 0x06, 0xcd, 0x92, 0x78, 0xc4, 0x52, 0x08, 0x6a, 0x01, + 0xb0, 0xbd, 0x90, 0xc6, 0xc2, 0x9c, 0x46, 0x69, 0xa9, 0x78, 0xb1, 0xda, 0x3e, 0xc3, 0xed, 0xdb, + 0x4e, 0xa0, 0xd8, 0xa0, 0x40, 0x57, 0x61, 0x96, 0x79, 0x41, 0xb7, 0xef, 0x3b, 0x94, 0x03, 0x1a, + 0x65, 0x61, 0xe7, 0x79, 0x65, 0xe7, 0xec, 0xb6, 0x81, 0xc3, 0x19, 0x4a, 0xae, 0xa9, 0xe3, 0xc4, + 0xa4, 0x1b, 0x52, 0x8f, 0xb0, 0xc6, 0x4c, 0xaa, 0x69, 0x35, 0x81, 0x62, 0x83, 0x02, 0x3d, 0x05, + 0x25, 0xb1, 0xf3, 0x8d, 0x8a, 0x50, 0x51, 0x57, 0x2a, 0x4a, 0xe2, 0x58, 0xb0, 0xc4, 0xa1, 0x67, + 0x60, 0x46, 0xdd, 0x9a, 0x46, 0x55, 0x90, 0x9d, 0x55, 0x64, 0x33, 0xda, 0xad, 0x35, 0x1e, 0x7d, + 0x0b, 0x10, 0x8b, 0x43, 0xea, 0x74, 0x89, 0x42, 0xbd, 0xea, 0xb0, 0xbd, 0x06, 0x08, 0xae, 0x05, + 0xc5, 0x85, 0xb6, 0x47, 0x28, 0xf0, 0x09, 0x5c, 0xf6, 0xef, 0x2c, 0x38, 0x6b, 0xf8, 0x82, 0xf0, + 0xbb, 0xab, 0x30, 0xdb, 0x35, 0x6e, 0x9d, 0xf2, 0x8b, 0x64, 0x67, 0xcc, 0x1b, 0x89, 0x33, 0x94, + 0x88, 0x40, 0x95, 0x2a, 0x49, 0x3a, 0xba, 0x5c, 0xce, 0xed, 0xb4, 0xda, 0x86, 0x54, 0x93, 0x01, + 0x64, 0x38, 0x95, 0x6c, 0xff, 0xc3, 0x12, 0x0e, 0xac, 0xe3, 0x0d, 0xba, 0x68, 0xc4, 0x34, 0x4b, + 0x1c, 0xc7, 0xec, 0x98, 0x78, 0x74, 0x4a, 0x20, 0x28, 0xfc, 0x5f, 0x04, 0x82, 0x6b, 0x95, 0x5f, + 0xbd, 0xdb, 0x9c, 0x7a, 0xeb, 0xaf, 0x4b, 0x53, 0x76, 0x0f, 0xea, 0xab, 0x94, 0x38, 0x31, 0xb9, + 0x15, 0xc5, 0x62, 0x01, 0x36, 0x94, 0x5d, 0x7a, 0x88, 0xfb, 0x81, 0x5a, 0x28, 0xf0, 0xfb, 0xbd, + 0x26, 0x20, 0x58, 0x61, 0xf8, 0xf9, 0xed, 0x7a, 0xc4, 0x77, 0x37, 0x9d, 0xc0, 0xe9, 0x12, 0xaa, + 0x6e, 0x60, 0xb2, 0xab, 0xd7, 0x0d, 0x1c, 0xce, 0x50, 0xda, 0x3f, 0x2d, 0x42, 0x7d, 0x8d, 0xf8, + 0x24, 0xd5, 0x77, 0x1d, 0x50, 0x97, 0x3a, 0x1d, 0xb2, 0x45, 0xa8, 0x17, 0xba, 0xdb, 0xa4, 0x13, + 0x06, 0x2e, 0x13, 0x1e, 0x51, 0x6c, 0x7f, 0x8e, 0xfb, 0xd9, 0x8d, 0x11, 0x2c, 0x3e, 0x81, 0x03, + 0xf9, 0x50, 0x8f, 0xa8, 0x78, 0xf6, 0x62, 0x95, 0x7b, 0xf8, 0x9d, 0x7f, 0x3e, 0xdf, 0x56, 0x6f, + 0x99, 0xac, 0xed, 0xf9, 0xa3, 0x41, 0xb3, 0x9e, 0x01, 0xe1, 0xac, 0x70, 0xf4, 0x4d, 0x98, 0x0b, + 0x69, 0xb4, 0xe7, 0x04, 0x6b, 0x24, 0x22, 0x81, 0x4b, 0x82, 0x98, 0x89, 0x5d, 0xa8, 0xb4, 0xcf, + 0xf3, 0x8c, 0x71, 0x6b, 0x08, 0x87, 0x47, 0xa8, 0xd1, 0x3d, 0x98, 0x8f, 0x68, 0x18, 0x39, 0x5d, + 0x87, 0x4b, 0xdc, 0x0a, 0x7d, 0xaf, 0x73, 0x28, 0xe2, 0x54, 0xb5, 0x7d, 0xe9, 0x68, 0xd0, 0x9c, + 0xdf, 0x1a, 0x46, 0x1e, 0x0f, 0x9a, 0xe7, 0xc4, 0xd6, 0x71, 0x48, 0x8a, 0xc4, 0xa3, 0x62, 0x8c, + 0x33, 0x2c, 0x8d, 0x3b, 0x43, 0x7b, 0x03, 0x2a, 0x6b, 0x7d, 0x2a, 0xb8, 0xd0, 0xcb, 0x50, 0x71, + 0xd5, 0xb3, 0xda, 0xf9, 0x27, 0x75, 0xca, 0xd5, 0x34, 0xc7, 0x83, 0x66, 0x9d, 0x17, 0x09, 0x2d, + 0x0d, 0xc0, 0x09, 0x8b, 0x7d, 0x1f, 0xea, 0xeb, 0x0f, 0xa3, 0x90, 0xc6, 0xfa, 0x4c, 0x9f, 0x86, + 0x32, 0x11, 0x00, 0x21, 0xad, 0x92, 0xe6, 0x09, 0x49, 0x86, 0x15, 0x96, 0xc7, 0x2d, 0xf2, 0xd0, + 0xe9, 0xc4, 0x2a, 0xe0, 0x27, 0x71, 0x6b, 0x9d, 0x03, 0xb1, 0xc4, 0xd9, 0xef, 0x5b, 0x50, 0x16, + 0x1e, 0xc5, 0xd0, 0x6d, 0x28, 0xf6, 0x9c, 0x48, 0x25, 0xab, 0x17, 0xf2, 0x9d, 0xac, 0x64, 0x6d, + 0x6d, 0x3a, 0xd1, 0x7a, 0x10, 0xd3, 0xc3, 0x76, 0x4d, 0x29, 0x29, 0x6e, 0x3a, 0x11, 0xe6, 0xe2, + 0x16, 0x5c, 0xa8, 0x68, 0x2c, 0x9a, 0x83, 0xe2, 0x3e, 0x39, 0x94, 0x01, 0x09, 0xf3, 0x47, 0xd4, + 0x86, 0xd2, 0x81, 0xe3, 0xf7, 0x89, 0xf2, 0xa7, 0x4b, 0x93, 0x68, 0xc5, 0x92, 0xf5, 0x5a, 0xe1, + 0xaa, 0x65, 0xdf, 0x02, 0xb8, 0x41, 0x92, 0x1d, 0x5a, 0x81, 0xb3, 0x3a, 0xda, 0x64, 0x83, 0xe0, + 0xe7, 0x95, 0x79, 0x67, 0x71, 0x16, 0x8d, 0x87, 0xe9, 0xed, 0xfb, 0x50, 0x15, 0x81, 0x92, 0xe7, + 0xbb, 0x34, 0x03, 0x58, 0x8f, 0xc8, 0x00, 0x3a, 0x61, 0x16, 0xc6, 0x25, 0x4c, 0x23, 0x2e, 0xf8, + 0x50, 0x97, 0xbc, 0x3a, 0x87, 0xe7, 0xd2, 0x70, 0x09, 0x2a, 0xda, 0x4c, 0xa5, 0x25, 0xa9, 0xdd, + 0xb4, 0x20, 0x9c, 0x50, 0x18, 0xda, 0xf6, 0x20, 0x13, 0xf4, 0xf3, 0x29, 0x33, 0x12, 0x5a, 0xe1, + 0xd1, 0x09, 0xcd, 0xd0, 0xf4, 0x23, 0x68, 0x8c, 0x2b, 0xf8, 0x1e, 0x23, 0x2d, 0xe5, 0x37, 0xc5, + 0x7e, 0xdb, 0x82, 0x39, 0x53, 0x52, 0xfe, 0xe3, 0xcb, 0xaf, 0xe4, 0xf4, 0xd2, 0xc8, 0xd8, 0x91, + 0x5f, 0x5b, 0x70, 0x3e, 0xb3, 0xb4, 0x89, 0x4e, 0x7c, 0x02, 0xa3, 0x4c, 0xe7, 0x28, 0x4e, 0xe0, + 0x1c, 0xcb, 0x50, 0xdb, 0x08, 0xbc, 0xd8, 0x73, 0x7c, 0xef, 0x07, 0x84, 0x9e, 0x5e, 0x4c, 0xda, + 0x7f, 0xb0, 0x60, 0xd6, 0xe0, 0x60, 0xe8, 0x3e, 0xcc, 0xf0, 0xb8, 0xeb, 0x05, 0x5d, 0x15, 0x3b, + 0x72, 0xd6, 0x0c, 0x86, 0x90, 0x74, 0x5d, 0x5b, 0x52, 0x12, 0xd6, 0x22, 0xd1, 0x16, 0x94, 0x29, + 0x61, 0x7d, 0x3f, 0x9e, 0x2c, 0x44, 0x6c, 0xc7, 0x4e, 0xdc, 0x67, 0x32, 0x36, 0x63, 0xc1, 0x8f, + 0x95, 0x1c, 0xfb, 0xcf, 0x05, 0xa8, 0xdf, 0x74, 0x76, 0x88, 0xbf, 0x4d, 0x7c, 0xd2, 0x89, 0x43, + 0x8a, 0x7e, 0x08, 0xb5, 0x9e, 0x13, 0x77, 0xf6, 0x04, 0x54, 0x97, 0xeb, 0x6b, 0xf9, 0x14, 0x65, + 0x24, 0xb5, 0x36, 0x53, 0x31, 0x32, 0x20, 0x9e, 0x53, 0x0b, 0xab, 0x19, 0x18, 0x6c, 0x6a, 0x13, + 0x3d, 0x96, 0x78, 0x5f, 0x7f, 0x18, 0xf1, 0x5a, 0x62, 0xf2, 0xd6, 0x2e, 0x63, 0x02, 0x26, 0x6f, + 0xf6, 0x3d, 0x4a, 0x7a, 0x24, 0x88, 0xd3, 0x1e, 0x6b, 0x73, 0x48, 0x3e, 0x1e, 0xd1, 0xb8, 0xf0, + 0x0a, 0xcc, 0x0d, 0x1b, 0x7f, 0x42, 0xbc, 0x3e, 0x6f, 0xc6, 0xeb, 0xaa, 0x19, 0x81, 0x7f, 0x6b, + 0x41, 0x63, 0x9c, 0x21, 0xe8, 0x8b, 0x86, 0xa0, 0x34, 0x47, 0xbc, 0x46, 0x0e, 0xa5, 0xd4, 0x75, + 0xa8, 0x84, 0x11, 0xef, 0x8a, 0x43, 0xaa, 0xfc, 0xfc, 0x19, 0xed, 0xbb, 0xb7, 0x14, 0xfc, 0x78, + 0xd0, 0xbc, 0x90, 0x11, 0xaf, 0x11, 0x38, 0x61, 0xe5, 0x89, 0x59, 0xd8, 0xc3, 0x8b, 0x85, 0x24, + 0x31, 0xdf, 0x15, 0x10, 0xac, 0x30, 0xf6, 0xef, 0x2d, 0x98, 0x16, 0x55, 0xf2, 0x7d, 0xa8, 0xf0, + 0xfd, 0x73, 0x9d, 0xd8, 0x11, 0x76, 0xe5, 0xee, 0xcf, 0x38, 0xf7, 0x26, 0x89, 0x9d, 0xf4, 0x7e, + 0x69, 0x08, 0x4e, 0x24, 0x22, 0x0c, 0x25, 0x2f, 0x26, 0x3d, 0x7d, 0x90, 0xcf, 0x8e, 0x15, 0xad, + 0xa6, 0x03, 0x2d, 0xec, 0x3c, 0x58, 0x7f, 0x18, 0x93, 0x80, 0x1f, 0x46, 0x1a, 0x0c, 0x36, 0xb8, + 0x0c, 0x2c, 0x45, 0xd9, 0xff, 0xb6, 0x20, 0x51, 0xc5, 0xaf, 0x3b, 0x23, 0xfe, 0xee, 0x4d, 0x2f, + 0xd8, 0x57, 0xdb, 0x9a, 0x98, 0xb3, 0xad, 0xe0, 0x38, 0xa1, 0x38, 0x29, 0x21, 0x16, 0x26, 0x4b, + 0x88, 0x5c, 0x61, 0x27, 0x0c, 0x62, 0x2f, 0xe8, 0x8f, 0xc4, 0x97, 0x55, 0x05, 0xc7, 0x09, 0x05, + 0xaf, 0x3b, 0x29, 0xe9, 0x39, 0x5e, 0xe0, 0x05, 0x5d, 0xbe, 0x88, 0xd5, 0xb0, 0x1f, 0xc4, 0xa2, + 0x00, 0x53, 0x75, 0x27, 0x1e, 0xc1, 0xe2, 0x13, 0x38, 0xec, 0x3f, 0x15, 0xa1, 0xc6, 0xd7, 0xac, + 0x33, 0xfb, 0x4b, 0x50, 0xf7, 0x4d, 0x2f, 0x50, 0x6b, 0xbf, 0xa0, 0x4c, 0xc9, 0xde, 0x6b, 0x9c, + 0xa5, 0xe5, 0xcc, 0xa2, 0x5c, 0x4e, 0x98, 0x0b, 0x59, 0xe6, 0xeb, 0x26, 0x12, 0x67, 0x69, 0x79, + 0xbc, 0x7e, 0xc0, 0xef, 0x87, 0x2a, 0x44, 0x93, 0x23, 0xfa, 0x36, 0x07, 0x62, 0x89, 0x3b, 0x69, + 0x9f, 0xa7, 0x27, 0xdc, 0xe7, 0x6b, 0x70, 0x86, 0x3b, 0x44, 0xd8, 0x8f, 0x75, 0xb5, 0x5e, 0x12, + 0xbb, 0x86, 0x8e, 0x06, 0xcd, 0x33, 0xb7, 0x33, 0x18, 0x3c, 0x44, 0xc9, 0x6d, 0xf4, 0xbd, 0x9e, + 0x17, 0x37, 0x66, 0x04, 0x4b, 0x62, 0xe3, 0x4d, 0x0e, 0xc4, 0x12, 0x97, 0x39, 0xc8, 0xca, 0xa9, + 0x07, 0xb9, 0x09, 0xe7, 0x1c, 0xdf, 0x0f, 0x1f, 0x88, 0x65, 0xb6, 0xc3, 0x70, 0xbf, 0xe7, 0xd0, + 0x7d, 0x26, 0x7a, 0xdc, 0x4a, 0xfb, 0x0b, 0x8a, 0xf1, 0xdc, 0xca, 0x28, 0x09, 0x3e, 0x89, 0xcf, + 0xfe, 0x67, 0x01, 0x90, 0xec, 0x56, 0x5c, 0x59, 0xc4, 0xc9, 0x40, 0xf3, 0x0c, 0xcc, 0xf4, 0x54, + 0xb7, 0x63, 0x65, 0xf3, 0x9c, 0x6e, 0x74, 0x34, 0x1e, 0x6d, 0x42, 0x55, 0x5e, 0xf8, 0xd4, 0x89, + 0x97, 0x15, 0x71, 0xf5, 0x96, 0x46, 0x1c, 0x0f, 0x9a, 0x0b, 0x19, 0x35, 0x09, 0xe6, 0xf6, 0x61, + 0x44, 0x70, 0x2a, 0x01, 0x5d, 0x01, 0x70, 0x22, 0xcf, 0x1c, 0x6d, 0x55, 0xd3, 0xd1, 0x48, 0xda, + 0xa4, 0x62, 0x83, 0x0a, 0xbd, 0x0a, 0xd3, 0x7c, 0xe3, 0xd5, 0xdc, 0xe3, 0xcb, 0xf9, 0xc2, 0x06, + 0x3f, 0xba, 0x76, 0x85, 0xe7, 0x52, 0xfe, 0x84, 0x85, 0x04, 0x74, 0x0f, 0xca, 0xc2, 0xcb, 0xe4, + 0x21, 0x4f, 0x58, 0xff, 0x8a, 0x66, 0x48, 0x15, 0xef, 0xc7, 0xc9, 0x13, 0x56, 0x12, 0xed, 0x37, + 0xa1, 0xba, 0xe9, 0x75, 0x68, 0xc8, 0xd5, 0xf1, 0x0d, 0x66, 0x99, 0xe6, 0x2f, 0xd9, 0x60, 0xed, + 0x4b, 0x1a, 0xcf, 0x9d, 0x28, 0x70, 0x82, 0x50, 0xb6, 0x78, 0xa5, 0xd4, 0x89, 0x5e, 0xe7, 0x40, + 0x2c, 0x71, 0xd7, 0xce, 0xf3, 0xfa, 0xe1, 0x67, 0xef, 0x35, 0xa7, 0xde, 0x79, 0xaf, 0x39, 0xf5, + 0xee, 0x7b, 0xaa, 0x96, 0xf8, 0x7b, 0x0d, 0xe0, 0xd6, 0xce, 0xf7, 0x49, 0x47, 0xc6, 0xa8, 0xd3, + 0x07, 0x53, 0xbc, 0x26, 0x54, 0xf3, 0x50, 0x31, 0xc4, 0x29, 0x0c, 0xd5, 0x84, 0x06, 0x0e, 0x67, + 0x28, 0xd1, 0x32, 0x54, 0x93, 0x61, 0x95, 0x3a, 0xb6, 0x79, 0xed, 0x06, 0xc9, 0x44, 0x0b, 0xa7, + 0x34, 0x99, 0x80, 0x39, 0x7d, 0x6a, 0xc0, 0x6c, 0x43, 0xb1, 0xef, 0xb9, 0xe2, 0x54, 0xaa, 0xed, + 0xe7, 0x74, 0xc2, 0xba, 0xb3, 0xb1, 0x76, 0x3c, 0x68, 0x3e, 0x39, 0x6e, 0xd2, 0x1b, 0x1f, 0x46, + 0x84, 0xb5, 0xee, 0x6c, 0xac, 0x61, 0xce, 0x7c, 0x52, 0x30, 0x28, 0x4f, 0x18, 0x0c, 0xae, 0x00, + 0xa8, 0x55, 0x73, 0x6e, 0x79, 0xab, 0x13, 0xef, 0xbc, 0x91, 0x60, 0xb0, 0x41, 0x85, 0x18, 0xcc, + 0x77, 0x28, 0x91, 0xce, 0xee, 0xf5, 0x08, 0x8b, 0x9d, 0x9e, 0x1c, 0x5d, 0x4d, 0xe6, 0xaa, 0x4f, + 0x28, 0x35, 0xf3, 0xab, 0xc3, 0xc2, 0xf0, 0xa8, 0x7c, 0x14, 0xc2, 0xbc, 0xab, 0xba, 0xe7, 0x54, + 0x69, 0x75, 0x62, 0xa5, 0x17, 0xb8, 0xc2, 0xb5, 0x61, 0x41, 0x78, 0x54, 0x36, 0xfa, 0x1e, 0x2c, + 0x68, 0xe0, 0xe8, 0x08, 0x43, 0x0c, 0xd3, 0x8a, 0xed, 0xc5, 0xa3, 0x41, 0x73, 0x61, 0x6d, 0x2c, + 0x15, 0x7e, 0x84, 0x04, 0xe4, 0x42, 0xd9, 0x97, 0xd5, 0x60, 0x4d, 0x64, 0xf0, 0xaf, 0xe7, 0x5b, + 0x45, 0xea, 0xfd, 0x2d, 0xb3, 0x0a, 0x4c, 0x5a, 0x74, 0x55, 0x00, 0x2a, 0xd9, 0xe8, 0x21, 0xd4, + 0x9c, 0x20, 0x08, 0x63, 0x47, 0x0e, 0x55, 0x66, 0x85, 0xaa, 0x95, 0x89, 0x55, 0xad, 0xa4, 0x32, + 0x86, 0xaa, 0x4e, 0x03, 0x83, 0x4d, 0x55, 0xe8, 0x01, 0x9c, 0x0d, 0x1f, 0x04, 0x84, 0x62, 0xb2, + 0x4b, 0x28, 0x09, 0x3a, 0x84, 0x35, 0xea, 0x42, 0xfb, 0x57, 0x73, 0x6a, 0xcf, 0x30, 0xa7, 0x2e, + 0x9d, 0x85, 0x33, 0x3c, 0xac, 0x05, 0xb5, 0x00, 0x76, 0xbd, 0x40, 0xf5, 0x0e, 0x8d, 0x33, 0xe9, + 0xf4, 0xf5, 0x7a, 0x02, 0xc5, 0x06, 0x05, 0x7a, 0x01, 0x6a, 0x1d, 0xbf, 0xcf, 0x62, 0x22, 0xc7, + 0xbc, 0x67, 0xc5, 0x0d, 0x4a, 0xd6, 0xb7, 0x9a, 0xa2, 0xb0, 0x49, 0x87, 0xf6, 0x60, 0xd6, 0x33, + 0x9a, 0x94, 0xc6, 0x9c, 0xf0, 0xc5, 0x2b, 0x13, 0x77, 0x26, 0xac, 0x3d, 0xc7, 0x23, 0x91, 0x09, + 0xc1, 0x19, 0xc9, 0xa8, 0x0f, 0xf5, 0x9e, 0x99, 0x6a, 0x1a, 0xf3, 0x62, 0x1f, 0xaf, 0xe6, 0x53, + 0x35, 0x9a, 0x0c, 0xd3, 0x7a, 0x24, 0x83, 0xc3, 0x59, 0x2d, 0x0b, 0x5f, 0x83, 0xda, 0x7f, 0x59, + 0xaa, 0xf3, 0x52, 0x7f, 0xd8, 0x63, 0x26, 0x2a, 0xf5, 0xdf, 0x2f, 0xc0, 0x99, 0xec, 0x39, 0x27, + 0x2d, 0xb1, 0x35, 0xf6, 0x6b, 0x81, 0x4e, 0x06, 0xc5, 0xb1, 0xc9, 0x40, 0xc5, 0xdc, 0xe9, 0xc7, + 0x89, 0xb9, 0xd9, 0x74, 0x5e, 0xca, 0x95, 0xce, 0x5b, 0x00, 0xbc, 0xdc, 0xa1, 0xa1, 0xef, 0x13, + 0x2a, 0x42, 0x74, 0x45, 0x7d, 0x0f, 0x48, 0xa0, 0xd8, 0xa0, 0xe0, 0xb5, 0xed, 0x8e, 0x1f, 0x76, + 0xf6, 0xc5, 0x16, 0xe8, 0xf0, 0x22, 0x82, 0x73, 0x45, 0xd6, 0xb6, 0xed, 0x11, 0x2c, 0x3e, 0x81, + 0xc3, 0x3e, 0x84, 0x0b, 0x5b, 0x0e, 0xe5, 0x8e, 0x94, 0x5e, 0x65, 0xd1, 0x3c, 0xbc, 0x31, 0xd2, + 0x9a, 0x3c, 0x37, 0x69, 0x48, 0x48, 0x17, 0x9d, 0xc2, 0xd2, 0xf6, 0xc4, 0xfe, 0x8b, 0x05, 0x4f, + 0x9c, 0xa8, 0xfb, 0x33, 0x68, 0x8d, 0xde, 0xc8, 0xb6, 0x46, 0x2f, 0xe5, 0x1c, 0x21, 0x9f, 0x64, + 0xed, 0x98, 0x46, 0x69, 0x06, 0x4a, 0x5b, 0xbc, 0xec, 0xb4, 0x7f, 0x69, 0xc1, 0xac, 0x78, 0x9a, + 0x64, 0xfc, 0xde, 0x84, 0xd2, 0x6e, 0xa8, 0x47, 0x6c, 0x15, 0xf9, 0xa5, 0xea, 0x3a, 0x07, 0x60, + 0x09, 0x7f, 0x8c, 0xf9, 0xfc, 0xdb, 0x16, 0x64, 0x07, 0xdf, 0xe8, 0x15, 0xe9, 0xf3, 0x56, 0x32, + 0x99, 0x9e, 0xd0, 0xdf, 0x5f, 0x1e, 0xd7, 0xd8, 0x9d, 0xcb, 0x35, 0xe5, 0xbc, 0x04, 0x55, 0x1c, + 0x86, 0xf1, 0x96, 0x13, 0xef, 0x31, 0xbe, 0xf0, 0x88, 0x3f, 0xa8, 0xbd, 0x11, 0x0b, 0x17, 0x18, + 0x2c, 0xe1, 0xf6, 0x2f, 0x2c, 0x78, 0x62, 0xec, 0x27, 0x11, 0x7e, 0xf5, 0x3a, 0xc9, 0x9b, 0x5a, + 0x51, 0xe2, 0x85, 0x29, 0x1d, 0x36, 0xa8, 0x78, 0x47, 0x96, 0xf9, 0x8e, 0x32, 0xdc, 0x91, 0x65, + 0xb4, 0xe1, 0x2c, 0xad, 0xfd, 0xaf, 0x02, 0x94, 0xe5, 0x98, 0xe7, 0x7f, 0xec, 0xb1, 0x4f, 0x43, + 0x99, 0x09, 0x3d, 0xca, 0xbc, 0x24, 0x9b, 0x4b, 0xed, 0x58, 0x61, 0x45, 0x17, 0x43, 0x18, 0x73, + 0xba, 0x3a, 0xca, 0xa5, 0x5d, 0x8c, 0x04, 0x63, 0x8d, 0x47, 0x2f, 0x42, 0x99, 0x12, 0x87, 0x25, + 0xfd, 0xe1, 0xa2, 0x16, 0x89, 0x05, 0xf4, 0x78, 0xd0, 0x9c, 0x55, 0xc2, 0xc5, 0x3b, 0x56, 0xd4, + 0xe8, 0x1e, 0xcc, 0xb8, 0x24, 0x76, 0x3c, 0x5f, 0x77, 0x0c, 0xcf, 0x4f, 0x32, 0x0e, 0x5b, 0x93, + 0xac, 0xed, 0x1a, 0xb7, 0x49, 0xbd, 0x60, 0x2d, 0x90, 0x47, 0xe8, 0x4e, 0xe8, 0xca, 0x2f, 0xa9, + 0xa5, 0x34, 0x42, 0xaf, 0x86, 0x2e, 0xc1, 0x02, 0x63, 0xbf, 0x63, 0x41, 0x4d, 0x4a, 0x5a, 0x75, + 0xfa, 0x8c, 0xa0, 0xcb, 0xc9, 0x2a, 0xe4, 0x71, 0xeb, 0x9a, 0x71, 0x9a, 0x77, 0x59, 0xc7, 0x83, + 0x66, 0x55, 0x90, 0x89, 0x96, 0x4b, 0x2f, 0xc0, 0xd8, 0xa3, 0xc2, 0x29, 0x7b, 0xf4, 0x14, 0x94, + 0xc4, 0xed, 0x51, 0x9b, 0x99, 0xdc, 0x75, 0x71, 0xc1, 0xb0, 0xc4, 0xd9, 0x1f, 0x17, 0xa0, 0x9e, + 0x59, 0x5c, 0x8e, 0xae, 0x23, 0x19, 0xbd, 0x16, 0x72, 0x8c, 0xf3, 0xc7, 0x7f, 0xff, 0xfe, 0x0e, + 0x94, 0x3b, 0x7c, 0x7d, 0xfa, 0x0f, 0x08, 0x97, 0x27, 0x39, 0x0a, 0xb1, 0x33, 0xa9, 0x27, 0x89, + 0x57, 0x86, 0x95, 0x40, 0x74, 0x03, 0xe6, 0x29, 0x89, 0xe9, 0xe1, 0xca, 0x6e, 0x4c, 0xa8, 0x39, + 0x07, 0x28, 0xa5, 0x75, 0x39, 0x1e, 0x26, 0xc0, 0xa3, 0x3c, 0x3a, 0xa7, 0x96, 0x1f, 0x23, 0xa7, + 0xda, 0x3b, 0x30, 0x7b, 0xdb, 0xd9, 0xf1, 0x93, 0x6f, 0x8a, 0x18, 0xea, 0x5e, 0xd0, 0xf1, 0xfb, + 0x2e, 0x91, 0xd1, 0x58, 0x47, 0x2f, 0x7d, 0x69, 0x37, 0x4c, 0xe4, 0xf1, 0xa0, 0x79, 0x2e, 0x03, + 0x90, 0x1f, 0xd1, 0x70, 0x56, 0x84, 0xed, 0xc3, 0xf4, 0x67, 0xd8, 0xa7, 0x7e, 0x17, 0xaa, 0x69, + 0x27, 0xf1, 0x29, 0xab, 0xb4, 0xdf, 0x80, 0x0a, 0xf7, 0x78, 0xdd, 0x01, 0x9f, 0x52, 0x16, 0x65, + 0x0b, 0x96, 0x42, 0x9e, 0x82, 0xc5, 0xee, 0x41, 0xfd, 0x4e, 0xe4, 0x3e, 0xe6, 0x57, 0xe5, 0x42, + 0xee, 0xac, 0x75, 0x05, 0xe4, 0x3f, 0x35, 0x78, 0x82, 0x90, 0x99, 0xdb, 0x48, 0x10, 0x66, 0xe2, + 0x35, 0xbe, 0x2a, 0xfc, 0xc4, 0x02, 0x10, 0xa3, 0x9f, 0xf5, 0x03, 0x12, 0xc4, 0x7c, 0x1f, 0xb8, + 0x53, 0x0d, 0xef, 0x83, 0x88, 0x0c, 0x02, 0x83, 0xee, 0x40, 0x39, 0x94, 0xde, 0x24, 0xc7, 0xfc, + 0x13, 0x4e, 0x4c, 0x93, 0x8b, 0x24, 0xfd, 0x09, 0x2b, 0x61, 0xed, 0x8b, 0x1f, 0x7c, 0xb2, 0x38, + 0xf5, 0xe1, 0x27, 0x8b, 0x53, 0x1f, 0x7d, 0xb2, 0x38, 0xf5, 0xd6, 0xd1, 0xa2, 0xf5, 0xc1, 0xd1, + 0xa2, 0xf5, 0xe1, 0xd1, 0xa2, 0xf5, 0xd1, 0xd1, 0xa2, 0xf5, 0xf1, 0xd1, 0xa2, 0xf5, 0xce, 0xdf, + 0x16, 0xa7, 0xee, 0x15, 0x0e, 0x2e, 0xff, 0x27, 0x00, 0x00, 0xff, 0xff, 0xe5, 0xe0, 0x33, 0x2e, + 0x95, 0x26, 0x00, 0x00, } diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.proto b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.proto index 989f076a10..cc9099a657 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.proto +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/generated.proto @@ -92,6 +92,16 @@ message APIResource { // categories is a list of the grouped resources this resource belongs to (e.g. 'all') repeated string categories = 7; + + // The hash value of the storage version, the version this resource is + // converted to when written to the data store. Value must be treated + // as opaque by clients. Only equality comparison on the value is valid. + // This is an alpha feature and may change or be removed in the future. + // The field is populated by the apiserver only if the + // StorageVersionHash feature gate is enabled. + // This field will remain optional even if it graduates. + // +optional + optional string storageVersionHash = 10; } // APIResourceList is a list of APIResource, it is used to expose the name of the @@ -134,9 +144,12 @@ message CreateOptions { // +optional repeated string dryRun = 1; - // If IncludeUninitialized is specified, the object may be - // returned without completing initialization. - optional bool includeUninitialized = 2; + // fieldManager is a name associated with the actor or entity + // that is making these changes. The value must be less than or + // 128 characters long, and only contain printable characters, + // as defined by https://golang.org/pkg/unicode/#IsPrint. + // +optional + optional string fieldManager = 3; } // DeleteOptions may be provided when deleting an API object. @@ -188,14 +201,34 @@ message Duration { } // ExportOptions is the query options to the standard REST get call. +// Deprecated. Planned for removal in 1.18. message ExportOptions { // Should this value be exported. Export strips fields that a user can not specify. + // Deprecated. Planned for removal in 1.18. optional bool export = 1; // Should the export be exact. Exact export maintains cluster-specific fields like 'Namespace'. + // Deprecated. Planned for removal in 1.18. optional bool exact = 2; } +// Fields stores a set of fields in a data structure like a Trie. +// To understand how this is used, see: https://github.com/kubernetes-sigs/structured-merge-diff +message Fields { + // Map stores a set of fields in a data structure like a Trie. + // + // Each key is either a '.' representing the field itself, and will always map to an empty set, + // or a string representing a sub-field or item. The string will follow one of these four formats: + // 'f:', where is the name of a field in a struct, or key in a map + // 'v:', where is the exact json formatted value of a list item + // 'i:', where is position of a item in a list + // 'k:', where is a map of a list item's key fields to their unique values + // If a key maps to an empty Fields value, the field that key represents is part of the set. + // + // The exact format is defined in k8s.io/apiserver/pkg/endpoints/handlers/fieldmanager/internal + map map = 1; +} + // GetOptions is the standard query options to the standard REST get call. message GetOptions { // When specified: @@ -203,10 +236,6 @@ message GetOptions { // - if it's 0, then we simply return what we currently have in cache, no guarantee; // - if set to non zero, then the result is at least as fresh as given rv. optional string resourceVersion = 1; - - // If true, partially initialized resources are included in the response. - // +optional - optional bool includeUninitialized = 2; } // GroupKind specifies a Group and a Kind, but does not force a version. This is useful for identifying @@ -366,6 +395,21 @@ message ListMeta { // identical to the value in the first response, unless you have received this token from an error // message. optional string continue = 3; + + // remainingItemCount is the number of subsequent items in the list which are not included in this + // list response. If the list request contained label or field selectors, then the number of + // remaining items is unknown and the field will be left unset and omitted during serialization. + // If the list is complete (either because it is not chunking or because this is the last chunk), + // then there are no more remaining items and this field will be left unset and omitted during + // serialization. + // Servers older than v1.15 do not set this field. + // The intended use of the remainingItemCount is *estimating* the size of a collection. Clients + // should not rely on the remainingItemCount to be set or to be exact. + // + // This field is alpha and can be changed or removed without notice. + // + // +optional + optional int64 remainingItemCount = 4; } // ListOptions is the query options to a standard REST list call. @@ -380,15 +424,25 @@ message ListOptions { // +optional optional string fieldSelector = 2; - // If true, partially initialized resources are included in the response. - // +optional - optional bool includeUninitialized = 6; - // Watch for changes to the described resources and return them as a stream of // add, update, and remove notifications. Specify resourceVersion. // +optional optional bool watch = 3; + // allowWatchBookmarks requests watch events with type "BOOKMARK". + // Servers that do not implement bookmarks may ignore this flag and + // bookmarks are sent at the server's discretion. Clients should not + // assume bookmarks are returned at any specific interval, nor may they + // assume the server will send any BOOKMARK event during a session. + // If this is not a watch, this field is ignored. + // If the feature gate WatchBookmarks is not enabled in apiserver, + // this field is ignored. + // + // This field is alpha and can be changed or removed without notice. + // + // +optional + optional bool allowWatchBookmarks = 9; + // When specified with a watch call, shows changes that occur after that particular version of a resource. // Defaults to changes from the beginning of history. // When specified for list: @@ -438,6 +492,31 @@ message ListOptions { optional string continue = 8; } +// ManagedFieldsEntry is a workflow-id, a FieldSet and the group version of the resource +// that the fieldset applies to. +message ManagedFieldsEntry { + // Manager is an identifier of the workflow managing these fields. + optional string manager = 1; + + // Operation is the type of operation which lead to this ManagedFieldsEntry being created. + // The only valid values for this field are 'Apply' and 'Update'. + optional string operation = 2; + + // APIVersion defines the version of this resource that this field set + // applies to. The format is "group/version" just like the top-level + // APIVersion field. It is necessary to track the version of a field + // set because it cannot be automatically converted. + optional string apiVersion = 3; + + // Time is timestamp of when these fields were set. It should always be empty if Operation is 'Apply' + // +optional + optional Time time = 4; + + // Fields identifies a set of fields. + // +optional + optional Fields fields = 5; +} + // MicroTime is version of Time with microsecond level precision. // // +protobuf.options.marshal=false @@ -602,6 +681,8 @@ message ObjectMeta { // When an object is created, the system will populate this list with the current set of initializers. // Only privileged users may set or modify this list. Once it is empty, it may not be modified further // by any user. + // + // DEPRECATED - initializers are an alpha field and will be removed in v1.15. optional Initializers initializers = 16; // Must be empty before the object is deleted from the registry. Each entry @@ -617,6 +698,19 @@ message ObjectMeta { // This field is not set anywhere right now and apiserver is going to ignore it if set in create or update request. // +optional optional string clusterName = 15; + + // ManagedFields maps workflow-id and version to the set of fields + // that are managed by that workflow. This is mostly for internal + // housekeeping, and users typically shouldn't need to set or + // understand this field. A workflow can be the user's name, a + // controller's name, or the name of a specific apply path like + // "ci-cd". The set of fields is always in the version that the + // workflow used when modifying the object. + // + // This field is alpha and can be changed or removed without notice. + // + // +optional + repeated ManagedFieldsEntry managedFields = 17; } // OwnerReference contains enough information to let you identify an owning @@ -652,15 +746,69 @@ message OwnerReference { optional bool blockOwnerDeletion = 7; } +// PartialObjectMetadata is a generic representation of any object with ObjectMeta. It allows clients +// to get access to a particular ObjectMeta schema without knowing the details of the version. +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +message PartialObjectMetadata { + // Standard object's metadata. + // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata + // +optional + optional ObjectMeta metadata = 1; +} + +// PartialObjectMetadataList contains a list of objects containing only their metadata +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +message PartialObjectMetadataList { + // Standard list metadata. + // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds + // +optional + optional ListMeta metadata = 1; + + // items contains each of the included items. + repeated PartialObjectMetadata items = 2; +} + // Patch is provided to give a concrete name and type to the Kubernetes PATCH request body. message Patch { } +// PatchOptions may be provided when patching an API object. +// PatchOptions is meant to be a superset of UpdateOptions. +message PatchOptions { + // When present, indicates that modifications should not be + // persisted. An invalid or unrecognized dryRun directive will + // result in an error response and no further processing of the + // request. Valid values are: + // - All: all dry run stages will be processed + // +optional + repeated string dryRun = 1; + + // Force is going to "force" Apply requests. It means user will + // re-acquire conflicting fields owned by other people. Force + // flag must be unset for non-apply patch requests. + // +optional + optional bool force = 2; + + // fieldManager is a name associated with the actor or entity + // that is making these changes. The value must be less than or + // 128 characters long, and only contain printable characters, + // as defined by https://golang.org/pkg/unicode/#IsPrint. This + // field is required for apply requests + // (application/apply-patch) but optional for non-apply patch + // types (JsonPatch, MergePatch, StrategicMergePatch). + // +optional + optional string fieldManager = 3; +} + // Preconditions must be fulfilled before an operation (update, delete, etc.) is carried out. message Preconditions { // Specifies the target UID. // +optional optional string uid = 1; + + // Specifies the target ResourceVersion + // +optional + optional string resourceVersion = 2; } // RootPaths lists the paths available at root. @@ -782,6 +930,16 @@ message StatusDetails { optional int32 retryAfterSeconds = 5; } +// TableOptions are used when a Table is requested by the caller. +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +message TableOptions { + // includeObject decides whether to include each object along with its columnar information. + // Specifying "None" will return no object, specifying "Object" will return the full object contents, and + // specifying "Metadata" (the default) will return the object's metadata in the PartialObjectMetadata kind + // in version v1beta1 of the meta.k8s.io API group. + optional string includeObject = 1; +} + // Time is a wrapper around time.Time which supports correct // marshaling to YAML and JSON. Wrappers are provided for many // of the factory methods that the time package offers. @@ -841,6 +999,7 @@ message TypeMeta { } // UpdateOptions may be provided when updating an API object. +// All fields in UpdateOptions should also be present in PatchOptions. message UpdateOptions { // When present, indicates that modifications should not be // persisted. An invalid or unrecognized dryRun directive will @@ -849,6 +1008,13 @@ message UpdateOptions { // - All: all dry run stages will be processed // +optional repeated string dryRun = 1; + + // fieldManager is a name associated with the actor or entity + // that is making these changes. The value must be less than or + // 128 characters long, and only contain printable characters, + // as defined by https://golang.org/pkg/unicode/#IsPrint. + // +optional + optional string fieldManager = 2; } // Verbs masks the value so protobuf can generate diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/helpers.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/helpers.go index d845d7b0ff..b4dc78b3ea 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/helpers.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/helpers.go @@ -17,6 +17,7 @@ limitations under the License. package v1 import ( + "encoding/json" "fmt" "k8s.io/apimachinery/pkg/fields" @@ -227,8 +228,40 @@ func NewUIDPreconditions(uid string) *Preconditions { return &Preconditions{UID: &u} } +// NewRVDeletionPrecondition returns a DeleteOptions with a ResourceVersion precondition set. +func NewRVDeletionPrecondition(rv string) *DeleteOptions { + p := Preconditions{ResourceVersion: &rv} + return &DeleteOptions{Preconditions: &p} +} + // HasObjectMetaSystemFieldValues returns true if fields that are managed by the system on ObjectMeta have values. func HasObjectMetaSystemFieldValues(meta Object) bool { return !meta.GetCreationTimestamp().Time.IsZero() || len(meta.GetUID()) != 0 } + +// ResetObjectMetaForStatus forces the meta fields for a status update to match the meta fields +// for a pre-existing object. This is opt-in for new objects with Status subresource. +func ResetObjectMetaForStatus(meta, existingMeta Object) { + meta.SetDeletionTimestamp(existingMeta.GetDeletionTimestamp()) + meta.SetGeneration(existingMeta.GetGeneration()) + meta.SetSelfLink(existingMeta.GetSelfLink()) + meta.SetLabels(existingMeta.GetLabels()) + meta.SetAnnotations(existingMeta.GetAnnotations()) + meta.SetFinalizers(existingMeta.GetFinalizers()) + meta.SetOwnerReferences(existingMeta.GetOwnerReferences()) + meta.SetManagedFields(existingMeta.GetManagedFields()) +} + +// MarshalJSON implements json.Marshaler +func (f Fields) MarshalJSON() ([]byte, error) { + return json.Marshal(&f.Map) +} + +// UnmarshalJSON implements json.Unmarshaler +func (f *Fields) UnmarshalJSON(b []byte) error { + return json.Unmarshal(b, &f.Map) +} + +var _ json.Marshaler = Fields{} +var _ json.Unmarshaler = &Fields{} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/meta.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/meta.go index ee1447541f..37141bd5da 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/meta.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/meta.go @@ -63,6 +63,8 @@ type Object interface { SetOwnerReferences([]OwnerReference) GetClusterName() string SetClusterName(clusterName string) + GetManagedFields() []ManagedFieldsEntry + SetManagedFields(managedFields []ManagedFieldsEntry) } // ListMetaAccessor retrieves the list interface from an object @@ -92,6 +94,8 @@ type ListInterface interface { SetSelfLink(selfLink string) GetContinue() string SetContinue(c string) + GetRemainingItemCount() *int64 + SetRemainingItemCount(c *int64) } // Type exposes the type and APIVersion of versioned or internal API objects. @@ -103,12 +107,16 @@ type Type interface { SetKind(kind string) } +var _ ListInterface = &ListMeta{} + func (meta *ListMeta) GetResourceVersion() string { return meta.ResourceVersion } func (meta *ListMeta) SetResourceVersion(version string) { meta.ResourceVersion = version } func (meta *ListMeta) GetSelfLink() string { return meta.SelfLink } func (meta *ListMeta) SetSelfLink(selfLink string) { meta.SelfLink = selfLink } func (meta *ListMeta) GetContinue() string { return meta.Continue } func (meta *ListMeta) SetContinue(c string) { meta.Continue = c } +func (meta *ListMeta) GetRemainingItemCount() *int64 { return meta.RemainingItemCount } +func (meta *ListMeta) SetRemainingItemCount(c *int64) { meta.RemainingItemCount = c } func (obj *TypeMeta) GetObjectKind() schema.ObjectKind { return obj } @@ -166,5 +174,9 @@ func (meta *ObjectMeta) GetOwnerReferences() []OwnerReference { return m func (meta *ObjectMeta) SetOwnerReferences(references []OwnerReference) { meta.OwnerReferences = references } -func (meta *ObjectMeta) GetClusterName() string { return meta.ClusterName } -func (meta *ObjectMeta) SetClusterName(clusterName string) { meta.ClusterName = clusterName } +func (meta *ObjectMeta) GetClusterName() string { return meta.ClusterName } +func (meta *ObjectMeta) SetClusterName(clusterName string) { meta.ClusterName = clusterName } +func (meta *ObjectMeta) GetManagedFields() []ManagedFieldsEntry { return meta.ManagedFields } +func (meta *ObjectMeta) SetManagedFields(managedFields []ManagedFieldsEntry) { + meta.ManagedFields = managedFields +} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go index 6f6c5111bc..cdd9a6a7a0 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go @@ -41,11 +41,6 @@ func (t *MicroTime) DeepCopyInto(out *MicroTime) { *out = *t } -// String returns the representation of the time. -func (t MicroTime) String() string { - return t.Time.String() -} - // NewMicroTime returns a wrapped instance of the provided time func NewMicroTime(time time.Time) MicroTime { return MicroTime{time} @@ -72,22 +67,40 @@ func (t *MicroTime) IsZero() bool { // Before reports whether the time instant t is before u. func (t *MicroTime) Before(u *MicroTime) bool { - return t.Time.Before(u.Time) + if t != nil && u != nil { + return t.Time.Before(u.Time) + } + return false } // Equal reports whether the time instant t is equal to u. func (t *MicroTime) Equal(u *MicroTime) bool { - return t.Time.Equal(u.Time) + if t == nil && u == nil { + return true + } + if t != nil && u != nil { + return t.Time.Equal(u.Time) + } + return false } // BeforeTime reports whether the time instant t is before second-lever precision u. func (t *MicroTime) BeforeTime(u *Time) bool { - return t.Time.Before(u.Time) + if t != nil && u != nil { + return t.Time.Before(u.Time) + } + return false } // EqualTime reports whether the time instant t is equal to second-lever precision u. func (t *MicroTime) EqualTime(u *Time) bool { - return t.Time.Equal(u.Time) + if t == nil && u == nil { + return true + } + if t != nil && u != nil { + return t.Time.Equal(u.Time) + } + return false } // UnixMicro returns the local time corresponding to the given Unix time diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/register.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/register.go index 0827729d08..368efe1efd 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/register.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/register.go @@ -55,6 +55,7 @@ func AddToGroupVersion(scheme *runtime.Scheme, groupVersion schema.GroupVersion) &DeleteOptions{}, &CreateOptions{}, &UpdateOptions{}, + &PatchOptions{}, ) utilruntime.Must(scheme.AddConversionFuncs( Convert_v1_WatchEvent_To_watch_Event, @@ -90,8 +91,26 @@ func init() { &DeleteOptions{}, &CreateOptions{}, &UpdateOptions{}, + &PatchOptions{}, ) + if err := AddMetaToScheme(scheme); err != nil { + panic(err) + } + // register manually. This usually goes through the SchemeBuilder, which we cannot use here. utilruntime.Must(RegisterDefaults(scheme)) } + +func AddMetaToScheme(scheme *runtime.Scheme) error { + scheme.AddKnownTypes(SchemeGroupVersion, + &Table{}, + &TableOptions{}, + &PartialObjectMetadata{}, + &PartialObjectMetadataList{}, + ) + + return scheme.AddConversionFuncs( + Convert_Slice_string_To_v1_IncludeObjectPolicy, + ) +} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go index efff656e10..fe510ed9e6 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go @@ -20,7 +20,7 @@ import ( "encoding/json" "time" - "github.com/google/gofuzz" + fuzz "github.com/google/gofuzz" ) // Time is a wrapper around time.Time which supports correct @@ -41,11 +41,6 @@ func (t *Time) DeepCopyInto(out *Time) { *out = *t } -// String returns the representation of the time. -func (t Time) String() string { - return t.Time.String() -} - // NewTime returns a wrapped instance of the provided time func NewTime(time time.Time) Time { return Time{time} @@ -72,7 +67,10 @@ func (t *Time) IsZero() bool { // Before reports whether the time instant t is before u. func (t *Time) Before(u *Time) bool { - return t.Time.Before(u.Time) + if t != nil && u != nil { + return t.Time.Before(u.Time) + } + return false } // Equal reports whether the time instant t is equal to u. @@ -147,8 +145,12 @@ func (t Time) MarshalJSON() ([]byte, error) { // Encode unset/nil objects as JSON's "null". return []byte("null"), nil } - - return json.Marshal(t.UTC().Format(time.RFC3339)) + buf := make([]byte, 0, len(time.RFC3339)+2) + buf = append(buf, '"') + // time cannot contain non escapable JSON characters + buf = t.UTC().AppendFormat(buf, time.RFC3339) + buf = append(buf, '"') + return buf, nil } // OpenAPISchemaType is used by the kube-openapi generator when constructing diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types.go index 65f87546d2..46ef65f457 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types.go @@ -81,6 +81,21 @@ type ListMeta struct { // identical to the value in the first response, unless you have received this token from an error // message. Continue string `json:"continue,omitempty" protobuf:"bytes,3,opt,name=continue"` + + // remainingItemCount is the number of subsequent items in the list which are not included in this + // list response. If the list request contained label or field selectors, then the number of + // remaining items is unknown and the field will be left unset and omitted during serialization. + // If the list is complete (either because it is not chunking or because this is the last chunk), + // then there are no more remaining items and this field will be left unset and omitted during + // serialization. + // Servers older than v1.15 do not set this field. + // The intended use of the remainingItemCount is *estimating* the size of a collection. Clients + // should not rely on the remainingItemCount to be set or to be exact. + // + // This field is alpha and can be changed or removed without notice. + // + // +optional + RemainingItemCount *int64 `json:"remainingItemCount,omitempty" protobuf:"bytes,4,opt,name=remainingItemCount"` } // These are internal finalizer values for Kubernetes-like APIs, must be qualified name unless defined here @@ -235,6 +250,8 @@ type ObjectMeta struct { // When an object is created, the system will populate this list with the current set of initializers. // Only privileged users may set or modify this list. Once it is empty, it may not be modified further // by any user. + // + // DEPRECATED - initializers are an alpha field and will be removed in v1.15. Initializers *Initializers `json:"initializers,omitempty" protobuf:"bytes,16,opt,name=initializers"` // Must be empty before the object is deleted from the registry. Each entry @@ -250,6 +267,19 @@ type ObjectMeta struct { // This field is not set anywhere right now and apiserver is going to ignore it if set in create or update request. // +optional ClusterName string `json:"clusterName,omitempty" protobuf:"bytes,15,opt,name=clusterName"` + + // ManagedFields maps workflow-id and version to the set of fields + // that are managed by that workflow. This is mostly for internal + // housekeeping, and users typically shouldn't need to set or + // understand this field. A workflow can be the user's name, a + // controller's name, or the name of a specific apply path like + // "ci-cd". The set of fields is always in the version that the + // workflow used when modifying the object. + // + // This field is alpha and can be changed or removed without notice. + // + // +optional + ManagedFields []ManagedFieldsEntry `json:"managedFields,omitempty" protobuf:"bytes,17,rep,name=managedFields"` } // Initializers tracks the progress of initialization. @@ -327,13 +357,27 @@ type ListOptions struct { // Defaults to everything. // +optional FieldSelector string `json:"fieldSelector,omitempty" protobuf:"bytes,2,opt,name=fieldSelector"` - // If true, partially initialized resources are included in the response. - // +optional - IncludeUninitialized bool `json:"includeUninitialized,omitempty" protobuf:"varint,6,opt,name=includeUninitialized"` + + // +k8s:deprecated=includeUninitialized,protobuf=6 + // Watch for changes to the described resources and return them as a stream of // add, update, and remove notifications. Specify resourceVersion. // +optional Watch bool `json:"watch,omitempty" protobuf:"varint,3,opt,name=watch"` + // allowWatchBookmarks requests watch events with type "BOOKMARK". + // Servers that do not implement bookmarks may ignore this flag and + // bookmarks are sent at the server's discretion. Clients should not + // assume bookmarks are returned at any specific interval, nor may they + // assume the server will send any BOOKMARK event during a session. + // If this is not a watch, this field is ignored. + // If the feature gate WatchBookmarks is not enabled in apiserver, + // this field is ignored. + // + // This field is alpha and can be changed or removed without notice. + // + // +optional + AllowWatchBookmarks bool `json:"allowWatchBookmarks,omitempty" protobuf:"varint,9,opt,name=allowWatchBookmarks"` + // When specified with a watch call, shows changes that occur after that particular version of a resource. // Defaults to changes from the beginning of history. // When specified for list: @@ -384,11 +428,14 @@ type ListOptions struct { // +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object // ExportOptions is the query options to the standard REST get call. +// Deprecated. Planned for removal in 1.18. type ExportOptions struct { TypeMeta `json:",inline"` // Should this value be exported. Export strips fields that a user can not specify. + // Deprecated. Planned for removal in 1.18. Export bool `json:"export" protobuf:"varint,1,opt,name=export"` // Should the export be exact. Exact export maintains cluster-specific fields like 'Namespace'. + // Deprecated. Planned for removal in 1.18. Exact bool `json:"exact" protobuf:"varint,2,opt,name=exact"` } @@ -402,9 +449,7 @@ type GetOptions struct { // - if it's 0, then we simply return what we currently have in cache, no guarantee; // - if set to non zero, then the result is at least as fresh as given rv. ResourceVersion string `json:"resourceVersion,omitempty" protobuf:"bytes,1,opt,name=resourceVersion"` - // If true, partially initialized resources are included in the response. - // +optional - IncludeUninitialized bool `json:"includeUninitialized,omitempty" protobuf:"varint,2,opt,name=includeUninitialized"` + // +k8s:deprecated=includeUninitialized,protobuf=2 } // DeletionPropagation decides if a deletion will propagate to the dependents of @@ -489,15 +534,52 @@ type CreateOptions struct { // - All: all dry run stages will be processed // +optional DryRun []string `json:"dryRun,omitempty" protobuf:"bytes,1,rep,name=dryRun"` + // +k8s:deprecated=includeUninitialized,protobuf=2 - // If IncludeUninitialized is specified, the object may be - // returned without completing initialization. - IncludeUninitialized bool `json:"includeUninitialized,omitempty" protobuf:"varint,2,opt,name=includeUninitialized"` + // fieldManager is a name associated with the actor or entity + // that is making these changes. The value must be less than or + // 128 characters long, and only contain printable characters, + // as defined by https://golang.org/pkg/unicode/#IsPrint. + // +optional + FieldManager string `json:"fieldManager,omitempty" protobuf:"bytes,3,name=fieldManager"` +} + +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object + +// PatchOptions may be provided when patching an API object. +// PatchOptions is meant to be a superset of UpdateOptions. +type PatchOptions struct { + TypeMeta `json:",inline"` + + // When present, indicates that modifications should not be + // persisted. An invalid or unrecognized dryRun directive will + // result in an error response and no further processing of the + // request. Valid values are: + // - All: all dry run stages will be processed + // +optional + DryRun []string `json:"dryRun,omitempty" protobuf:"bytes,1,rep,name=dryRun"` + + // Force is going to "force" Apply requests. It means user will + // re-acquire conflicting fields owned by other people. Force + // flag must be unset for non-apply patch requests. + // +optional + Force *bool `json:"force,omitempty" protobuf:"varint,2,opt,name=force"` + + // fieldManager is a name associated with the actor or entity + // that is making these changes. The value must be less than or + // 128 characters long, and only contain printable characters, + // as defined by https://golang.org/pkg/unicode/#IsPrint. This + // field is required for apply requests + // (application/apply-patch) but optional for non-apply patch + // types (JsonPatch, MergePatch, StrategicMergePatch). + // +optional + FieldManager string `json:"fieldManager,omitempty" protobuf:"bytes,3,name=fieldManager"` } // +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object // UpdateOptions may be provided when updating an API object. +// All fields in UpdateOptions should also be present in PatchOptions. type UpdateOptions struct { TypeMeta `json:",inline"` @@ -508,6 +590,13 @@ type UpdateOptions struct { // - All: all dry run stages will be processed // +optional DryRun []string `json:"dryRun,omitempty" protobuf:"bytes,1,rep,name=dryRun"` + + // fieldManager is a name associated with the actor or entity + // that is making these changes. The value must be less than or + // 128 characters long, and only contain printable characters, + // as defined by https://golang.org/pkg/unicode/#IsPrint. + // +optional + FieldManager string `json:"fieldManager,omitempty" protobuf:"bytes,2,name=fieldManager"` } // Preconditions must be fulfilled before an operation (update, delete, etc.) is carried out. @@ -515,6 +604,9 @@ type Preconditions struct { // Specifies the target UID. // +optional UID *types.UID `json:"uid,omitempty" protobuf:"bytes,1,opt,name=uid,casttype=k8s.io/apimachinery/pkg/types.UID"` + // Specifies the target ResourceVersion + // +optional + ResourceVersion *string `json:"resourceVersion,omitempty" protobuf:"bytes,2,opt,name=resourceVersion"` } // +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object @@ -792,6 +884,9 @@ const ( // without the expected return type. The presence of this cause indicates the error may be // due to an intervening proxy or the server software malfunctioning. CauseTypeUnexpectedServerResponse CauseType = "UnexpectedServerResponse" + // FieldManagerConflict is used to report when another client claims to manage this field, + // It should only be returned for a request using server-side apply. + CauseTypeFieldManagerConflict CauseType = "FieldManagerConflict" ) // +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object @@ -906,6 +1001,15 @@ type APIResource struct { ShortNames []string `json:"shortNames,omitempty" protobuf:"bytes,5,rep,name=shortNames"` // categories is a list of the grouped resources this resource belongs to (e.g. 'all') Categories []string `json:"categories,omitempty" protobuf:"bytes,7,rep,name=categories"` + // The hash value of the storage version, the version this resource is + // converted to when written to the data store. Value must be treated + // as opaque by clients. Only equality comparison on the value is valid. + // This is an alpha feature and may change or be removed in the future. + // The field is populated by the apiserver only if the + // StorageVersionHash feature gate is enabled. + // This field will remain optional even if it graduates. + // +optional + StorageVersionHash string `json:"storageVersionHash,omitempty" protobuf:"bytes,10,opt,name=storageVersionHash"` } // Verbs masks the value so protobuf can generate @@ -1007,3 +1111,210 @@ const ( LabelSelectorOpExists LabelSelectorOperator = "Exists" LabelSelectorOpDoesNotExist LabelSelectorOperator = "DoesNotExist" ) + +// ManagedFieldsEntry is a workflow-id, a FieldSet and the group version of the resource +// that the fieldset applies to. +type ManagedFieldsEntry struct { + // Manager is an identifier of the workflow managing these fields. + Manager string `json:"manager,omitempty" protobuf:"bytes,1,opt,name=manager"` + // Operation is the type of operation which lead to this ManagedFieldsEntry being created. + // The only valid values for this field are 'Apply' and 'Update'. + Operation ManagedFieldsOperationType `json:"operation,omitempty" protobuf:"bytes,2,opt,name=operation,casttype=ManagedFieldsOperationType"` + // APIVersion defines the version of this resource that this field set + // applies to. The format is "group/version" just like the top-level + // APIVersion field. It is necessary to track the version of a field + // set because it cannot be automatically converted. + APIVersion string `json:"apiVersion,omitempty" protobuf:"bytes,3,opt,name=apiVersion"` + // Time is timestamp of when these fields were set. It should always be empty if Operation is 'Apply' + // +optional + Time *Time `json:"time,omitempty" protobuf:"bytes,4,opt,name=time"` + // Fields identifies a set of fields. + // +optional + Fields *Fields `json:"fields,omitempty" protobuf:"bytes,5,opt,name=fields,casttype=Fields"` +} + +// ManagedFieldsOperationType is the type of operation which lead to a ManagedFieldsEntry being created. +type ManagedFieldsOperationType string + +const ( + ManagedFieldsOperationApply ManagedFieldsOperationType = "Apply" + ManagedFieldsOperationUpdate ManagedFieldsOperationType = "Update" +) + +// Fields stores a set of fields in a data structure like a Trie. +// To understand how this is used, see: https://github.com/kubernetes-sigs/structured-merge-diff +type Fields struct { + // Map stores a set of fields in a data structure like a Trie. + // + // Each key is either a '.' representing the field itself, and will always map to an empty set, + // or a string representing a sub-field or item. The string will follow one of these four formats: + // 'f:', where is the name of a field in a struct, or key in a map + // 'v:', where is the exact json formatted value of a list item + // 'i:', where is position of a item in a list + // 'k:', where is a map of a list item's key fields to their unique values + // If a key maps to an empty Fields value, the field that key represents is part of the set. + // + // The exact format is defined in k8s.io/apiserver/pkg/endpoints/handlers/fieldmanager/internal + Map map[string]Fields `json:",inline" protobuf:"bytes,1,rep,name=map"` +} + +// TODO: Table does not generate to protobuf because of the interface{} - fix protobuf +// generation to support a meta type that can accept any valid JSON. This can be introduced +// in a v1 because clients a) receive an error if they try to access proto today, and b) +// once introduced they would be able to gracefully switch over to using it. + +// Table is a tabular representation of a set of API resources. The server transforms the +// object into a set of preferred columns for quickly reviewing the objects. +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +// +protobuf=false +type Table struct { + TypeMeta `json:",inline"` + // Standard list metadata. + // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds + // +optional + ListMeta `json:"metadata,omitempty"` + + // columnDefinitions describes each column in the returned items array. The number of cells per row + // will always match the number of column definitions. + ColumnDefinitions []TableColumnDefinition `json:"columnDefinitions"` + // rows is the list of items in the table. + Rows []TableRow `json:"rows"` +} + +// TableColumnDefinition contains information about a column returned in the Table. +// +protobuf=false +type TableColumnDefinition struct { + // name is a human readable name for the column. + Name string `json:"name"` + // type is an OpenAPI type definition for this column, such as number, integer, string, or + // array. + // See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more. + Type string `json:"type"` + // format is an optional OpenAPI type modifier for this column. A format modifies the type and + // imposes additional rules, like date or time formatting for a string. The 'name' format is applied + // to the primary identifier column which has type 'string' to assist in clients identifying column + // is the resource name. + // See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more. + Format string `json:"format"` + // description is a human readable description of this column. + Description string `json:"description"` + // priority is an integer defining the relative importance of this column compared to others. Lower + // numbers are considered higher priority. Columns that may be omitted in limited space scenarios + // should be given a higher priority. + Priority int32 `json:"priority"` +} + +// TableRow is an individual row in a table. +// +protobuf=false +type TableRow struct { + // cells will be as wide as the column definitions array and may contain strings, numbers (float64 or + // int64), booleans, simple maps, lists, or null. See the type field of the column definition for a + // more detailed description. + Cells []interface{} `json:"cells"` + // conditions describe additional status of a row that are relevant for a human user. These conditions + // apply to the row, not to the object, and will be specific to table output. The only defined + // condition type is 'Completed', for a row that indicates a resource that has run to completion and + // can be given less visual priority. + // +optional + Conditions []TableRowCondition `json:"conditions,omitempty"` + // This field contains the requested additional information about each object based on the includeObject + // policy when requesting the Table. If "None", this field is empty, if "Object" this will be the + // default serialization of the object for the current API version, and if "Metadata" (the default) will + // contain the object metadata. Check the returned kind and apiVersion of the object before parsing. + // The media type of the object will always match the enclosing list - if this as a JSON table, these + // will be JSON encoded objects. + // +optional + Object runtime.RawExtension `json:"object,omitempty"` +} + +// TableRowCondition allows a row to be marked with additional information. +// +protobuf=false +type TableRowCondition struct { + // Type of row condition. The only defined value is 'Completed' indicating that the + // object this row represents has reached a completed state and may be given less visual + // priority than other rows. Clients are not required to honor any conditions but should + // be consistent where possible about handling the conditions. + Type RowConditionType `json:"type"` + // Status of the condition, one of True, False, Unknown. + Status ConditionStatus `json:"status"` + // (brief) machine readable reason for the condition's last transition. + // +optional + Reason string `json:"reason,omitempty"` + // Human readable message indicating details about last transition. + // +optional + Message string `json:"message,omitempty"` +} + +type RowConditionType string + +// These are valid conditions of a row. This list is not exhaustive and new conditions may be +// included by other resources. +const ( + // RowCompleted means the underlying resource has reached completion and may be given less + // visual priority than other resources. + RowCompleted RowConditionType = "Completed" +) + +type ConditionStatus string + +// These are valid condition statuses. "ConditionTrue" means a resource is in the condition. +// "ConditionFalse" means a resource is not in the condition. "ConditionUnknown" means kubernetes +// can't decide if a resource is in the condition or not. In the future, we could add other +// intermediate conditions, e.g. ConditionDegraded. +const ( + ConditionTrue ConditionStatus = "True" + ConditionFalse ConditionStatus = "False" + ConditionUnknown ConditionStatus = "Unknown" +) + +// IncludeObjectPolicy controls which portion of the object is returned with a Table. +type IncludeObjectPolicy string + +const ( + // IncludeNone returns no object. + IncludeNone IncludeObjectPolicy = "None" + // IncludeMetadata serializes the object containing only its metadata field. + IncludeMetadata IncludeObjectPolicy = "Metadata" + // IncludeObject contains the full object. + IncludeObject IncludeObjectPolicy = "Object" +) + +// TableOptions are used when a Table is requested by the caller. +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +type TableOptions struct { + TypeMeta `json:",inline"` + + // NoHeaders is only exposed for internal callers. It is not included in our OpenAPI definitions + // and may be removed as a field in a future release. + NoHeaders bool `json:"-"` + + // includeObject decides whether to include each object along with its columnar information. + // Specifying "None" will return no object, specifying "Object" will return the full object contents, and + // specifying "Metadata" (the default) will return the object's metadata in the PartialObjectMetadata kind + // in version v1beta1 of the meta.k8s.io API group. + IncludeObject IncludeObjectPolicy `json:"includeObject,omitempty" protobuf:"bytes,1,opt,name=includeObject,casttype=IncludeObjectPolicy"` +} + +// PartialObjectMetadata is a generic representation of any object with ObjectMeta. It allows clients +// to get access to a particular ObjectMeta schema without knowing the details of the version. +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +type PartialObjectMetadata struct { + TypeMeta `json:",inline"` + // Standard object's metadata. + // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata + // +optional + ObjectMeta `json:"metadata,omitempty" protobuf:"bytes,1,opt,name=metadata"` +} + +// PartialObjectMetadataList contains a list of objects containing only their metadata +// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object +type PartialObjectMetadataList struct { + TypeMeta `json:",inline"` + // Standard list metadata. + // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds + // +optional + ListMeta `json:"metadata,omitempty" protobuf:"bytes,1,opt,name=metadata"` + + // items contains each of the included items. + Items []PartialObjectMetadata `json:"items" protobuf:"bytes,2,rep,name=items"` +} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types_swagger_doc_generated.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types_swagger_doc_generated.go index 679e709e8e..f35c22bf16 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types_swagger_doc_generated.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/types_swagger_doc_generated.go @@ -49,16 +49,17 @@ func (APIGroupList) SwaggerDoc() map[string]string { } var map_APIResource = map[string]string{ - "": "APIResource specifies the name of a resource and whether it is namespaced.", - "name": "name is the plural name of the resource.", - "singularName": "singularName is the singular name of the resource. This allows clients to handle plural and singular opaquely. The singularName is more correct for reporting status on a single item and both singular and plural are allowed from the kubectl CLI interface.", - "namespaced": "namespaced indicates if a resource is namespaced or not.", - "group": "group is the preferred group of the resource. Empty implies the group of the containing resource list. For subresources, this may have a different value, for example: Scale\".", - "version": "version is the preferred version of the resource. Empty implies the version of the containing resource list For subresources, this may have a different value, for example: v1 (while inside a v1beta1 version of the core resource's group)\".", - "kind": "kind is the kind for the resource (e.g. 'Foo' is the kind for a resource 'foo')", - "verbs": "verbs is a list of supported kube verbs (this includes get, list, watch, create, update, patch, delete, deletecollection, and proxy)", - "shortNames": "shortNames is a list of suggested short names of the resource.", - "categories": "categories is a list of the grouped resources this resource belongs to (e.g. 'all')", + "": "APIResource specifies the name of a resource and whether it is namespaced.", + "name": "name is the plural name of the resource.", + "singularName": "singularName is the singular name of the resource. This allows clients to handle plural and singular opaquely. The singularName is more correct for reporting status on a single item and both singular and plural are allowed from the kubectl CLI interface.", + "namespaced": "namespaced indicates if a resource is namespaced or not.", + "group": "group is the preferred group of the resource. Empty implies the group of the containing resource list. For subresources, this may have a different value, for example: Scale\".", + "version": "version is the preferred version of the resource. Empty implies the version of the containing resource list For subresources, this may have a different value, for example: v1 (while inside a v1beta1 version of the core resource's group)\".", + "kind": "kind is the kind for the resource (e.g. 'Foo' is the kind for a resource 'foo')", + "verbs": "verbs is a list of supported kube verbs (this includes get, list, watch, create, update, patch, delete, deletecollection, and proxy)", + "shortNames": "shortNames is a list of suggested short names of the resource.", + "categories": "categories is a list of the grouped resources this resource belongs to (e.g. 'all')", + "storageVersionHash": "The hash value of the storage version, the version this resource is converted to when written to the data store. Value must be treated as opaque by clients. Only equality comparison on the value is valid. This is an alpha feature and may change or be removed in the future. The field is populated by the apiserver only if the StorageVersionHash feature gate is enabled. This field will remain optional even if it graduates.", } func (APIResource) SwaggerDoc() map[string]string { @@ -86,9 +87,9 @@ func (APIVersions) SwaggerDoc() map[string]string { } var map_CreateOptions = map[string]string{ - "": "CreateOptions may be provided when creating an API object.", - "dryRun": "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", - "includeUninitialized": "If IncludeUninitialized is specified, the object may be returned without completing initialization.", + "": "CreateOptions may be provided when creating an API object.", + "dryRun": "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + "fieldManager": "fieldManager is a name associated with the actor or entity that is making these changes. The value must be less than or 128 characters long, and only contain printable characters, as defined by https://golang.org/pkg/unicode/#IsPrint.", } func (CreateOptions) SwaggerDoc() map[string]string { @@ -109,19 +110,26 @@ func (DeleteOptions) SwaggerDoc() map[string]string { } var map_ExportOptions = map[string]string{ - "": "ExportOptions is the query options to the standard REST get call.", - "export": "Should this value be exported. Export strips fields that a user can not specify.", - "exact": "Should the export be exact. Exact export maintains cluster-specific fields like 'Namespace'.", + "": "ExportOptions is the query options to the standard REST get call. Deprecated. Planned for removal in 1.18.", + "export": "Should this value be exported. Export strips fields that a user can not specify. Deprecated. Planned for removal in 1.18.", + "exact": "Should the export be exact. Exact export maintains cluster-specific fields like 'Namespace'. Deprecated. Planned for removal in 1.18.", } func (ExportOptions) SwaggerDoc() map[string]string { return map_ExportOptions } +var map_Fields = map[string]string{ + "": "Fields stores a set of fields in a data structure like a Trie. To understand how this is used, see: https://github.com/kubernetes-sigs/structured-merge-diff", +} + +func (Fields) SwaggerDoc() map[string]string { + return map_Fields +} + var map_GetOptions = map[string]string{ - "": "GetOptions is the standard query options to the standard REST get call.", - "resourceVersion": "When specified: - if unset, then the result is returned from remote storage based on quorum-read flag; - if it's 0, then we simply return what we currently have in cache, no guarantee; - if set to non zero, then the result is at least as fresh as given rv.", - "includeUninitialized": "If true, partially initialized resources are included in the response.", + "": "GetOptions is the standard query options to the standard REST get call.", + "resourceVersion": "When specified: - if unset, then the result is returned from remote storage based on quorum-read flag; - if it's 0, then we simply return what we currently have in cache, no guarantee; - if set to non zero, then the result is at least as fresh as given rv.", } func (GetOptions) SwaggerDoc() map[string]string { @@ -189,10 +197,11 @@ func (List) SwaggerDoc() map[string]string { } var map_ListMeta = map[string]string{ - "": "ListMeta describes metadata that synthetic resources must have, including lists and various status objects. A resource may have only one of {ObjectMeta, ListMeta}.", - "selfLink": "selfLink is a URL representing this object. Populated by the system. Read-only.", - "resourceVersion": "String that identifies the server's internal version of this object that can be used by clients to determine when objects have changed. Value must be treated as opaque by clients and passed unmodified back to the server. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#concurrency-control-and-consistency", - "continue": "continue may be set if the user set a limit on the number of items returned, and indicates that the server has more data available. The value is opaque and may be used to issue another request to the endpoint that served this list to retrieve the next set of available objects. Continuing a consistent list may not be possible if the server configuration has changed or more than a few minutes have passed. The resourceVersion field returned when using this continue value will be identical to the value in the first response, unless you have received this token from an error message.", + "": "ListMeta describes metadata that synthetic resources must have, including lists and various status objects. A resource may have only one of {ObjectMeta, ListMeta}.", + "selfLink": "selfLink is a URL representing this object. Populated by the system. Read-only.", + "resourceVersion": "String that identifies the server's internal version of this object that can be used by clients to determine when objects have changed. Value must be treated as opaque by clients and passed unmodified back to the server. Populated by the system. Read-only. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#concurrency-control-and-consistency", + "continue": "continue may be set if the user set a limit on the number of items returned, and indicates that the server has more data available. The value is opaque and may be used to issue another request to the endpoint that served this list to retrieve the next set of available objects. Continuing a consistent list may not be possible if the server configuration has changed or more than a few minutes have passed. The resourceVersion field returned when using this continue value will be identical to the value in the first response, unless you have received this token from an error message.", + "remainingItemCount": "remainingItemCount is the number of subsequent items in the list which are not included in this list response. If the list request contained label or field selectors, then the number of remaining items is unknown and the field will be left unset and omitted during serialization. If the list is complete (either because it is not chunking or because this is the last chunk), then there are no more remaining items and this field will be left unset and omitted during serialization. Servers older than v1.15 do not set this field. The intended use of the remainingItemCount is *estimating* the size of a collection. Clients should not rely on the remainingItemCount to be set or to be exact.\n\nThis field is alpha and can be changed or removed without notice.", } func (ListMeta) SwaggerDoc() map[string]string { @@ -200,21 +209,34 @@ func (ListMeta) SwaggerDoc() map[string]string { } var map_ListOptions = map[string]string{ - "": "ListOptions is the query options to a standard REST list call.", - "labelSelector": "A selector to restrict the list of returned objects by their labels. Defaults to everything.", - "fieldSelector": "A selector to restrict the list of returned objects by their fields. Defaults to everything.", - "includeUninitialized": "If true, partially initialized resources are included in the response.", - "watch": "Watch for changes to the described resources and return them as a stream of add, update, and remove notifications. Specify resourceVersion.", - "resourceVersion": "When specified with a watch call, shows changes that occur after that particular version of a resource. Defaults to changes from the beginning of history. When specified for list: - if unset, then the result is returned from remote storage based on quorum-read flag; - if it's 0, then we simply return what we currently have in cache, no guarantee; - if set to non zero, then the result is at least as fresh as given rv.", - "timeoutSeconds": "Timeout for the list/watch call. This limits the duration of the call, regardless of any activity or inactivity.", - "limit": "limit is a maximum number of responses to return for a list call. If more items exist, the server will set the `continue` field on the list metadata to a value that can be used with the same initial query to retrieve the next set of results. Setting a limit may return fewer than the requested amount of items (up to zero items) in the event all requested objects are filtered out and clients should only use the presence of the continue field to determine whether more results are available. Servers may choose not to support the limit argument and will return all of the available results. If limit is specified and the continue field is empty, clients may assume that no more results are available. This field is not supported if watch is true.\n\nThe server guarantees that the objects returned when using continue will be identical to issuing a single list call without a limit - that is, no objects created, modified, or deleted after the first request is issued will be included in any subsequent continued requests. This is sometimes referred to as a consistent snapshot, and ensures that a client that is using limit to receive smaller chunks of a very large result can ensure they see all possible objects. If objects are updated during a chunked list the version of the object that was present at the time the first list result was calculated is returned.", - "continue": "The continue option should be set when retrieving more results from the server. Since this value is server defined, clients may only use the continue value from a previous query result with identical query parameters (except for the value of continue) and the server may reject a continue value it does not recognize. If the specified continue value is no longer valid whether due to expiration (generally five to fifteen minutes) or a configuration change on the server, the server will respond with a 410 ResourceExpired error together with a continue token. If the client needs a consistent list, it must restart their list without the continue field. Otherwise, the client may send another list request with the token received with the 410 error, the server will respond with a list starting from the next key, but from the latest snapshot, which is inconsistent from the previous list results - objects that are created, modified, or deleted after the first list request will be included in the response, as long as their keys are after the \"next key\".\n\nThis field is not supported when watch is true. Clients may start a watch from the last resourceVersion value returned by the server and not miss any modifications.", + "": "ListOptions is the query options to a standard REST list call.", + "labelSelector": "A selector to restrict the list of returned objects by their labels. Defaults to everything.", + "fieldSelector": "A selector to restrict the list of returned objects by their fields. Defaults to everything.", + "watch": "Watch for changes to the described resources and return them as a stream of add, update, and remove notifications. Specify resourceVersion.", + "allowWatchBookmarks": "allowWatchBookmarks requests watch events with type \"BOOKMARK\". Servers that do not implement bookmarks may ignore this flag and bookmarks are sent at the server's discretion. Clients should not assume bookmarks are returned at any specific interval, nor may they assume the server will send any BOOKMARK event during a session. If this is not a watch, this field is ignored. If the feature gate WatchBookmarks is not enabled in apiserver, this field is ignored.\n\nThis field is alpha and can be changed or removed without notice.", + "resourceVersion": "When specified with a watch call, shows changes that occur after that particular version of a resource. Defaults to changes from the beginning of history. When specified for list: - if unset, then the result is returned from remote storage based on quorum-read flag; - if it's 0, then we simply return what we currently have in cache, no guarantee; - if set to non zero, then the result is at least as fresh as given rv.", + "timeoutSeconds": "Timeout for the list/watch call. This limits the duration of the call, regardless of any activity or inactivity.", + "limit": "limit is a maximum number of responses to return for a list call. If more items exist, the server will set the `continue` field on the list metadata to a value that can be used with the same initial query to retrieve the next set of results. Setting a limit may return fewer than the requested amount of items (up to zero items) in the event all requested objects are filtered out and clients should only use the presence of the continue field to determine whether more results are available. Servers may choose not to support the limit argument and will return all of the available results. If limit is specified and the continue field is empty, clients may assume that no more results are available. This field is not supported if watch is true.\n\nThe server guarantees that the objects returned when using continue will be identical to issuing a single list call without a limit - that is, no objects created, modified, or deleted after the first request is issued will be included in any subsequent continued requests. This is sometimes referred to as a consistent snapshot, and ensures that a client that is using limit to receive smaller chunks of a very large result can ensure they see all possible objects. If objects are updated during a chunked list the version of the object that was present at the time the first list result was calculated is returned.", + "continue": "The continue option should be set when retrieving more results from the server. Since this value is server defined, clients may only use the continue value from a previous query result with identical query parameters (except for the value of continue) and the server may reject a continue value it does not recognize. If the specified continue value is no longer valid whether due to expiration (generally five to fifteen minutes) or a configuration change on the server, the server will respond with a 410 ResourceExpired error together with a continue token. If the client needs a consistent list, it must restart their list without the continue field. Otherwise, the client may send another list request with the token received with the 410 error, the server will respond with a list starting from the next key, but from the latest snapshot, which is inconsistent from the previous list results - objects that are created, modified, or deleted after the first list request will be included in the response, as long as their keys are after the \"next key\".\n\nThis field is not supported when watch is true. Clients may start a watch from the last resourceVersion value returned by the server and not miss any modifications.", } func (ListOptions) SwaggerDoc() map[string]string { return map_ListOptions } +var map_ManagedFieldsEntry = map[string]string{ + "": "ManagedFieldsEntry is a workflow-id, a FieldSet and the group version of the resource that the fieldset applies to.", + "manager": "Manager is an identifier of the workflow managing these fields.", + "operation": "Operation is the type of operation which lead to this ManagedFieldsEntry being created. The only valid values for this field are 'Apply' and 'Update'.", + "apiVersion": "APIVersion defines the version of this resource that this field set applies to. The format is \"group/version\" just like the top-level APIVersion field. It is necessary to track the version of a field set because it cannot be automatically converted.", + "time": "Time is timestamp of when these fields were set. It should always be empty if Operation is 'Apply'", + "fields": "Fields identifies a set of fields.", +} + +func (ManagedFieldsEntry) SwaggerDoc() map[string]string { + return map_ManagedFieldsEntry +} + var map_ObjectMeta = map[string]string{ "": "ObjectMeta is metadata that all persisted resources must have, which includes all objects users must create.", "name": "Name must be unique within a namespace. Is required when creating resources, although some resources may allow a client to request the generation of an appropriate name automatically. Name is primarily intended for creation idempotence and configuration definition. Cannot be updated. More info: http://kubernetes.io/docs/user-guide/identifiers#names", @@ -230,9 +252,10 @@ var map_ObjectMeta = map[string]string{ "labels": "Map of string keys and values that can be used to organize and categorize (scope and select) objects. May match selectors of replication controllers and services. More info: http://kubernetes.io/docs/user-guide/labels", "annotations": "Annotations is an unstructured key value map stored with a resource that may be set by external tools to store and retrieve arbitrary metadata. They are not queryable and should be preserved when modifying objects. More info: http://kubernetes.io/docs/user-guide/annotations", "ownerReferences": "List of objects depended by this object. If ALL objects in the list have been deleted, this object will be garbage collected. If this object is managed by a controller, then an entry in this list will point to this controller, with the controller field set to true. There cannot be more than one managing controller.", - "initializers": "An initializer is a controller which enforces some system invariant at object creation time. This field is a list of initializers that have not yet acted on this object. If nil or empty, this object has been completely initialized. Otherwise, the object is considered uninitialized and is hidden (in list/watch and get calls) from clients that haven't explicitly asked to observe uninitialized objects.\n\nWhen an object is created, the system will populate this list with the current set of initializers. Only privileged users may set or modify this list. Once it is empty, it may not be modified further by any user.", + "initializers": "An initializer is a controller which enforces some system invariant at object creation time. This field is a list of initializers that have not yet acted on this object. If nil or empty, this object has been completely initialized. Otherwise, the object is considered uninitialized and is hidden (in list/watch and get calls) from clients that haven't explicitly asked to observe uninitialized objects.\n\nWhen an object is created, the system will populate this list with the current set of initializers. Only privileged users may set or modify this list. Once it is empty, it may not be modified further by any user.\n\nDEPRECATED - initializers are an alpha field and will be removed in v1.15.", "finalizers": "Must be empty before the object is deleted from the registry. Each entry is an identifier for the responsible component that will remove the entry from the list. If the deletionTimestamp of the object is non-nil, entries in this list can only be removed.", "clusterName": "The name of the cluster which the object belongs to. This is used to distinguish resources with same name and namespace in different clusters. This field is not set anywhere right now and apiserver is going to ignore it if set in create or update request.", + "managedFields": "ManagedFields maps workflow-id and version to the set of fields that are managed by that workflow. This is mostly for internal housekeeping, and users typically shouldn't need to set or understand this field. A workflow can be the user's name, a controller's name, or the name of a specific apply path like \"ci-cd\". The set of fields is always in the version that the workflow used when modifying the object.\n\nThis field is alpha and can be changed or removed without notice.", } func (ObjectMeta) SwaggerDoc() map[string]string { @@ -253,6 +276,25 @@ func (OwnerReference) SwaggerDoc() map[string]string { return map_OwnerReference } +var map_PartialObjectMetadata = map[string]string{ + "": "PartialObjectMetadata is a generic representation of any object with ObjectMeta. It allows clients to get access to a particular ObjectMeta schema without knowing the details of the version.", + "metadata": "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata", +} + +func (PartialObjectMetadata) SwaggerDoc() map[string]string { + return map_PartialObjectMetadata +} + +var map_PartialObjectMetadataList = map[string]string{ + "": "PartialObjectMetadataList contains a list of objects containing only their metadata", + "metadata": "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds", + "items": "items contains each of the included items.", +} + +func (PartialObjectMetadataList) SwaggerDoc() map[string]string { + return map_PartialObjectMetadataList +} + var map_Patch = map[string]string{ "": "Patch is provided to give a concrete name and type to the Kubernetes PATCH request body.", } @@ -261,9 +303,21 @@ func (Patch) SwaggerDoc() map[string]string { return map_Patch } +var map_PatchOptions = map[string]string{ + "": "PatchOptions may be provided when patching an API object. PatchOptions is meant to be a superset of UpdateOptions.", + "dryRun": "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + "force": "Force is going to \"force\" Apply requests. It means user will re-acquire conflicting fields owned by other people. Force flag must be unset for non-apply patch requests.", + "fieldManager": "fieldManager is a name associated with the actor or entity that is making these changes. The value must be less than or 128 characters long, and only contain printable characters, as defined by https://golang.org/pkg/unicode/#IsPrint. This field is required for apply requests (application/apply-patch) but optional for non-apply patch types (JsonPatch, MergePatch, StrategicMergePatch).", +} + +func (PatchOptions) SwaggerDoc() map[string]string { + return map_PatchOptions +} + var map_Preconditions = map[string]string{ - "": "Preconditions must be fulfilled before an operation (update, delete, etc.) is carried out.", - "uid": "Specifies the target UID.", + "": "Preconditions must be fulfilled before an operation (update, delete, etc.) is carried out.", + "uid": "Specifies the target UID.", + "resourceVersion": "Specifies the target ResourceVersion", } func (Preconditions) SwaggerDoc() map[string]string { @@ -328,6 +382,62 @@ func (StatusDetails) SwaggerDoc() map[string]string { return map_StatusDetails } +var map_Table = map[string]string{ + "": "Table is a tabular representation of a set of API resources. The server transforms the object into a set of preferred columns for quickly reviewing the objects.", + "metadata": "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds", + "columnDefinitions": "columnDefinitions describes each column in the returned items array. The number of cells per row will always match the number of column definitions.", + "rows": "rows is the list of items in the table.", +} + +func (Table) SwaggerDoc() map[string]string { + return map_Table +} + +var map_TableColumnDefinition = map[string]string{ + "": "TableColumnDefinition contains information about a column returned in the Table.", + "name": "name is a human readable name for the column.", + "type": "type is an OpenAPI type definition for this column, such as number, integer, string, or array. See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more.", + "format": "format is an optional OpenAPI type modifier for this column. A format modifies the type and imposes additional rules, like date or time formatting for a string. The 'name' format is applied to the primary identifier column which has type 'string' to assist in clients identifying column is the resource name. See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more.", + "description": "description is a human readable description of this column.", + "priority": "priority is an integer defining the relative importance of this column compared to others. Lower numbers are considered higher priority. Columns that may be omitted in limited space scenarios should be given a higher priority.", +} + +func (TableColumnDefinition) SwaggerDoc() map[string]string { + return map_TableColumnDefinition +} + +var map_TableOptions = map[string]string{ + "": "TableOptions are used when a Table is requested by the caller.", + "includeObject": "includeObject decides whether to include each object along with its columnar information. Specifying \"None\" will return no object, specifying \"Object\" will return the full object contents, and specifying \"Metadata\" (the default) will return the object's metadata in the PartialObjectMetadata kind in version v1beta1 of the meta.k8s.io API group.", +} + +func (TableOptions) SwaggerDoc() map[string]string { + return map_TableOptions +} + +var map_TableRow = map[string]string{ + "": "TableRow is an individual row in a table.", + "cells": "cells will be as wide as the column definitions array and may contain strings, numbers (float64 or int64), booleans, simple maps, lists, or null. See the type field of the column definition for a more detailed description.", + "conditions": "conditions describe additional status of a row that are relevant for a human user. These conditions apply to the row, not to the object, and will be specific to table output. The only defined condition type is 'Completed', for a row that indicates a resource that has run to completion and can be given less visual priority.", + "object": "This field contains the requested additional information about each object based on the includeObject policy when requesting the Table. If \"None\", this field is empty, if \"Object\" this will be the default serialization of the object for the current API version, and if \"Metadata\" (the default) will contain the object metadata. Check the returned kind and apiVersion of the object before parsing. The media type of the object will always match the enclosing list - if this as a JSON table, these will be JSON encoded objects.", +} + +func (TableRow) SwaggerDoc() map[string]string { + return map_TableRow +} + +var map_TableRowCondition = map[string]string{ + "": "TableRowCondition allows a row to be marked with additional information.", + "type": "Type of row condition. The only defined value is 'Completed' indicating that the object this row represents has reached a completed state and may be given less visual priority than other rows. Clients are not required to honor any conditions but should be consistent where possible about handling the conditions.", + "status": "Status of the condition, one of True, False, Unknown.", + "reason": "(brief) machine readable reason for the condition's last transition.", + "message": "Human readable message indicating details about last transition.", +} + +func (TableRowCondition) SwaggerDoc() map[string]string { + return map_TableRowCondition +} + var map_TypeMeta = map[string]string{ "": "TypeMeta describes an individual object in an API response or request with strings representing the type of the object and its API schema version. Structures that are versioned or persisted should inline TypeMeta.", "kind": "Kind is a string value representing the REST resource this object represents. Servers may infer this from the endpoint the client submits requests to. Cannot be updated. In CamelCase. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds", @@ -339,8 +449,9 @@ func (TypeMeta) SwaggerDoc() map[string]string { } var map_UpdateOptions = map[string]string{ - "": "UpdateOptions may be provided when updating an API object.", - "dryRun": "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + "": "UpdateOptions may be provided when updating an API object. All fields in UpdateOptions should also be present in PatchOptions.", + "dryRun": "When present, indicates that modifications should not be persisted. An invalid or unrecognized dryRun directive will result in an error response and no further processing of the request. Valid values are: - All: all dry run stages will be processed", + "fieldManager": "fieldManager is a name associated with the actor or entity that is making these changes. The value must be less than or 128 characters long, and only contain printable characters, as defined by https://golang.org/pkg/unicode/#IsPrint.", } func (UpdateOptions) SwaggerDoc() map[string]string { diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/helpers.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/helpers.go index fc138e75aa..3b07e86db8 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/helpers.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/helpers.go @@ -47,6 +47,9 @@ func NestedFieldNoCopy(obj map[string]interface{}, fields ...string) (interface{ var val interface{} = obj for i, field := range fields { + if val == nil { + return nil, false, nil + } if m, ok := val.(map[string]interface{}); ok { val, ok = m[field] if !ok { @@ -272,6 +275,22 @@ func getNestedString(obj map[string]interface{}, fields ...string) string { return val } +func getNestedInt64(obj map[string]interface{}, fields ...string) int64 { + val, found, err := NestedInt64(obj, fields...) + if !found || err != nil { + return 0 + } + return val +} + +func getNestedInt64Pointer(obj map[string]interface{}, fields ...string) *int64 { + val, found, err := NestedInt64(obj, fields...) + if !found || err != nil { + return nil + } + return &val +} + func jsonPath(fields []string) string { return "." + strings.Join(fields, ".") } diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured.go index 781469ec26..0ba18d45d8 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured.go @@ -47,6 +47,7 @@ type Unstructured struct { var _ metav1.Object = &Unstructured{} var _ runtime.Unstructured = &Unstructured{} +var _ metav1.ListInterface = &Unstructured{} func (obj *Unstructured) GetObjectKind() schema.ObjectKind { return obj } @@ -126,6 +127,16 @@ func (u *Unstructured) UnmarshalJSON(b []byte) error { return err } +// NewEmptyInstance returns a new instance of the concrete type containing only kind/apiVersion and no other data. +// This should be called instead of reflect.New() for unstructured types because the go type alone does not preserve kind/apiVersion info. +func (in *Unstructured) NewEmptyInstance() runtime.Unstructured { + out := new(Unstructured) + if in != nil { + out.GetObjectKind().SetGroupVersionKind(in.GetObjectKind().GroupVersionKind()) + } + return out +} + func (in *Unstructured) DeepCopy() *Unstructured { if in == nil { return nil @@ -143,13 +154,20 @@ func (u *Unstructured) setNestedField(value interface{}, fields ...string) { SetNestedField(u.Object, value, fields...) } -func (u *Unstructured) setNestedSlice(value []string, fields ...string) { +func (u *Unstructured) setNestedStringSlice(value []string, fields ...string) { if u.Object == nil { u.Object = make(map[string]interface{}) } SetNestedStringSlice(u.Object, value, fields...) } +func (u *Unstructured) setNestedSlice(value []interface{}, fields ...string) { + if u.Object == nil { + u.Object = make(map[string]interface{}) + } + SetNestedSlice(u.Object, value, fields...) +} + func (u *Unstructured) setNestedMap(value map[string]string, fields ...string) { if u.Object == nil { u.Object = make(map[string]interface{}) @@ -312,6 +330,18 @@ func (u *Unstructured) SetContinue(c string) { u.setNestedField(c, "metadata", "continue") } +func (u *Unstructured) GetRemainingItemCount() *int64 { + return getNestedInt64Pointer(u.Object, "metadata", "remainingItemCount") +} + +func (u *Unstructured) SetRemainingItemCount(c *int64) { + if c == nil { + RemoveNestedField(u.Object, "metadata", "remainingItemCount") + } else { + u.setNestedField(*c, "metadata", "remainingItemCount") + } +} + func (u *Unstructured) GetCreationTimestamp() metav1.Time { var timestamp metav1.Time timestamp.UnmarshalQueryParameter(getNestedString(u.Object, "metadata", "creationTimestamp")) @@ -436,7 +466,7 @@ func (u *Unstructured) SetFinalizers(finalizers []string) { RemoveNestedField(u.Object, "metadata", "finalizers") return } - u.setNestedSlice(finalizers, "metadata", "finalizers") + u.setNestedStringSlice(finalizers, "metadata", "finalizers") } func (u *Unstructured) GetClusterName() string { @@ -450,3 +480,42 @@ func (u *Unstructured) SetClusterName(clusterName string) { } u.setNestedField(clusterName, "metadata", "clusterName") } + +func (u *Unstructured) GetManagedFields() []metav1.ManagedFieldsEntry { + items, found, err := NestedSlice(u.Object, "metadata", "managedFields") + if !found || err != nil { + return nil + } + managedFields := []metav1.ManagedFieldsEntry{} + for _, item := range items { + m, ok := item.(map[string]interface{}) + if !ok { + utilruntime.HandleError(fmt.Errorf("unable to retrieve managedFields for object, item %v is not a map", item)) + return nil + } + out := metav1.ManagedFieldsEntry{} + if err := runtime.DefaultUnstructuredConverter.FromUnstructured(m, &out); err != nil { + utilruntime.HandleError(fmt.Errorf("unable to retrieve managedFields for object: %v", err)) + return nil + } + managedFields = append(managedFields, out) + } + return managedFields +} + +func (u *Unstructured) SetManagedFields(managedFields []metav1.ManagedFieldsEntry) { + if managedFields == nil { + RemoveNestedField(u.Object, "metadata", "managedFields") + return + } + items := []interface{}{} + for _, managedFieldsEntry := range managedFields { + out, err := runtime.DefaultUnstructuredConverter.ToUnstructured(&managedFieldsEntry) + if err != nil { + utilruntime.HandleError(fmt.Errorf("unable to set managedFields for object: %v", err)) + return + } + items = append(items, out) + } + u.setNestedSlice(items, "metadata", "managedFields") +} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured_list.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured_list.go index bf3fd023f4..5028f5fb57 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured_list.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/unstructured/unstructured_list.go @@ -52,6 +52,16 @@ func (u *UnstructuredList) EachListItem(fn func(runtime.Object) error) error { return nil } +// NewEmptyInstance returns a new instance of the concrete type containing only kind/apiVersion and no other data. +// This should be called instead of reflect.New() for unstructured types because the go type alone does not preserve kind/apiVersion info. +func (u *UnstructuredList) NewEmptyInstance() runtime.Unstructured { + out := new(UnstructuredList) + if u != nil { + out.SetGroupVersionKind(u.GroupVersionKind()) + } + return out +} + // UnstructuredContent returns a map contain an overlay of the Items field onto // the Object field. Items always overwrites overlay. func (u *UnstructuredList) UnstructuredContent() map[string]interface{} { @@ -166,6 +176,18 @@ func (u *UnstructuredList) SetContinue(c string) { u.setNestedField(c, "metadata", "continue") } +func (u *UnstructuredList) GetRemainingItemCount() *int64 { + return getNestedInt64Pointer(u.Object, "metadata", "remainingItemCount") +} + +func (u *UnstructuredList) SetRemainingItemCount(c *int64) { + if c == nil { + RemoveNestedField(u.Object, "metadata", "remainingItemCount") + } else { + u.setNestedField(*c, "metadata", "remainingItemCount") + } +} + func (u *UnstructuredList) SetGroupVersionKind(gvk schema.GroupVersionKind) { u.SetAPIVersion(gvk.GroupVersion().String()) u.SetKind(gvk.Kind) diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/zz_generated.deepcopy.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/zz_generated.deepcopy.go index 10845993e2..fa179ac7b1 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/zz_generated.deepcopy.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/zz_generated.deepcopy.go @@ -312,6 +312,29 @@ func (in *ExportOptions) DeepCopyObject() runtime.Object { return nil } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *Fields) DeepCopyInto(out *Fields) { + *out = *in + if in.Map != nil { + in, out := &in.Map, &out.Map + *out = make(map[string]Fields, len(*in)) + for key, val := range *in { + (*out)[key] = *val.DeepCopy() + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Fields. +func (in *Fields) DeepCopy() *Fields { + if in == nil { + return nil + } + out := new(Fields) + in.DeepCopyInto(out) + return out +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *GetOptions) DeepCopyInto(out *GetOptions) { *out = *in @@ -549,7 +572,7 @@ func (in *LabelSelectorRequirement) DeepCopy() *LabelSelectorRequirement { func (in *List) DeepCopyInto(out *List) { *out = *in out.TypeMeta = in.TypeMeta - out.ListMeta = in.ListMeta + in.ListMeta.DeepCopyInto(&out.ListMeta) if in.Items != nil { in, out := &in.Items, &out.Items *out = make([]runtime.RawExtension, len(*in)) @@ -581,6 +604,11 @@ func (in *List) DeepCopyObject() runtime.Object { // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *ListMeta) DeepCopyInto(out *ListMeta) { *out = *in + if in.RemainingItemCount != nil { + in, out := &in.RemainingItemCount, &out.RemainingItemCount + *out = new(int64) + **out = **in + } return } @@ -624,6 +652,31 @@ func (in *ListOptions) DeepCopyObject() runtime.Object { return nil } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *ManagedFieldsEntry) DeepCopyInto(out *ManagedFieldsEntry) { + *out = *in + if in.Time != nil { + in, out := &in.Time, &out.Time + *out = (*in).DeepCopy() + } + if in.Fields != nil { + in, out := &in.Fields, &out.Fields + *out = new(Fields) + (*in).DeepCopyInto(*out) + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new ManagedFieldsEntry. +func (in *ManagedFieldsEntry) DeepCopy() *ManagedFieldsEntry { + if in == nil { + return nil + } + out := new(ManagedFieldsEntry) + in.DeepCopyInto(out) + return out +} + // DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new MicroTime. func (in *MicroTime) DeepCopy() *MicroTime { if in == nil { @@ -678,6 +731,13 @@ func (in *ObjectMeta) DeepCopyInto(out *ObjectMeta) { *out = make([]string, len(*in)) copy(*out, *in) } + if in.ManagedFields != nil { + in, out := &in.ManagedFields, &out.ManagedFields + *out = make([]ManagedFieldsEntry, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } return } @@ -717,6 +777,65 @@ func (in *OwnerReference) DeepCopy() *OwnerReference { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *PartialObjectMetadata) DeepCopyInto(out *PartialObjectMetadata) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new PartialObjectMetadata. +func (in *PartialObjectMetadata) DeepCopy() *PartialObjectMetadata { + if in == nil { + return nil + } + out := new(PartialObjectMetadata) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *PartialObjectMetadata) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *PartialObjectMetadataList) DeepCopyInto(out *PartialObjectMetadataList) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ListMeta.DeepCopyInto(&out.ListMeta) + if in.Items != nil { + in, out := &in.Items, &out.Items + *out = make([]PartialObjectMetadata, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new PartialObjectMetadataList. +func (in *PartialObjectMetadataList) DeepCopy() *PartialObjectMetadataList { + if in == nil { + return nil + } + out := new(PartialObjectMetadataList) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *PartialObjectMetadataList) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *Patch) DeepCopyInto(out *Patch) { *out = *in @@ -733,6 +852,41 @@ func (in *Patch) DeepCopy() *Patch { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *PatchOptions) DeepCopyInto(out *PatchOptions) { + *out = *in + out.TypeMeta = in.TypeMeta + if in.DryRun != nil { + in, out := &in.DryRun, &out.DryRun + *out = make([]string, len(*in)) + copy(*out, *in) + } + if in.Force != nil { + in, out := &in.Force, &out.Force + *out = new(bool) + **out = **in + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new PatchOptions. +func (in *PatchOptions) DeepCopy() *PatchOptions { + if in == nil { + return nil + } + out := new(PatchOptions) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *PatchOptions) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + // DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. func (in *Preconditions) DeepCopyInto(out *Preconditions) { *out = *in @@ -741,6 +895,11 @@ func (in *Preconditions) DeepCopyInto(out *Preconditions) { *out = new(types.UID) **out = **in } + if in.ResourceVersion != nil { + in, out := &in.ResourceVersion, &out.ResourceVersion + *out = new(string) + **out = **in + } return } @@ -795,7 +954,7 @@ func (in *ServerAddressByClientCIDR) DeepCopy() *ServerAddressByClientCIDR { func (in *Status) DeepCopyInto(out *Status) { *out = *in out.TypeMeta = in.TypeMeta - out.ListMeta = in.ListMeta + in.ListMeta.DeepCopyInto(&out.ListMeta) if in.Details != nil { in, out := &in.Details, &out.Details *out = new(StatusDetails) @@ -859,6 +1018,108 @@ func (in *StatusDetails) DeepCopy() *StatusDetails { return out } +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *Table) DeepCopyInto(out *Table) { + *out = *in + out.TypeMeta = in.TypeMeta + in.ListMeta.DeepCopyInto(&out.ListMeta) + if in.ColumnDefinitions != nil { + in, out := &in.ColumnDefinitions, &out.ColumnDefinitions + *out = make([]TableColumnDefinition, len(*in)) + copy(*out, *in) + } + if in.Rows != nil { + in, out := &in.Rows, &out.Rows + *out = make([]TableRow, len(*in)) + for i := range *in { + (*in)[i].DeepCopyInto(&(*out)[i]) + } + } + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Table. +func (in *Table) DeepCopy() *Table { + if in == nil { + return nil + } + out := new(Table) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *Table) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *TableColumnDefinition) DeepCopyInto(out *TableColumnDefinition) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TableColumnDefinition. +func (in *TableColumnDefinition) DeepCopy() *TableColumnDefinition { + if in == nil { + return nil + } + out := new(TableColumnDefinition) + in.DeepCopyInto(out) + return out +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *TableOptions) DeepCopyInto(out *TableOptions) { + *out = *in + out.TypeMeta = in.TypeMeta + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TableOptions. +func (in *TableOptions) DeepCopy() *TableOptions { + if in == nil { + return nil + } + out := new(TableOptions) + in.DeepCopyInto(out) + return out +} + +// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. +func (in *TableOptions) DeepCopyObject() runtime.Object { + if c := in.DeepCopy(); c != nil { + return c + } + return nil +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *TableRow) DeepCopyInto(out *TableRow) { + clone := in.DeepCopy() + *out = *clone + return +} + +// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. +func (in *TableRowCondition) DeepCopyInto(out *TableRowCondition) { + *out = *in + return +} + +// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TableRowCondition. +func (in *TableRowCondition) DeepCopy() *TableRowCondition { + if in == nil { + return nil + } + out := new(TableRowCondition) + in.DeepCopyInto(out) + return out +} + // DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Time. func (in *Time) DeepCopy() *Time { if in == nil { diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/conversion.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/conversion.go deleted file mode 100644 index f3e5e4c98d..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/conversion.go +++ /dev/null @@ -1,27 +0,0 @@ -/* -Copyright 2017 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta1 - -import "k8s.io/apimachinery/pkg/conversion" - -// Convert_Slice_string_To_v1beta1_IncludeObjectPolicy allows converting a URL query parameter value -func Convert_Slice_string_To_v1beta1_IncludeObjectPolicy(input *[]string, out *IncludeObjectPolicy, s conversion.Scope) error { - if len(*input) > 0 { - *out = IncludeObjectPolicy((*input)[0]) - } - return nil -} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/doc.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/doc.go deleted file mode 100644 index 46b0e133c3..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/doc.go +++ /dev/null @@ -1,23 +0,0 @@ -/* -Copyright 2017 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// +k8s:deepcopy-gen=package -// +k8s:openapi-gen=true -// +k8s:defaulter-gen=TypeMeta - -// +groupName=meta.k8s.io - -package v1beta1 diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.pb.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.pb.go deleted file mode 100644 index 47c03d69b9..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.pb.go +++ /dev/null @@ -1,613 +0,0 @@ -/* -Copyright The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// Code generated by protoc-gen-gogo. DO NOT EDIT. -// source: k8s.io/kubernetes/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.proto - -/* - Package v1beta1 is a generated protocol buffer package. - - It is generated from these files: - k8s.io/kubernetes/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.proto - - It has these top-level messages: - PartialObjectMetadata - PartialObjectMetadataList - TableOptions -*/ -package v1beta1 - -import proto "github.com/gogo/protobuf/proto" -import fmt "fmt" -import math "math" - -import strings "strings" -import reflect "reflect" - -import io "io" - -// Reference imports to suppress errors if they are not otherwise used. -var _ = proto.Marshal -var _ = fmt.Errorf -var _ = math.Inf - -// This is a compile-time assertion to ensure that this generated file -// is compatible with the proto package it is being compiled against. -// A compilation error at this line likely means your copy of the -// proto package needs to be updated. -const _ = proto.GoGoProtoPackageIsVersion2 // please upgrade the proto package - -func (m *PartialObjectMetadata) Reset() { *m = PartialObjectMetadata{} } -func (*PartialObjectMetadata) ProtoMessage() {} -func (*PartialObjectMetadata) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{0} } - -func (m *PartialObjectMetadataList) Reset() { *m = PartialObjectMetadataList{} } -func (*PartialObjectMetadataList) ProtoMessage() {} -func (*PartialObjectMetadataList) Descriptor() ([]byte, []int) { - return fileDescriptorGenerated, []int{1} -} - -func (m *TableOptions) Reset() { *m = TableOptions{} } -func (*TableOptions) ProtoMessage() {} -func (*TableOptions) Descriptor() ([]byte, []int) { return fileDescriptorGenerated, []int{2} } - -func init() { - proto.RegisterType((*PartialObjectMetadata)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1beta1.PartialObjectMetadata") - proto.RegisterType((*PartialObjectMetadataList)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1beta1.PartialObjectMetadataList") - proto.RegisterType((*TableOptions)(nil), "k8s.io.apimachinery.pkg.apis.meta.v1beta1.TableOptions") -} -func (m *PartialObjectMetadata) Marshal() (dAtA []byte, err error) { - size := m.Size() - dAtA = make([]byte, size) - n, err := m.MarshalTo(dAtA) - if err != nil { - return nil, err - } - return dAtA[:n], nil -} - -func (m *PartialObjectMetadata) MarshalTo(dAtA []byte) (int, error) { - var i int - _ = i - var l int - _ = l - dAtA[i] = 0xa - i++ - i = encodeVarintGenerated(dAtA, i, uint64(m.ObjectMeta.Size())) - n1, err := m.ObjectMeta.MarshalTo(dAtA[i:]) - if err != nil { - return 0, err - } - i += n1 - return i, nil -} - -func (m *PartialObjectMetadataList) Marshal() (dAtA []byte, err error) { - size := m.Size() - dAtA = make([]byte, size) - n, err := m.MarshalTo(dAtA) - if err != nil { - return nil, err - } - return dAtA[:n], nil -} - -func (m *PartialObjectMetadataList) MarshalTo(dAtA []byte) (int, error) { - var i int - _ = i - var l int - _ = l - if len(m.Items) > 0 { - for _, msg := range m.Items { - dAtA[i] = 0xa - i++ - i = encodeVarintGenerated(dAtA, i, uint64(msg.Size())) - n, err := msg.MarshalTo(dAtA[i:]) - if err != nil { - return 0, err - } - i += n - } - } - return i, nil -} - -func (m *TableOptions) Marshal() (dAtA []byte, err error) { - size := m.Size() - dAtA = make([]byte, size) - n, err := m.MarshalTo(dAtA) - if err != nil { - return nil, err - } - return dAtA[:n], nil -} - -func (m *TableOptions) MarshalTo(dAtA []byte) (int, error) { - var i int - _ = i - var l int - _ = l - dAtA[i] = 0xa - i++ - i = encodeVarintGenerated(dAtA, i, uint64(len(m.IncludeObject))) - i += copy(dAtA[i:], m.IncludeObject) - return i, nil -} - -func encodeVarintGenerated(dAtA []byte, offset int, v uint64) int { - for v >= 1<<7 { - dAtA[offset] = uint8(v&0x7f | 0x80) - v >>= 7 - offset++ - } - dAtA[offset] = uint8(v) - return offset + 1 -} -func (m *PartialObjectMetadata) Size() (n int) { - var l int - _ = l - l = m.ObjectMeta.Size() - n += 1 + l + sovGenerated(uint64(l)) - return n -} - -func (m *PartialObjectMetadataList) Size() (n int) { - var l int - _ = l - if len(m.Items) > 0 { - for _, e := range m.Items { - l = e.Size() - n += 1 + l + sovGenerated(uint64(l)) - } - } - return n -} - -func (m *TableOptions) Size() (n int) { - var l int - _ = l - l = len(m.IncludeObject) - n += 1 + l + sovGenerated(uint64(l)) - return n -} - -func sovGenerated(x uint64) (n int) { - for { - n++ - x >>= 7 - if x == 0 { - break - } - } - return n -} -func sozGenerated(x uint64) (n int) { - return sovGenerated(uint64((x << 1) ^ uint64((int64(x) >> 63)))) -} -func (this *PartialObjectMetadata) String() string { - if this == nil { - return "nil" - } - s := strings.Join([]string{`&PartialObjectMetadata{`, - `ObjectMeta:` + strings.Replace(strings.Replace(this.ObjectMeta.String(), "ObjectMeta", "k8s_io_apimachinery_pkg_apis_meta_v1.ObjectMeta", 1), `&`, ``, 1) + `,`, - `}`, - }, "") - return s -} -func (this *PartialObjectMetadataList) String() string { - if this == nil { - return "nil" - } - s := strings.Join([]string{`&PartialObjectMetadataList{`, - `Items:` + strings.Replace(fmt.Sprintf("%v", this.Items), "PartialObjectMetadata", "PartialObjectMetadata", 1) + `,`, - `}`, - }, "") - return s -} -func (this *TableOptions) String() string { - if this == nil { - return "nil" - } - s := strings.Join([]string{`&TableOptions{`, - `IncludeObject:` + fmt.Sprintf("%v", this.IncludeObject) + `,`, - `}`, - }, "") - return s -} -func valueToStringGenerated(v interface{}) string { - rv := reflect.ValueOf(v) - if rv.IsNil() { - return "nil" - } - pv := reflect.Indirect(rv).Interface() - return fmt.Sprintf("*%v", pv) -} -func (m *PartialObjectMetadata) Unmarshal(dAtA []byte) error { - l := len(dAtA) - iNdEx := 0 - for iNdEx < l { - preIndex := iNdEx - var wire uint64 - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - wire |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - fieldNum := int32(wire >> 3) - wireType := int(wire & 0x7) - if wireType == 4 { - return fmt.Errorf("proto: PartialObjectMetadata: wiretype end group for non-group") - } - if fieldNum <= 0 { - return fmt.Errorf("proto: PartialObjectMetadata: illegal tag %d (wire type %d)", fieldNum, wire) - } - switch fieldNum { - case 1: - if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field ObjectMeta", wireType) - } - var msglen int - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - msglen |= (int(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - if msglen < 0 { - return ErrInvalidLengthGenerated - } - postIndex := iNdEx + msglen - if postIndex > l { - return io.ErrUnexpectedEOF - } - if err := m.ObjectMeta.Unmarshal(dAtA[iNdEx:postIndex]); err != nil { - return err - } - iNdEx = postIndex - default: - iNdEx = preIndex - skippy, err := skipGenerated(dAtA[iNdEx:]) - if err != nil { - return err - } - if skippy < 0 { - return ErrInvalidLengthGenerated - } - if (iNdEx + skippy) > l { - return io.ErrUnexpectedEOF - } - iNdEx += skippy - } - } - - if iNdEx > l { - return io.ErrUnexpectedEOF - } - return nil -} -func (m *PartialObjectMetadataList) Unmarshal(dAtA []byte) error { - l := len(dAtA) - iNdEx := 0 - for iNdEx < l { - preIndex := iNdEx - var wire uint64 - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - wire |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - fieldNum := int32(wire >> 3) - wireType := int(wire & 0x7) - if wireType == 4 { - return fmt.Errorf("proto: PartialObjectMetadataList: wiretype end group for non-group") - } - if fieldNum <= 0 { - return fmt.Errorf("proto: PartialObjectMetadataList: illegal tag %d (wire type %d)", fieldNum, wire) - } - switch fieldNum { - case 1: - if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field Items", wireType) - } - var msglen int - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - msglen |= (int(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - if msglen < 0 { - return ErrInvalidLengthGenerated - } - postIndex := iNdEx + msglen - if postIndex > l { - return io.ErrUnexpectedEOF - } - m.Items = append(m.Items, &PartialObjectMetadata{}) - if err := m.Items[len(m.Items)-1].Unmarshal(dAtA[iNdEx:postIndex]); err != nil { - return err - } - iNdEx = postIndex - default: - iNdEx = preIndex - skippy, err := skipGenerated(dAtA[iNdEx:]) - if err != nil { - return err - } - if skippy < 0 { - return ErrInvalidLengthGenerated - } - if (iNdEx + skippy) > l { - return io.ErrUnexpectedEOF - } - iNdEx += skippy - } - } - - if iNdEx > l { - return io.ErrUnexpectedEOF - } - return nil -} -func (m *TableOptions) Unmarshal(dAtA []byte) error { - l := len(dAtA) - iNdEx := 0 - for iNdEx < l { - preIndex := iNdEx - var wire uint64 - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - wire |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - fieldNum := int32(wire >> 3) - wireType := int(wire & 0x7) - if wireType == 4 { - return fmt.Errorf("proto: TableOptions: wiretype end group for non-group") - } - if fieldNum <= 0 { - return fmt.Errorf("proto: TableOptions: illegal tag %d (wire type %d)", fieldNum, wire) - } - switch fieldNum { - case 1: - if wireType != 2 { - return fmt.Errorf("proto: wrong wireType = %d for field IncludeObject", wireType) - } - var stringLen uint64 - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return ErrIntOverflowGenerated - } - if iNdEx >= l { - return io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - stringLen |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - intStringLen := int(stringLen) - if intStringLen < 0 { - return ErrInvalidLengthGenerated - } - postIndex := iNdEx + intStringLen - if postIndex > l { - return io.ErrUnexpectedEOF - } - m.IncludeObject = IncludeObjectPolicy(dAtA[iNdEx:postIndex]) - iNdEx = postIndex - default: - iNdEx = preIndex - skippy, err := skipGenerated(dAtA[iNdEx:]) - if err != nil { - return err - } - if skippy < 0 { - return ErrInvalidLengthGenerated - } - if (iNdEx + skippy) > l { - return io.ErrUnexpectedEOF - } - iNdEx += skippy - } - } - - if iNdEx > l { - return io.ErrUnexpectedEOF - } - return nil -} -func skipGenerated(dAtA []byte) (n int, err error) { - l := len(dAtA) - iNdEx := 0 - for iNdEx < l { - var wire uint64 - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return 0, ErrIntOverflowGenerated - } - if iNdEx >= l { - return 0, io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - wire |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - wireType := int(wire & 0x7) - switch wireType { - case 0: - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return 0, ErrIntOverflowGenerated - } - if iNdEx >= l { - return 0, io.ErrUnexpectedEOF - } - iNdEx++ - if dAtA[iNdEx-1] < 0x80 { - break - } - } - return iNdEx, nil - case 1: - iNdEx += 8 - return iNdEx, nil - case 2: - var length int - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return 0, ErrIntOverflowGenerated - } - if iNdEx >= l { - return 0, io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - length |= (int(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - iNdEx += length - if length < 0 { - return 0, ErrInvalidLengthGenerated - } - return iNdEx, nil - case 3: - for { - var innerWire uint64 - var start int = iNdEx - for shift := uint(0); ; shift += 7 { - if shift >= 64 { - return 0, ErrIntOverflowGenerated - } - if iNdEx >= l { - return 0, io.ErrUnexpectedEOF - } - b := dAtA[iNdEx] - iNdEx++ - innerWire |= (uint64(b) & 0x7F) << shift - if b < 0x80 { - break - } - } - innerWireType := int(innerWire & 0x7) - if innerWireType == 4 { - break - } - next, err := skipGenerated(dAtA[start:]) - if err != nil { - return 0, err - } - iNdEx = start + next - } - return iNdEx, nil - case 4: - return iNdEx, nil - case 5: - iNdEx += 4 - return iNdEx, nil - default: - return 0, fmt.Errorf("proto: illegal wireType %d", wireType) - } - } - panic("unreachable") -} - -var ( - ErrInvalidLengthGenerated = fmt.Errorf("proto: negative length found during unmarshaling") - ErrIntOverflowGenerated = fmt.Errorf("proto: integer overflow") -) - -func init() { - proto.RegisterFile("k8s.io/kubernetes/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.proto", fileDescriptorGenerated) -} - -var fileDescriptorGenerated = []byte{ - // 375 bytes of a gzipped FileDescriptorProto - 0x1f, 0x8b, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0xff, 0x8c, 0x91, 0xcd, 0x0a, 0xd3, 0x40, - 0x10, 0xc7, 0xb3, 0x48, 0xd1, 0x6e, 0xed, 0x25, 0x22, 0xd4, 0x1e, 0x36, 0xa5, 0xa7, 0x0a, 0x76, - 0xd7, 0x16, 0x11, 0x8f, 0x92, 0x5b, 0x41, 0x69, 0x09, 0x9e, 0x3c, 0xb9, 0x49, 0xc6, 0x74, 0xcd, - 0xc7, 0x86, 0xec, 0xa6, 0xd0, 0x8b, 0xf8, 0x08, 0x3e, 0x56, 0x8f, 0x3d, 0xf6, 0x14, 0x6c, 0x7c, - 0x0b, 0x4f, 0x92, 0x0f, 0xec, 0x87, 0x15, 0x7b, 0x9b, 0xf9, 0x0f, 0xbf, 0x5f, 0x66, 0xb2, 0xd8, - 0x09, 0xdf, 0x28, 0x2a, 0x24, 0x0b, 0x73, 0x17, 0xb2, 0x04, 0x34, 0x28, 0xb6, 0x81, 0xc4, 0x97, - 0x19, 0x6b, 0x07, 0x3c, 0x15, 0x31, 0xf7, 0xd6, 0x22, 0x81, 0x6c, 0xcb, 0xd2, 0x30, 0xa8, 0x02, - 0xc5, 0x62, 0xd0, 0x9c, 0x6d, 0x66, 0x2e, 0x68, 0x3e, 0x63, 0x01, 0x24, 0x90, 0x71, 0x0d, 0x3e, - 0x4d, 0x33, 0xa9, 0xa5, 0xf9, 0xbc, 0x41, 0xe9, 0x39, 0x4a, 0xd3, 0x30, 0xa8, 0x02, 0x45, 0x2b, - 0x94, 0xb6, 0xe8, 0x70, 0x1a, 0x08, 0xbd, 0xce, 0x5d, 0xea, 0xc9, 0x98, 0x05, 0x32, 0x90, 0xac, - 0x36, 0xb8, 0xf9, 0xe7, 0xba, 0xab, 0x9b, 0xba, 0x6a, 0xcc, 0xc3, 0x57, 0xf7, 0x2c, 0x75, 0xbd, - 0xcf, 0xf0, 0x9f, 0xa7, 0x64, 0x79, 0xa2, 0x45, 0x0c, 0x7f, 0x01, 0xaf, 0xff, 0x07, 0x28, 0x6f, - 0x0d, 0x31, 0xbf, 0xe6, 0xc6, 0x5b, 0xfc, 0x74, 0xc5, 0x33, 0x2d, 0x78, 0xb4, 0x74, 0xbf, 0x80, - 0xa7, 0xdf, 0x83, 0xe6, 0x3e, 0xd7, 0xdc, 0xfc, 0x84, 0x1f, 0xc5, 0x6d, 0x3d, 0x40, 0x23, 0x34, - 0xe9, 0xcd, 0x5f, 0xd2, 0x7b, 0x7e, 0x12, 0x3d, 0x79, 0x6c, 0x73, 0x57, 0x58, 0x46, 0x59, 0x58, - 0xf8, 0x94, 0x39, 0x7f, 0xac, 0xe3, 0xaf, 0xf8, 0xd9, 0xcd, 0x4f, 0xbf, 0x13, 0x4a, 0x9b, 0x1c, - 0x77, 0x84, 0x86, 0x58, 0x0d, 0xd0, 0xe8, 0xc1, 0xa4, 0x37, 0x7f, 0x4b, 0xef, 0x7e, 0x20, 0x7a, - 0x53, 0x6a, 0x77, 0xcb, 0xc2, 0xea, 0x2c, 0x2a, 0xa5, 0xd3, 0x98, 0xc7, 0x2e, 0x7e, 0xfc, 0x81, - 0xbb, 0x11, 0x2c, 0x53, 0x2d, 0x64, 0xa2, 0x4c, 0x07, 0xf7, 0x45, 0xe2, 0x45, 0xb9, 0x0f, 0x0d, - 0x5a, 0x9f, 0xdd, 0xb5, 0x5f, 0xb4, 0x47, 0xf4, 0x17, 0xe7, 0xc3, 0x5f, 0x85, 0xf5, 0xe4, 0x22, - 0x58, 0xc9, 0x48, 0x78, 0x5b, 0xe7, 0x52, 0x61, 0x4f, 0x77, 0x47, 0x62, 0xec, 0x8f, 0xc4, 0x38, - 0x1c, 0x89, 0xf1, 0xad, 0x24, 0x68, 0x57, 0x12, 0xb4, 0x2f, 0x09, 0x3a, 0x94, 0x04, 0xfd, 0x28, - 0x09, 0xfa, 0xfe, 0x93, 0x18, 0x1f, 0x1f, 0xb6, 0xab, 0xff, 0x0e, 0x00, 0x00, 0xff, 0xff, 0xf3, - 0xe1, 0xde, 0x86, 0xdb, 0x02, 0x00, 0x00, -} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.proto b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.proto deleted file mode 100644 index 83be997904..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/generated.proto +++ /dev/null @@ -1,57 +0,0 @@ -/* -Copyright The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - - -// This file was autogenerated by go-to-protobuf. Do not edit it manually! - -syntax = 'proto2'; - -package k8s.io.apimachinery.pkg.apis.meta.v1beta1; - -import "k8s.io/apimachinery/pkg/apis/meta/v1/generated.proto"; -import "k8s.io/apimachinery/pkg/runtime/generated.proto"; -import "k8s.io/apimachinery/pkg/runtime/schema/generated.proto"; - -// Package-wide variables from generator "generated". -option go_package = "v1beta1"; - -// PartialObjectMetadata is a generic representation of any object with ObjectMeta. It allows clients -// to get access to a particular ObjectMeta schema without knowing the details of the version. -// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object -message PartialObjectMetadata { - // Standard object's metadata. - // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata - // +optional - optional k8s.io.apimachinery.pkg.apis.meta.v1.ObjectMeta metadata = 1; -} - -// PartialObjectMetadataList contains a list of objects containing only their metadata -// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object -message PartialObjectMetadataList { - // items contains each of the included items. - repeated PartialObjectMetadata items = 1; -} - -// TableOptions are used when a Table is requested by the caller. -// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object -message TableOptions { - // includeObject decides whether to include each object along with its columnar information. - // Specifying "None" will return no object, specifying "Object" will return the full object contents, and - // specifying "Metadata" (the default) will return the object's metadata in the PartialObjectMetadata kind - // in version v1beta1 of the meta.k8s.io API group. - optional string includeObject = 1; -} - diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/register.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/register.go deleted file mode 100644 index d13254b41d..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/register.go +++ /dev/null @@ -1,57 +0,0 @@ -/* -Copyright 2017 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta1 - -import ( - "k8s.io/apimachinery/pkg/runtime" - "k8s.io/apimachinery/pkg/runtime/schema" -) - -// GroupName is the group name for this API. -const GroupName = "meta.k8s.io" - -// SchemeGroupVersion is group version used to register these objects -var SchemeGroupVersion = schema.GroupVersion{Group: GroupName, Version: "v1beta1"} - -// Kind takes an unqualified kind and returns a Group qualified GroupKind -func Kind(kind string) schema.GroupKind { - return SchemeGroupVersion.WithKind(kind).GroupKind() -} - -// scheme is the registry for the common types that adhere to the meta v1beta1 API spec. -var scheme = runtime.NewScheme() - -// ParameterCodec knows about query parameters used with the meta v1beta1 API spec. -var ParameterCodec = runtime.NewParameterCodec(scheme) - -func init() { - scheme.AddKnownTypes(SchemeGroupVersion, - &Table{}, - &TableOptions{}, - &PartialObjectMetadata{}, - &PartialObjectMetadataList{}, - ) - - if err := scheme.AddConversionFuncs( - Convert_Slice_string_To_v1beta1_IncludeObjectPolicy, - ); err != nil { - panic(err) - } - - // register manually. This usually goes through the SchemeBuilder, which we cannot use here. - //scheme.AddGeneratedDeepCopyFuncs(GetGeneratedDeepCopyFuncs()...) -} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/types.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/types.go deleted file mode 100644 index 344c533e13..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/types.go +++ /dev/null @@ -1,161 +0,0 @@ -/* -Copyright 2017 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// package v1beta1 is alpha objects from meta that will be introduced. -package v1beta1 - -import ( - "k8s.io/apimachinery/pkg/apis/meta/v1" - "k8s.io/apimachinery/pkg/runtime" -) - -// TODO: Table does not generate to protobuf because of the interface{} - fix protobuf -// generation to support a meta type that can accept any valid JSON. - -// Table is a tabular representation of a set of API resources. The server transforms the -// object into a set of preferred columns for quickly reviewing the objects. -// +protobuf=false -// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object -type Table struct { - v1.TypeMeta `json:",inline"` - // Standard list metadata. - // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds - // +optional - v1.ListMeta `json:"metadata,omitempty"` - - // columnDefinitions describes each column in the returned items array. The number of cells per row - // will always match the number of column definitions. - ColumnDefinitions []TableColumnDefinition `json:"columnDefinitions"` - // rows is the list of items in the table. - Rows []TableRow `json:"rows"` -} - -// TableColumnDefinition contains information about a column returned in the Table. -// +protobuf=false -type TableColumnDefinition struct { - // name is a human readable name for the column. - Name string `json:"name"` - // type is an OpenAPI type definition for this column. - // See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more. - Type string `json:"type"` - // format is an optional OpenAPI type definition for this column. The 'name' format is applied - // to the primary identifier column to assist in clients identifying column is the resource name. - // See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more. - Format string `json:"format"` - // description is a human readable description of this column. - Description string `json:"description"` - // priority is an integer defining the relative importance of this column compared to others. Lower - // numbers are considered higher priority. Columns that may be omitted in limited space scenarios - // should be given a higher priority. - Priority int32 `json:"priority"` -} - -// TableRow is an individual row in a table. -// +protobuf=false -type TableRow struct { - // cells will be as wide as headers and may contain strings, numbers (float64 or int64), booleans, simple - // maps, or lists, or null. See the type field of the column definition for a more detailed description. - Cells []interface{} `json:"cells"` - // conditions describe additional status of a row that are relevant for a human user. - // +optional - Conditions []TableRowCondition `json:"conditions,omitempty"` - // This field contains the requested additional information about each object based on the includeObject - // policy when requesting the Table. If "None", this field is empty, if "Object" this will be the - // default serialization of the object for the current API version, and if "Metadata" (the default) will - // contain the object metadata. Check the returned kind and apiVersion of the object before parsing. - // +optional - Object runtime.RawExtension `json:"object,omitempty"` -} - -// TableRowCondition allows a row to be marked with additional information. -// +protobuf=false -type TableRowCondition struct { - // Type of row condition. - Type RowConditionType `json:"type"` - // Status of the condition, one of True, False, Unknown. - Status ConditionStatus `json:"status"` - // (brief) machine readable reason for the condition's last transition. - // +optional - Reason string `json:"reason,omitempty"` - // Human readable message indicating details about last transition. - // +optional - Message string `json:"message,omitempty"` -} - -type RowConditionType string - -// These are valid conditions of a row. This list is not exhaustive and new conditions may be -// included by other resources. -const ( - // RowCompleted means the underlying resource has reached completion and may be given less - // visual priority than other resources. - RowCompleted RowConditionType = "Completed" -) - -type ConditionStatus string - -// These are valid condition statuses. "ConditionTrue" means a resource is in the condition. -// "ConditionFalse" means a resource is not in the condition. "ConditionUnknown" means kubernetes -// can't decide if a resource is in the condition or not. In the future, we could add other -// intermediate conditions, e.g. ConditionDegraded. -const ( - ConditionTrue ConditionStatus = "True" - ConditionFalse ConditionStatus = "False" - ConditionUnknown ConditionStatus = "Unknown" -) - -// IncludeObjectPolicy controls which portion of the object is returned with a Table. -type IncludeObjectPolicy string - -const ( - // IncludeNone returns no object. - IncludeNone IncludeObjectPolicy = "None" - // IncludeMetadata serializes the object containing only its metadata field. - IncludeMetadata IncludeObjectPolicy = "Metadata" - // IncludeObject contains the full object. - IncludeObject IncludeObjectPolicy = "Object" -) - -// TableOptions are used when a Table is requested by the caller. -// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object -type TableOptions struct { - v1.TypeMeta `json:",inline"` - // includeObject decides whether to include each object along with its columnar information. - // Specifying "None" will return no object, specifying "Object" will return the full object contents, and - // specifying "Metadata" (the default) will return the object's metadata in the PartialObjectMetadata kind - // in version v1beta1 of the meta.k8s.io API group. - IncludeObject IncludeObjectPolicy `json:"includeObject,omitempty" protobuf:"bytes,1,opt,name=includeObject,casttype=IncludeObjectPolicy"` -} - -// PartialObjectMetadata is a generic representation of any object with ObjectMeta. It allows clients -// to get access to a particular ObjectMeta schema without knowing the details of the version. -// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object -type PartialObjectMetadata struct { - v1.TypeMeta `json:",inline"` - // Standard object's metadata. - // More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata - // +optional - v1.ObjectMeta `json:"metadata,omitempty" protobuf:"bytes,1,opt,name=metadata"` -} - -// PartialObjectMetadataList contains a list of objects containing only their metadata -// +k8s:deepcopy-gen:interfaces=k8s.io/apimachinery/pkg/runtime.Object -type PartialObjectMetadataList struct { - v1.TypeMeta `json:",inline"` - - // items contains each of the included items. - Items []*PartialObjectMetadata `json:"items" protobuf:"bytes,1,rep,name=items"` -} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/types_swagger_doc_generated.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/types_swagger_doc_generated.go deleted file mode 100644 index 7394535d9d..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/types_swagger_doc_generated.go +++ /dev/null @@ -1,104 +0,0 @@ -/* -Copyright The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package v1beta1 - -// This file contains a collection of methods that can be used from go-restful to -// generate Swagger API documentation for its models. Please read this PR for more -// information on the implementation: https://github.com/emicklei/go-restful/pull/215 -// -// TODOs are ignored from the parser (e.g. TODO(andronat):... || TODO:...) if and only if -// they are on one line! For multiple line or blocks that you want to ignore use ---. -// Any context after a --- is ignored. -// -// Those methods can be generated by using hack/update-generated-swagger-docs.sh - -// AUTO-GENERATED FUNCTIONS START HERE. DO NOT EDIT. -var map_PartialObjectMetadata = map[string]string{ - "": "PartialObjectMetadata is a generic representation of any object with ObjectMeta. It allows clients to get access to a particular ObjectMeta schema without knowing the details of the version.", - "metadata": "Standard object's metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#metadata", -} - -func (PartialObjectMetadata) SwaggerDoc() map[string]string { - return map_PartialObjectMetadata -} - -var map_PartialObjectMetadataList = map[string]string{ - "": "PartialObjectMetadataList contains a list of objects containing only their metadata", - "items": "items contains each of the included items.", -} - -func (PartialObjectMetadataList) SwaggerDoc() map[string]string { - return map_PartialObjectMetadataList -} - -var map_Table = map[string]string{ - "": "Table is a tabular representation of a set of API resources. The server transforms the object into a set of preferred columns for quickly reviewing the objects.", - "metadata": "Standard list metadata. More info: https://git.k8s.io/community/contributors/devel/api-conventions.md#types-kinds", - "columnDefinitions": "columnDefinitions describes each column in the returned items array. The number of cells per row will always match the number of column definitions.", - "rows": "rows is the list of items in the table.", -} - -func (Table) SwaggerDoc() map[string]string { - return map_Table -} - -var map_TableColumnDefinition = map[string]string{ - "": "TableColumnDefinition contains information about a column returned in the Table.", - "name": "name is a human readable name for the column.", - "type": "type is an OpenAPI type definition for this column. See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more.", - "format": "format is an optional OpenAPI type definition for this column. The 'name' format is applied to the primary identifier column to assist in clients identifying column is the resource name. See https://github.com/OAI/OpenAPI-Specification/blob/master/versions/2.0.md#data-types for more.", - "description": "description is a human readable description of this column.", - "priority": "priority is an integer defining the relative importance of this column compared to others. Lower numbers are considered higher priority. Columns that may be omitted in limited space scenarios should be given a higher priority.", -} - -func (TableColumnDefinition) SwaggerDoc() map[string]string { - return map_TableColumnDefinition -} - -var map_TableOptions = map[string]string{ - "": "TableOptions are used when a Table is requested by the caller.", - "includeObject": "includeObject decides whether to include each object along with its columnar information. Specifying \"None\" will return no object, specifying \"Object\" will return the full object contents, and specifying \"Metadata\" (the default) will return the object's metadata in the PartialObjectMetadata kind in version v1beta1 of the meta.k8s.io API group.", -} - -func (TableOptions) SwaggerDoc() map[string]string { - return map_TableOptions -} - -var map_TableRow = map[string]string{ - "": "TableRow is an individual row in a table.", - "cells": "cells will be as wide as headers and may contain strings, numbers (float64 or int64), booleans, simple maps, or lists, or null. See the type field of the column definition for a more detailed description.", - "conditions": "conditions describe additional status of a row that are relevant for a human user.", - "object": "This field contains the requested additional information about each object based on the includeObject policy when requesting the Table. If \"None\", this field is empty, if \"Object\" this will be the default serialization of the object for the current API version, and if \"Metadata\" (the default) will contain the object metadata. Check the returned kind and apiVersion of the object before parsing.", -} - -func (TableRow) SwaggerDoc() map[string]string { - return map_TableRow -} - -var map_TableRowCondition = map[string]string{ - "": "TableRowCondition allows a row to be marked with additional information.", - "type": "Type of row condition.", - "status": "Status of the condition, one of True, False, Unknown.", - "reason": "(brief) machine readable reason for the condition's last transition.", - "message": "Human readable message indicating details about last transition.", -} - -func (TableRowCondition) SwaggerDoc() map[string]string { - return map_TableRowCondition -} - -// AUTO-GENERATED FUNCTIONS END HERE diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/zz_generated.deepcopy.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/zz_generated.deepcopy.go deleted file mode 100644 index b77db1b150..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/zz_generated.deepcopy.go +++ /dev/null @@ -1,189 +0,0 @@ -// +build !ignore_autogenerated - -/* -Copyright The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// Code generated by deepcopy-gen. DO NOT EDIT. - -package v1beta1 - -import ( - runtime "k8s.io/apimachinery/pkg/runtime" -) - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *PartialObjectMetadata) DeepCopyInto(out *PartialObjectMetadata) { - *out = *in - out.TypeMeta = in.TypeMeta - in.ObjectMeta.DeepCopyInto(&out.ObjectMeta) - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new PartialObjectMetadata. -func (in *PartialObjectMetadata) DeepCopy() *PartialObjectMetadata { - if in == nil { - return nil - } - out := new(PartialObjectMetadata) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *PartialObjectMetadata) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *PartialObjectMetadataList) DeepCopyInto(out *PartialObjectMetadataList) { - *out = *in - out.TypeMeta = in.TypeMeta - if in.Items != nil { - in, out := &in.Items, &out.Items - *out = make([]*PartialObjectMetadata, len(*in)) - for i := range *in { - if (*in)[i] != nil { - in, out := &(*in)[i], &(*out)[i] - *out = new(PartialObjectMetadata) - (*in).DeepCopyInto(*out) - } - } - } - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new PartialObjectMetadataList. -func (in *PartialObjectMetadataList) DeepCopy() *PartialObjectMetadataList { - if in == nil { - return nil - } - out := new(PartialObjectMetadataList) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *PartialObjectMetadataList) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *Table) DeepCopyInto(out *Table) { - *out = *in - out.TypeMeta = in.TypeMeta - out.ListMeta = in.ListMeta - if in.ColumnDefinitions != nil { - in, out := &in.ColumnDefinitions, &out.ColumnDefinitions - *out = make([]TableColumnDefinition, len(*in)) - copy(*out, *in) - } - if in.Rows != nil { - in, out := &in.Rows, &out.Rows - *out = make([]TableRow, len(*in)) - for i := range *in { - (*in)[i].DeepCopyInto(&(*out)[i]) - } - } - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new Table. -func (in *Table) DeepCopy() *Table { - if in == nil { - return nil - } - out := new(Table) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *Table) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *TableColumnDefinition) DeepCopyInto(out *TableColumnDefinition) { - *out = *in - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TableColumnDefinition. -func (in *TableColumnDefinition) DeepCopy() *TableColumnDefinition { - if in == nil { - return nil - } - out := new(TableColumnDefinition) - in.DeepCopyInto(out) - return out -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *TableOptions) DeepCopyInto(out *TableOptions) { - *out = *in - out.TypeMeta = in.TypeMeta - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TableOptions. -func (in *TableOptions) DeepCopy() *TableOptions { - if in == nil { - return nil - } - out := new(TableOptions) - in.DeepCopyInto(out) - return out -} - -// DeepCopyObject is an autogenerated deepcopy function, copying the receiver, creating a new runtime.Object. -func (in *TableOptions) DeepCopyObject() runtime.Object { - if c := in.DeepCopy(); c != nil { - return c - } - return nil -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *TableRow) DeepCopyInto(out *TableRow) { - clone := in.DeepCopy() - *out = *clone - return -} - -// DeepCopyInto is an autogenerated deepcopy function, copying the receiver, writing into out. in must be non-nil. -func (in *TableRowCondition) DeepCopyInto(out *TableRowCondition) { - *out = *in - return -} - -// DeepCopy is an autogenerated deepcopy function, copying the receiver, creating a new TableRowCondition. -func (in *TableRowCondition) DeepCopy() *TableRowCondition { - if in == nil { - return nil - } - out := new(TableRowCondition) - in.DeepCopyInto(out) - return out -} diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/zz_generated.defaults.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/zz_generated.defaults.go deleted file mode 100644 index 73e63fc114..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1beta1/zz_generated.defaults.go +++ /dev/null @@ -1,32 +0,0 @@ -// +build !ignore_autogenerated - -/* -Copyright The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// Code generated by defaulter-gen. DO NOT EDIT. - -package v1beta1 - -import ( - runtime "k8s.io/apimachinery/pkg/runtime" -) - -// RegisterDefaults adds defaulters functions to the given scheme. -// Public to allow building arbitrary schemes. -// All generated defaulters are covering - they call all nested defaulters. -func RegisterDefaults(scheme *runtime.Scheme) error { - return nil -} diff --git a/vendor/k8s.io/apimachinery/pkg/conversion/queryparams/convert.go b/vendor/k8s.io/apimachinery/pkg/conversion/queryparams/convert.go index b3804aa42b..2f0dd0074a 100644 --- a/vendor/k8s.io/apimachinery/pkg/conversion/queryparams/convert.go +++ b/vendor/k8s.io/apimachinery/pkg/conversion/queryparams/convert.go @@ -54,10 +54,6 @@ func jsonTag(field reflect.StructField) (string, bool) { return tag, omitempty } -func formatValue(value interface{}) string { - return fmt.Sprintf("%v", value) -} - func isPointerKind(kind reflect.Kind) bool { return kind == reflect.Ptr } diff --git a/vendor/k8s.io/apimachinery/pkg/labels/labels.go b/vendor/k8s.io/apimachinery/pkg/labels/labels.go index 32db4d96f6..abf3ace6f1 100644 --- a/vendor/k8s.io/apimachinery/pkg/labels/labels.go +++ b/vendor/k8s.io/apimachinery/pkg/labels/labels.go @@ -172,7 +172,7 @@ func ConvertSelectorToLabelsMap(selector string) (Set, error) { return labelsMap, err } value := strings.TrimSpace(l[1]) - if err := validateLabelValue(value); err != nil { + if err := validateLabelValue(key, value); err != nil { return labelsMap, err } labelsMap[key] = value diff --git a/vendor/k8s.io/apimachinery/pkg/labels/selector.go b/vendor/k8s.io/apimachinery/pkg/labels/selector.go index f5a0888932..9be9e57d3a 100644 --- a/vendor/k8s.io/apimachinery/pkg/labels/selector.go +++ b/vendor/k8s.io/apimachinery/pkg/labels/selector.go @@ -162,7 +162,7 @@ func NewRequirement(key string, op selection.Operator, vals []string) (*Requirem } for i := range vals { - if err := validateLabelValue(vals[i]); err != nil { + if err := validateLabelValue(key, vals[i]); err != nil { return nil, err } } @@ -837,9 +837,9 @@ func validateLabelKey(k string) error { return nil } -func validateLabelValue(v string) error { +func validateLabelValue(k, v string) error { if errs := validation.IsValidLabelValue(v); len(errs) != 0 { - return fmt.Errorf("invalid label value: %q: %s", v, strings.Join(errs, "; ")) + return fmt.Errorf("invalid label value: %q: at key: %q: %s", v, k, strings.Join(errs, "; ")) } return nil } diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/converter.go b/vendor/k8s.io/apimachinery/pkg/runtime/converter.go index dff56e0340..80343081f5 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/converter.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/converter.go @@ -746,7 +746,7 @@ func isZero(v reflect.Value) bool { func structToUnstructured(sv, dv reflect.Value) error { st, dt := sv.Type(), dv.Type() if dt.Kind() == reflect.Interface && dv.NumMethod() == 0 { - dv.Set(reflect.MakeMap(mapStringInterfaceType)) + dv.Set(reflect.MakeMapWithSize(mapStringInterfaceType, st.NumField())) dv = dv.Elem() dt = dv.Type() } diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/error.go b/vendor/k8s.io/apimachinery/pkg/runtime/error.go index 322b0313df..be0c5edc85 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/error.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/error.go @@ -120,3 +120,32 @@ func IsMissingVersion(err error) bool { _, ok := err.(*missingVersionErr) return ok } + +// strictDecodingError is a base error type that is returned by a strict Decoder such +// as UniversalStrictDecoder. +type strictDecodingError struct { + message string + data string +} + +// NewStrictDecodingError creates a new strictDecodingError object. +func NewStrictDecodingError(message string, data string) error { + return &strictDecodingError{ + message: message, + data: data, + } +} + +func (e *strictDecodingError) Error() string { + return fmt.Sprintf("strict decoder error for %s: %s", e.data, e.message) +} + +// IsStrictDecodingError returns true if the error indicates that the provided object +// strictness violations. +func IsStrictDecodingError(err error) bool { + if err == nil { + return false + } + _, ok := err.(*strictDecodingError) + return ok +} diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/generated.pb.go b/vendor/k8s.io/apimachinery/pkg/runtime/generated.pb.go index 9b15989c82..5781b2c9ad 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/generated.pb.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/generated.pb.go @@ -30,14 +30,19 @@ limitations under the License. */ package runtime -import proto "github.com/gogo/protobuf/proto" -import fmt "fmt" -import math "math" +import ( + fmt "fmt" -import strings "strings" -import reflect "reflect" + proto "github.com/gogo/protobuf/proto" -import io "io" + math "math" + + strings "strings" + + reflect "reflect" + + io "io" +) // Reference imports to suppress errors if they are not otherwise used. var _ = proto.Marshal diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/helper.go b/vendor/k8s.io/apimachinery/pkg/runtime/helper.go index 33f11eb10d..7bd1a3a6a5 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/helper.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/helper.go @@ -51,7 +51,7 @@ func UnsafeObjectConvertor(scheme *Scheme) ObjectConvertor { func SetField(src interface{}, v reflect.Value, fieldName string) error { field := v.FieldByName(fieldName) if !field.IsValid() { - return fmt.Errorf("couldn't find %v field in %#v", fieldName, v.Interface()) + return fmt.Errorf("couldn't find %v field in %T", fieldName, v.Interface()) } srcValue := reflect.ValueOf(src) if srcValue.Type().AssignableTo(field.Type()) { @@ -70,7 +70,7 @@ func SetField(src interface{}, v reflect.Value, fieldName string) error { func Field(v reflect.Value, fieldName string, dest interface{}) error { field := v.FieldByName(fieldName) if !field.IsValid() { - return fmt.Errorf("couldn't find %v field in %#v", fieldName, v.Interface()) + return fmt.Errorf("couldn't find %v field in %T", fieldName, v.Interface()) } destValue, err := conversion.EnforcePtr(dest) if err != nil { @@ -93,7 +93,7 @@ func Field(v reflect.Value, fieldName string, dest interface{}) error { func FieldPtr(v reflect.Value, fieldName string, dest interface{}) error { field := v.FieldByName(fieldName) if !field.IsValid() { - return fmt.Errorf("couldn't find %v field in %#v", fieldName, v.Interface()) + return fmt.Errorf("couldn't find %v field in %T", fieldName, v.Interface()) } v, err := conversion.EnforcePtr(dest) if err != nil { @@ -210,3 +210,50 @@ type defaultFramer struct{} func (defaultFramer) NewFrameReader(r io.ReadCloser) io.ReadCloser { return r } func (defaultFramer) NewFrameWriter(w io.Writer) io.Writer { return w } + +// WithVersionEncoder serializes an object and ensures the GVK is set. +type WithVersionEncoder struct { + Version GroupVersioner + Encoder + ObjectTyper +} + +// Encode does not do conversion. It sets the gvk during serialization. +func (e WithVersionEncoder) Encode(obj Object, stream io.Writer) error { + gvks, _, err := e.ObjectTyper.ObjectKinds(obj) + if err != nil { + if IsNotRegisteredError(err) { + return e.Encoder.Encode(obj, stream) + } + return err + } + kind := obj.GetObjectKind() + oldGVK := kind.GroupVersionKind() + gvk := gvks[0] + if e.Version != nil { + preferredGVK, ok := e.Version.KindForGroupVersionKinds(gvks) + if ok { + gvk = preferredGVK + } + } + kind.SetGroupVersionKind(gvk) + err = e.Encoder.Encode(obj, stream) + kind.SetGroupVersionKind(oldGVK) + return err +} + +// WithoutVersionDecoder clears the group version kind of a deserialized object. +type WithoutVersionDecoder struct { + Decoder +} + +// Decode does not do conversion. It removes the gvk during deserialization. +func (d WithoutVersionDecoder) Decode(data []byte, defaults *schema.GroupVersionKind, into Object) (Object, *schema.GroupVersionKind, error) { + obj, gvk, err := d.Decoder.Decode(data, defaults, into) + if obj != nil { + kind := obj.GetObjectKind() + // clearing the gvk is just a convention of a codec + kind.SetGroupVersionKind(schema.GroupVersionKind{}) + } + return obj, gvk, err +} diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/interfaces.go b/vendor/k8s.io/apimachinery/pkg/runtime/interfaces.go index 699ff13e04..bded5bf159 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/interfaces.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/interfaces.go @@ -91,6 +91,10 @@ type Framer interface { type SerializerInfo struct { // MediaType is the value that represents this serializer over the wire. MediaType string + // MediaTypeType is the first part of the MediaType ("application" in "application/json"). + MediaTypeType string + // MediaTypeSubType is the second part of the MediaType ("json" in "application/json"). + MediaTypeSubType string // EncodesAsText indicates this serializer can be encoded to UTF-8 safely. EncodesAsText bool // Serializer is the individual object serializer for this media type. @@ -206,6 +210,25 @@ type ObjectCreater interface { New(kind schema.GroupVersionKind) (out Object, err error) } +// EquivalentResourceMapper provides information about resources that address the same underlying data as a specified resource +type EquivalentResourceMapper interface { + // EquivalentResourcesFor returns a list of resources that address the same underlying data as resource. + // If subresource is specified, only equivalent resources which also have the same subresource are included. + // The specified resource can be included in the returned list. + EquivalentResourcesFor(resource schema.GroupVersionResource, subresource string) []schema.GroupVersionResource + // KindFor returns the kind expected by the specified resource[/subresource]. + // A zero value is returned if the kind is unknown. + KindFor(resource schema.GroupVersionResource, subresource string) schema.GroupVersionKind +} + +// EquivalentResourceRegistry provides an EquivalentResourceMapper interface, +// and allows registering known resource[/subresource] -> kind +type EquivalentResourceRegistry interface { + EquivalentResourceMapper + // RegisterKindFor registers the existence of the specified resource[/subresource] along with its expected kind. + RegisterKindFor(resource schema.GroupVersionResource, subresource string, kind schema.GroupVersionKind) +} + // ResourceVersioner provides methods for setting and retrieving // the resource version from an API object. type ResourceVersioner interface { @@ -237,6 +260,9 @@ type Object interface { // to JSON allowed. type Unstructured interface { Object + // NewEmptyInstance returns a new instance of the concrete type containing only kind/apiVersion and no other data. + // This should be called instead of reflect.New() for unstructured types because the go type alone does not preserve kind/apiVersion info. + NewEmptyInstance() Unstructured // UnstructuredContent returns a non-nil map with this object's contents. Values may be // []interface{}, map[string]interface{}, or any primitive type. Contents are typically serialized to // and from JSON. SetUnstructuredContent should be used to mutate the contents. diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/mapper.go b/vendor/k8s.io/apimachinery/pkg/runtime/mapper.go new file mode 100644 index 0000000000..3ff84611ab --- /dev/null +++ b/vendor/k8s.io/apimachinery/pkg/runtime/mapper.go @@ -0,0 +1,98 @@ +/* +Copyright 2019 The Kubernetes Authors. + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package runtime + +import ( + "sync" + + "k8s.io/apimachinery/pkg/runtime/schema" +) + +type equivalentResourceRegistry struct { + // keyFunc computes a key for the specified resource (this allows honoring colocated resources across API groups). + // if null, or if "" is returned, resource.String() is used as the key + keyFunc func(resource schema.GroupResource) string + // resources maps key -> subresource -> equivalent resources (subresource is not included in the returned resources). + // main resources are stored with subresource="". + resources map[string]map[string][]schema.GroupVersionResource + // kinds maps resource -> subresource -> kind + kinds map[schema.GroupVersionResource]map[string]schema.GroupVersionKind + // keys caches the computed key for each GroupResource + keys map[schema.GroupResource]string + + mutex sync.RWMutex +} + +var _ EquivalentResourceMapper = (*equivalentResourceRegistry)(nil) +var _ EquivalentResourceRegistry = (*equivalentResourceRegistry)(nil) + +// NewEquivalentResourceRegistry creates a resource registry that considers all versions of a GroupResource to be equivalent. +func NewEquivalentResourceRegistry() EquivalentResourceRegistry { + return &equivalentResourceRegistry{} +} + +// NewEquivalentResourceRegistryWithIdentity creates a resource mapper with a custom identity function. +// If "" is returned by the function, GroupResource#String is used as the identity. +// GroupResources with the same identity string are considered equivalent. +func NewEquivalentResourceRegistryWithIdentity(keyFunc func(schema.GroupResource) string) EquivalentResourceRegistry { + return &equivalentResourceRegistry{keyFunc: keyFunc} +} + +func (r *equivalentResourceRegistry) EquivalentResourcesFor(resource schema.GroupVersionResource, subresource string) []schema.GroupVersionResource { + r.mutex.RLock() + defer r.mutex.RUnlock() + return r.resources[r.keys[resource.GroupResource()]][subresource] +} +func (r *equivalentResourceRegistry) KindFor(resource schema.GroupVersionResource, subresource string) schema.GroupVersionKind { + r.mutex.RLock() + defer r.mutex.RUnlock() + return r.kinds[resource][subresource] +} +func (r *equivalentResourceRegistry) RegisterKindFor(resource schema.GroupVersionResource, subresource string, kind schema.GroupVersionKind) { + r.mutex.Lock() + defer r.mutex.Unlock() + if r.kinds == nil { + r.kinds = map[schema.GroupVersionResource]map[string]schema.GroupVersionKind{} + } + if r.kinds[resource] == nil { + r.kinds[resource] = map[string]schema.GroupVersionKind{} + } + r.kinds[resource][subresource] = kind + + // get the shared key of the parent resource + key := "" + gr := resource.GroupResource() + if r.keyFunc != nil { + key = r.keyFunc(gr) + } + if key == "" { + key = gr.String() + } + + if r.keys == nil { + r.keys = map[schema.GroupResource]string{} + } + r.keys[gr] = key + + if r.resources == nil { + r.resources = map[string]map[string][]schema.GroupVersionResource{} + } + if r.resources[key] == nil { + r.resources[key] = map[string][]schema.GroupVersionResource{} + } + r.resources[key][subresource] = append(r.resources[key][subresource], resource) +} diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/schema/generated.pb.go b/vendor/k8s.io/apimachinery/pkg/runtime/schema/generated.pb.go index 28a61d5fb5..c93861c527 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/schema/generated.pb.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/schema/generated.pb.go @@ -27,9 +27,13 @@ It has these top-level messages: */ package schema -import proto "github.com/gogo/protobuf/proto" -import fmt "fmt" -import math "math" +import ( + fmt "fmt" + + proto "github.com/gogo/protobuf/proto" + + math "math" +) // Reference imports to suppress errors if they are not otherwise used. var _ = proto.Marshal diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/codec_factory.go b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/codec_factory.go index 65f451124d..01f56c9871 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/codec_factory.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/codec_factory.go @@ -17,9 +17,13 @@ limitations under the License. package serializer import ( + "mime" + "strings" + "k8s.io/apimachinery/pkg/runtime" "k8s.io/apimachinery/pkg/runtime/schema" "k8s.io/apimachinery/pkg/runtime/serializer/json" + "k8s.io/apimachinery/pkg/runtime/serializer/protobuf" "k8s.io/apimachinery/pkg/runtime/serializer/recognizer" "k8s.io/apimachinery/pkg/runtime/serializer/versioning" ) @@ -48,6 +52,8 @@ func newSerializersForScheme(scheme *runtime.Scheme, mf json.MetaFactory) []seri jsonSerializer := json.NewSerializer(mf, scheme, scheme, false) jsonPrettySerializer := json.NewSerializer(mf, scheme, scheme, true) yamlSerializer := json.NewYAMLSerializer(mf, scheme, scheme) + serializer := protobuf.NewSerializer(scheme, scheme) + raw := protobuf.NewRawSerializer(scheme, scheme) serializers := []serializerType{ { @@ -68,6 +74,15 @@ func newSerializersForScheme(scheme *runtime.Scheme, mf json.MetaFactory) []seri EncodesAsText: true, Serializer: yamlSerializer, }, + { + AcceptContentTypes: []string{runtime.ContentTypeProtobuf}, + ContentType: runtime.ContentTypeProtobuf, + FileExtensions: []string{"pb"}, + Serializer: serializer, + + Framer: protobuf.LengthDelimitedFramer, + StreamSerializer: raw, + }, } for _, fn := range serializerExtensions { @@ -120,6 +135,15 @@ func newCodecFactory(scheme *runtime.Scheme, serializers []serializerType) Codec Serializer: d.Serializer, PrettySerializer: d.PrettySerializer, } + + mediaType, _, err := mime.ParseMediaType(info.MediaType) + if err != nil { + panic(err) + } + parts := strings.SplitN(mediaType, "/", 2) + info.MediaTypeType = parts[0] + info.MediaTypeSubType = parts[1] + if d.StreamSerializer != nil { info.StreamSerializer = &runtime.StreamSerializerInfo{ Serializer: d.StreamSerializer, @@ -148,6 +172,12 @@ func newCodecFactory(scheme *runtime.Scheme, serializers []serializerType) Codec } } +// WithoutConversion returns a NegotiatedSerializer that performs no conversion, even if the +// caller requests it. +func (f CodecFactory) WithoutConversion() runtime.NegotiatedSerializer { + return WithoutConversionCodecFactory{f} +} + // SupportedMediaTypes returns the RFC2046 media types that this factory has serializers for. func (f CodecFactory) SupportedMediaTypes() []runtime.SerializerInfo { return f.accepts @@ -215,23 +245,30 @@ func (f CodecFactory) EncoderForVersion(encoder runtime.Encoder, gv runtime.Grou return f.CodecForVersions(encoder, nil, gv, nil) } -// DirectCodecFactory provides methods for retrieving "DirectCodec"s, which do not do conversion. -type DirectCodecFactory struct { +// WithoutConversionCodecFactory is a CodecFactory that will explicitly ignore requests to perform conversion. +// This wrapper is used while code migrates away from using conversion (such as external clients) and in the future +// will be unnecessary when we change the signature of NegotiatedSerializer. +type WithoutConversionCodecFactory struct { CodecFactory } -// EncoderForVersion returns an encoder that does not do conversion. -func (f DirectCodecFactory) EncoderForVersion(serializer runtime.Encoder, version runtime.GroupVersioner) runtime.Encoder { - return versioning.DirectEncoder{ +// EncoderForVersion returns an encoder that does not do conversion, but does set the group version kind of the object +// when serialized. +func (f WithoutConversionCodecFactory) EncoderForVersion(serializer runtime.Encoder, version runtime.GroupVersioner) runtime.Encoder { + return runtime.WithVersionEncoder{ Version: version, Encoder: serializer, ObjectTyper: f.CodecFactory.scheme, } } -// DecoderToVersion returns an decoder that does not do conversion. gv is ignored. -func (f DirectCodecFactory) DecoderToVersion(serializer runtime.Decoder, _ runtime.GroupVersioner) runtime.Decoder { - return versioning.DirectDecoder{ +// DecoderToVersion returns an decoder that does not do conversion. +func (f WithoutConversionCodecFactory) DecoderToVersion(serializer runtime.Decoder, _ runtime.GroupVersioner) runtime.Decoder { + return runtime.WithoutVersionDecoder{ Decoder: serializer, } } + +// DirectCodecFactory was renamed to WithoutConversionCodecFactory in 1.15. +// TODO: remove in 1.16. +type DirectCodecFactory = WithoutConversionCodecFactory diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/json/json.go b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/json/json.go index 8987e74c68..de1a7d677f 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/json/json.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/json/json.go @@ -35,34 +35,56 @@ import ( // NewSerializer creates a JSON serializer that handles encoding versioned objects into the proper JSON form. If typer // is not nil, the object has the group, version, and kind fields set. +// Deprecated: use NewSerializerWithOptions instead. func NewSerializer(meta MetaFactory, creater runtime.ObjectCreater, typer runtime.ObjectTyper, pretty bool) *Serializer { - return &Serializer{ - meta: meta, - creater: creater, - typer: typer, - yaml: false, - pretty: pretty, - } + return NewSerializerWithOptions(meta, creater, typer, SerializerOptions{false, pretty, false}) } // NewYAMLSerializer creates a YAML serializer that handles encoding versioned objects into the proper YAML form. If typer // is not nil, the object has the group, version, and kind fields set. This serializer supports only the subset of YAML that // matches JSON, and will error if constructs are used that do not serialize to JSON. +// Deprecated: use NewSerializerWithOptions instead. func NewYAMLSerializer(meta MetaFactory, creater runtime.ObjectCreater, typer runtime.ObjectTyper) *Serializer { + return NewSerializerWithOptions(meta, creater, typer, SerializerOptions{true, false, false}) +} + +// NewSerializerWithOptions creates a JSON/YAML serializer that handles encoding versioned objects into the proper JSON/YAML +// form. If typer is not nil, the object has the group, version, and kind fields set. Options are copied into the Serializer +// and are immutable. +func NewSerializerWithOptions(meta MetaFactory, creater runtime.ObjectCreater, typer runtime.ObjectTyper, options SerializerOptions) *Serializer { return &Serializer{ meta: meta, creater: creater, typer: typer, - yaml: true, + options: options, } } +// SerializerOptions holds the options which are used to configure a JSON/YAML serializer. +// example: +// (1) To configure a JSON serializer, set `Yaml` to `false`. +// (2) To configure a YAML serializer, set `Yaml` to `true`. +// (3) To configure a strict serializer that can return strictDecodingError, set `Strict` to `true`. +type SerializerOptions struct { + // Yaml: configures the Serializer to work with JSON(false) or YAML(true). + // When `Yaml` is enabled, this serializer only supports the subset of YAML that + // matches JSON, and will error if constructs are used that do not serialize to JSON. + Yaml bool + + // Pretty: configures a JSON enabled Serializer(`Yaml: false`) to produce human-readable output. + // This option is silently ignored when `Yaml` is `true`. + Pretty bool + + // Strict: configures the Serializer to return strictDecodingError's when duplicate fields are present decoding JSON or YAML. + // Note that enabling this option is not as performant as the non-strict variant, and should not be used in fast paths. + Strict bool +} + type Serializer struct { meta MetaFactory + options SerializerOptions creater runtime.ObjectCreater typer runtime.ObjectTyper - yaml bool - pretty bool } // Serializer implements Serializer @@ -100,7 +122,27 @@ func (customNumberDecoder) Decode(ptr unsafe.Pointer, iter *jsoniter.Iterator) { } iter.ReportError("DecodeNumber", err.Error()) default: + // init depth, if needed + if iter.Attachment == nil { + iter.Attachment = int(1) + } + + // remember current depth + originalAttachment := iter.Attachment + + // increment depth before descending + if i, ok := iter.Attachment.(int); ok { + iter.Attachment = i + 1 + if i > 10000 { + iter.ReportError("parse", "exceeded max depth") + return + } + } + *(*interface{})(ptr) = iter.Read() + + // restore current depth + iter.Attachment = originalAttachment } } @@ -119,11 +161,28 @@ func CaseSensitiveJsonIterator() jsoniter.API { return config } -// Private copy of jsoniter to try to shield against possible mutations +// StrictCaseSensitiveJsonIterator returns a jsoniterator API that's configured to be +// case-sensitive, but also disallows unknown fields when unmarshalling. It is compatible with +// the encoding/json standard library. +func StrictCaseSensitiveJsonIterator() jsoniter.API { + config := jsoniter.Config{ + EscapeHTML: true, + SortMapKeys: true, + ValidateJsonRawMessage: true, + CaseSensitive: true, + DisallowUnknownFields: true, + }.Froze() + // Force jsoniter to decode number to interface{} via int64/float64, if possible. + config.RegisterExtension(&customNumberExtension{}) + return config +} + +// Private copies of jsoniter to try to shield against possible mutations // from outside. Still does not protect from package level jsoniter.Register*() functions - someone calling them // in some other library will mess with every usage of the jsoniter library in the whole program. // See https://github.com/json-iterator/go/issues/265 var caseSensitiveJsonIterator = CaseSensitiveJsonIterator() +var strictCaseSensitiveJsonIterator = StrictCaseSensitiveJsonIterator() // gvkWithDefaults returns group kind and version defaulting from provided default func gvkWithDefaults(actual, defaultGVK schema.GroupVersionKind) schema.GroupVersionKind { @@ -160,7 +219,7 @@ func (s *Serializer) Decode(originalData []byte, gvk *schema.GroupVersionKind, i } data := originalData - if s.yaml { + if s.options.Yaml { altered, err := yaml.YAMLToJSON(data) if err != nil { return nil, nil, err @@ -216,12 +275,38 @@ func (s *Serializer) Decode(originalData []byte, gvk *schema.GroupVersionKind, i if err := caseSensitiveJsonIterator.Unmarshal(data, obj); err != nil { return nil, actual, err } + + // If the deserializer is non-strict, return successfully here. + if !s.options.Strict { + return obj, actual, nil + } + + // In strict mode pass the data trough the YAMLToJSONStrict converter. + // This is done to catch duplicate fields regardless of encoding (JSON or YAML). For JSON data, + // the output would equal the input, unless there is a parsing error such as duplicate fields. + // As we know this was successful in the non-strict case, the only error that may be returned here + // is because of the newly-added strictness. hence we know we can return the typed strictDecoderError + // the actual error is that the object contains duplicate fields. + altered, err := yaml.YAMLToJSONStrict(originalData) + if err != nil { + return nil, actual, runtime.NewStrictDecodingError(err.Error(), string(originalData)) + } + // As performance is not an issue for now for the strict deserializer (one has regardless to do + // the unmarshal twice), we take the sanitized, altered data that is guaranteed to have no duplicated + // fields, and unmarshal this into a copy of the already-populated obj. Any error that occurs here is + // due to that a matching field doesn't exist in the object. hence we can return a typed strictDecoderError, + // the actual error is that the object contains unknown field. + strictObj := obj.DeepCopyObject() + if err := strictCaseSensitiveJsonIterator.Unmarshal(altered, strictObj); err != nil { + return nil, actual, runtime.NewStrictDecodingError(err.Error(), string(originalData)) + } + // Always return the same object as the non-strict serializer to avoid any deviations. return obj, actual, nil } // Encode serializes the provided object to the given writer. func (s *Serializer) Encode(obj runtime.Object, w io.Writer) error { - if s.yaml { + if s.options.Yaml { json, err := caseSensitiveJsonIterator.Marshal(obj) if err != nil { return err @@ -234,7 +319,7 @@ func (s *Serializer) Encode(obj runtime.Object, w io.Writer) error { return err } - if s.pretty { + if s.options.Pretty { data, err := caseSensitiveJsonIterator.MarshalIndent(obj, "", " ") if err != nil { return err @@ -248,7 +333,7 @@ func (s *Serializer) Encode(obj runtime.Object, w io.Writer) error { // RecognizesData implements the RecognizingDecoder interface. func (s *Serializer) RecognizesData(peek io.Reader) (ok, unknown bool, err error) { - if s.yaml { + if s.options.Yaml { // we could potentially look for '---' return false, true, nil } diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/protobuf/protobuf.go b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/protobuf/protobuf.go index b99ba25c8c..8af889d35b 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/protobuf/protobuf.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/protobuf/protobuf.go @@ -69,22 +69,18 @@ func IsNotMarshalable(err error) bool { // NewSerializer creates a Protobuf serializer that handles encoding versioned objects into the proper wire form. If a typer // is passed, the encoded object will have group, version, and kind fields set. If typer is nil, the objects will be written // as-is (any type info passed with the object will be used). -// -// This encoding scheme is experimental, and is subject to change at any time. -func NewSerializer(creater runtime.ObjectCreater, typer runtime.ObjectTyper, defaultContentType string) *Serializer { +func NewSerializer(creater runtime.ObjectCreater, typer runtime.ObjectTyper) *Serializer { return &Serializer{ - prefix: protoEncodingPrefix, - creater: creater, - typer: typer, - contentType: defaultContentType, + prefix: protoEncodingPrefix, + creater: creater, + typer: typer, } } type Serializer struct { - prefix []byte - creater runtime.ObjectCreater - typer runtime.ObjectTyper - contentType string + prefix []byte + creater runtime.ObjectCreater + typer runtime.ObjectTyper } var _ runtime.Serializer = &Serializer{} @@ -138,7 +134,7 @@ func (s *Serializer) Decode(originalData []byte, gvk *schema.GroupVersionKind, i if intoUnknown, ok := into.(*runtime.Unknown); ok && intoUnknown != nil { *intoUnknown = unk if ok, _, _ := s.RecognizesData(bytes.NewBuffer(unk.Raw)); ok { - intoUnknown.ContentType = s.contentType + intoUnknown.ContentType = runtime.ContentTypeProtobuf } return intoUnknown, &actual, nil } @@ -303,20 +299,18 @@ func estimateUnknownSize(unk *runtime.Unknown, byteSize uint64) uint64 { // encoded object, and thus is not self describing (callers must know what type is being described in order to decode). // // This encoding scheme is experimental, and is subject to change at any time. -func NewRawSerializer(creater runtime.ObjectCreater, typer runtime.ObjectTyper, defaultContentType string) *RawSerializer { +func NewRawSerializer(creater runtime.ObjectCreater, typer runtime.ObjectTyper) *RawSerializer { return &RawSerializer{ - creater: creater, - typer: typer, - contentType: defaultContentType, + creater: creater, + typer: typer, } } // RawSerializer encodes and decodes objects without adding a runtime.Unknown wrapper (objects are encoded without identifying // type). type RawSerializer struct { - creater runtime.ObjectCreater - typer runtime.ObjectTyper - contentType string + creater runtime.ObjectCreater + typer runtime.ObjectTyper } var _ runtime.Serializer = &RawSerializer{} @@ -358,7 +352,7 @@ func (s *RawSerializer) Decode(originalData []byte, gvk *schema.GroupVersionKind if intoUnknown, ok := into.(*runtime.Unknown); ok && intoUnknown != nil { intoUnknown.Raw = data intoUnknown.ContentEncoding = "" - intoUnknown.ContentType = s.contentType + intoUnknown.ContentType = runtime.ContentTypeProtobuf intoUnknown.SetGroupVersionKind(*actual) return intoUnknown, actual, nil } @@ -411,6 +405,9 @@ func unmarshalToObject(typer runtime.ObjectTyper, creater runtime.ObjectCreater, if err := proto.Unmarshal(data, pb); err != nil { return nil, actual, err } + if actual != nil { + obj.GetObjectKind().SetGroupVersionKind(*actual) + } return obj, actual, nil } diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/protobuf_extension.go b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/protobuf_extension.go deleted file mode 100644 index 545cf78df7..0000000000 --- a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/protobuf_extension.go +++ /dev/null @@ -1,48 +0,0 @@ -/* -Copyright 2014 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package serializer - -import ( - "k8s.io/apimachinery/pkg/runtime" - "k8s.io/apimachinery/pkg/runtime/serializer/protobuf" -) - -const ( - // contentTypeProtobuf is the protobuf type exposed for Kubernetes. It is private to prevent others from - // depending on it unintentionally. - // TODO: potentially move to pkg/api (since it's part of the Kube public API) and pass it in to the - // CodecFactory on initialization. - contentTypeProtobuf = "application/vnd.kubernetes.protobuf" -) - -func protobufSerializer(scheme *runtime.Scheme) (serializerType, bool) { - serializer := protobuf.NewSerializer(scheme, scheme, contentTypeProtobuf) - raw := protobuf.NewRawSerializer(scheme, scheme, contentTypeProtobuf) - return serializerType{ - AcceptContentTypes: []string{contentTypeProtobuf}, - ContentType: contentTypeProtobuf, - FileExtensions: []string{"pb"}, - Serializer: serializer, - - Framer: protobuf.LengthDelimitedFramer, - StreamSerializer: raw, - }, true -} - -func init() { - serializerExtensions = append(serializerExtensions, protobufSerializer) -} diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/versioning/versioning.go b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/versioning/versioning.go index 0018471076..a04a2e98bf 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/serializer/versioning/versioning.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/serializer/versioning/versioning.go @@ -106,20 +106,13 @@ func (c *codec) Decode(data []byte, defaultGVK *schema.GroupVersionKind, into ru } if d, ok := obj.(runtime.NestedObjectDecoder); ok { - if err := d.DecodeNestedObjects(DirectDecoder{c.decoder}); err != nil { + if err := d.DecodeNestedObjects(runtime.WithoutVersionDecoder{c.decoder}); err != nil { return nil, gvk, err } } // if we specify a target, use generic conversion. if into != nil { - if into == obj { - if isVersioned { - return versioned, gvk, nil - } - return into, gvk, nil - } - // perform defaulting if requested if c.defaulter != nil { // create a copy to ensure defaulting is not applied to the original versioned objects @@ -133,6 +126,14 @@ func (c *codec) Decode(data []byte, defaultGVK *schema.GroupVersionKind, into ru } } + // Short-circuit conversion if the into object is same object + if into == obj { + if isVersioned { + return versioned, gvk, nil + } + return into, gvk, nil + } + if err := c.convertor.Convert(obj, into, c.decodeVersion); err != nil { return nil, gvk, err } @@ -199,84 +200,41 @@ func (c *codec) Encode(obj runtime.Object, w io.Writer) error { return err } + objectKind := obj.GetObjectKind() + old := objectKind.GroupVersionKind() + // restore the old GVK after encoding + defer objectKind.SetGroupVersionKind(old) + if c.encodeVersion == nil || isUnversioned { if e, ok := obj.(runtime.NestedObjectEncoder); ok { - if err := e.EncodeNestedObjects(DirectEncoder{Encoder: c.encoder, ObjectTyper: c.typer}); err != nil { + if err := e.EncodeNestedObjects(runtime.WithVersionEncoder{Encoder: c.encoder, ObjectTyper: c.typer}); err != nil { return err } } - objectKind := obj.GetObjectKind() - old := objectKind.GroupVersionKind() objectKind.SetGroupVersionKind(gvks[0]) - err = c.encoder.Encode(obj, w) - objectKind.SetGroupVersionKind(old) - return err + return c.encoder.Encode(obj, w) } // Perform a conversion if necessary - objectKind := obj.GetObjectKind() - old := objectKind.GroupVersionKind() out, err := c.convertor.ConvertToVersion(obj, c.encodeVersion) if err != nil { return err } if e, ok := out.(runtime.NestedObjectEncoder); ok { - if err := e.EncodeNestedObjects(DirectEncoder{Version: c.encodeVersion, Encoder: c.encoder, ObjectTyper: c.typer}); err != nil { + if err := e.EncodeNestedObjects(runtime.WithVersionEncoder{Version: c.encodeVersion, Encoder: c.encoder, ObjectTyper: c.typer}); err != nil { return err } } // Conversion is responsible for setting the proper group, version, and kind onto the outgoing object - err = c.encoder.Encode(out, w) - // restore the old GVK, in case conversion returned the same object - objectKind.SetGroupVersionKind(old) - return err + return c.encoder.Encode(out, w) } -// DirectEncoder serializes an object and ensures the GVK is set. -type DirectEncoder struct { - Version runtime.GroupVersioner - runtime.Encoder - runtime.ObjectTyper -} +// DirectEncoder was moved and renamed to runtime.WithVersionEncoder in 1.15. +// TODO: remove in 1.16. +type DirectEncoder = runtime.WithVersionEncoder -// Encode does not do conversion. It sets the gvk during serialization. -func (e DirectEncoder) Encode(obj runtime.Object, stream io.Writer) error { - gvks, _, err := e.ObjectTyper.ObjectKinds(obj) - if err != nil { - if runtime.IsNotRegisteredError(err) { - return e.Encoder.Encode(obj, stream) - } - return err - } - kind := obj.GetObjectKind() - oldGVK := kind.GroupVersionKind() - gvk := gvks[0] - if e.Version != nil { - preferredGVK, ok := e.Version.KindForGroupVersionKinds(gvks) - if ok { - gvk = preferredGVK - } - } - kind.SetGroupVersionKind(gvk) - err = e.Encoder.Encode(obj, stream) - kind.SetGroupVersionKind(oldGVK) - return err -} - -// DirectDecoder clears the group version kind of a deserialized object. -type DirectDecoder struct { - runtime.Decoder -} - -// Decode does not do conversion. It removes the gvk during deserialization. -func (d DirectDecoder) Decode(data []byte, defaults *schema.GroupVersionKind, into runtime.Object) (runtime.Object, *schema.GroupVersionKind, error) { - obj, gvk, err := d.Decoder.Decode(data, defaults, into) - if obj != nil { - kind := obj.GetObjectKind() - // clearing the gvk is just a convention of a codec - kind.SetGroupVersionKind(schema.GroupVersionKind{}) - } - return obj, gvk, err -} +// DirectDecoder was moved and renamed to runtime.WithoutVersionDecoder in 1.15. +// TODO: remove in 1.16. +type DirectDecoder = runtime.WithoutVersionDecoder diff --git a/vendor/k8s.io/apimachinery/pkg/runtime/types.go b/vendor/k8s.io/apimachinery/pkg/runtime/types.go index e4515d8ed0..3d3ebe5f9d 100644 --- a/vendor/k8s.io/apimachinery/pkg/runtime/types.go +++ b/vendor/k8s.io/apimachinery/pkg/runtime/types.go @@ -41,7 +41,9 @@ type TypeMeta struct { } const ( - ContentTypeJSON string = "application/json" + ContentTypeJSON string = "application/json" + ContentTypeYAML string = "application/yaml" + ContentTypeProtobuf string = "application/vnd.kubernetes.protobuf" ) // RawExtension is used to hold extensions in external versions. diff --git a/vendor/k8s.io/apimachinery/pkg/types/patch.go b/vendor/k8s.io/apimachinery/pkg/types/patch.go index d522d1dbdc..fe8ecaaffa 100644 --- a/vendor/k8s.io/apimachinery/pkg/types/patch.go +++ b/vendor/k8s.io/apimachinery/pkg/types/patch.go @@ -25,4 +25,5 @@ const ( JSONPatchType PatchType = "application/json-patch+json" MergePatchType PatchType = "application/merge-patch+json" StrategicMergePatchType PatchType = "application/strategic-merge-patch+json" + ApplyPatchType PatchType = "application/apply-patch+yaml" ) diff --git a/vendor/k8s.io/apimachinery/pkg/util/errors/errors.go b/vendor/k8s.io/apimachinery/pkg/util/errors/errors.go index 88e937679d..62a73f34eb 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/errors/errors.go +++ b/vendor/k8s.io/apimachinery/pkg/util/errors/errors.go @@ -19,6 +19,8 @@ package errors import ( "errors" "fmt" + + "k8s.io/apimachinery/pkg/util/sets" ) // MessageCountMap contains occurrence for each error message. @@ -67,12 +69,38 @@ func (agg aggregate) Error() string { if len(agg) == 1 { return agg[0].Error() } - result := fmt.Sprintf("[%s", agg[0].Error()) - for i := 1; i < len(agg); i++ { - result += fmt.Sprintf(", %s", agg[i].Error()) + seenerrs := sets.NewString() + result := "" + agg.visit(func(err error) { + msg := err.Error() + if seenerrs.Has(msg) { + return + } + seenerrs.Insert(msg) + if len(seenerrs) > 1 { + result += ", " + } + result += msg + }) + if len(seenerrs) == 1 { + return result + } + return "[" + result + "]" +} + +func (agg aggregate) visit(f func(err error)) { + for _, err := range agg { + switch err := err.(type) { + case aggregate: + err.visit(f) + case Aggregate: + for _, nestedErr := range err.Errors() { + f(nestedErr) + } + default: + f(err) + } } - result += "]" - return result } // Errors is part of the Aggregate interface. diff --git a/vendor/k8s.io/apimachinery/pkg/util/intstr/generated.pb.go b/vendor/k8s.io/apimachinery/pkg/util/intstr/generated.pb.go index 48dd7d9c55..1ac96c9eb6 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/intstr/generated.pb.go +++ b/vendor/k8s.io/apimachinery/pkg/util/intstr/generated.pb.go @@ -28,11 +28,15 @@ limitations under the License. */ package intstr -import proto "github.com/gogo/protobuf/proto" -import fmt "fmt" -import math "math" +import ( + fmt "fmt" -import io "io" + proto "github.com/gogo/protobuf/proto" + + math "math" + + io "io" +) // Reference imports to suppress errors if they are not otherwise used. var _ = proto.Marshal diff --git a/vendor/k8s.io/apimachinery/pkg/util/json/json.go b/vendor/k8s.io/apimachinery/pkg/util/json/json.go index 10c8cb837e..0e2e301754 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/json/json.go +++ b/vendor/k8s.io/apimachinery/pkg/util/json/json.go @@ -19,6 +19,7 @@ package json import ( "bytes" "encoding/json" + "fmt" "io" ) @@ -34,6 +35,9 @@ func Marshal(v interface{}) ([]byte, error) { return json.Marshal(v) } +// limit recursive depth to prevent stack overflow errors +const maxDepth = 10000 + // Unmarshal unmarshals the given data // If v is a *map[string]interface{}, numbers are converted to int64 or float64 func Unmarshal(data []byte, v interface{}) error { @@ -48,7 +52,7 @@ func Unmarshal(data []byte, v interface{}) error { return err } // If the decode succeeds, post-process the map to convert json.Number objects to int64 or float64 - return convertMapNumbers(*v) + return convertMapNumbers(*v, 0) case *[]interface{}: // Build a decoder from the given data @@ -60,7 +64,7 @@ func Unmarshal(data []byte, v interface{}) error { return err } // If the decode succeeds, post-process the map to convert json.Number objects to int64 or float64 - return convertSliceNumbers(*v) + return convertSliceNumbers(*v, 0) default: return json.Unmarshal(data, v) @@ -69,16 +73,20 @@ func Unmarshal(data []byte, v interface{}) error { // convertMapNumbers traverses the map, converting any json.Number values to int64 or float64. // values which are map[string]interface{} or []interface{} are recursively visited -func convertMapNumbers(m map[string]interface{}) error { +func convertMapNumbers(m map[string]interface{}, depth int) error { + if depth > maxDepth { + return fmt.Errorf("exceeded max depth of %d", maxDepth) + } + var err error for k, v := range m { switch v := v.(type) { case json.Number: m[k], err = convertNumber(v) case map[string]interface{}: - err = convertMapNumbers(v) + err = convertMapNumbers(v, depth+1) case []interface{}: - err = convertSliceNumbers(v) + err = convertSliceNumbers(v, depth+1) } if err != nil { return err @@ -89,16 +97,20 @@ func convertMapNumbers(m map[string]interface{}) error { // convertSliceNumbers traverses the slice, converting any json.Number values to int64 or float64. // values which are map[string]interface{} or []interface{} are recursively visited -func convertSliceNumbers(s []interface{}) error { +func convertSliceNumbers(s []interface{}, depth int) error { + if depth > maxDepth { + return fmt.Errorf("exceeded max depth of %d", maxDepth) + } + var err error for i, v := range s { switch v := v.(type) { case json.Number: s[i], err = convertNumber(v) case map[string]interface{}: - err = convertMapNumbers(v) + err = convertMapNumbers(v, depth+1) case []interface{}: - err = convertSliceNumbers(v) + err = convertSliceNumbers(v, depth+1) } if err != nil { return err diff --git a/vendor/k8s.io/apimachinery/pkg/util/net/http.go b/vendor/k8s.io/apimachinery/pkg/util/net/http.go index 155667cdfc..078f00d9b9 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/net/http.go +++ b/vendor/k8s.io/apimachinery/pkg/util/net/http.go @@ -68,14 +68,17 @@ func IsProbableEOF(err error) bool { if uerr, ok := err.(*url.Error); ok { err = uerr.Err } + msg := err.Error() switch { case err == io.EOF: return true - case err.Error() == "http: can't write HTTP request on broken connection": + case msg == "http: can't write HTTP request on broken connection": return true - case strings.Contains(err.Error(), "connection reset by peer"): + case strings.Contains(msg, "http2: server sent GOAWAY and closed the connection"): return true - case strings.Contains(strings.ToLower(err.Error()), "use of closed network connection"): + case strings.Contains(msg, "connection reset by peer"): + return true + case strings.Contains(strings.ToLower(msg), "use of closed network connection"): return true } return false diff --git a/vendor/k8s.io/apimachinery/pkg/util/runtime/runtime.go b/vendor/k8s.io/apimachinery/pkg/util/runtime/runtime.go index 8e34f92613..3c886f46c3 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/runtime/runtime.go +++ b/vendor/k8s.io/apimachinery/pkg/util/runtime/runtime.go @@ -62,27 +62,18 @@ func HandleCrash(additionalHandlers ...func(interface{})) { // logPanic logs the caller tree when a panic occurs. func logPanic(r interface{}) { - callers := getCallers(r) + // Same as stdlib http server code. Manually allocate stack trace buffer size + // to prevent excessively large logs + const size = 64 << 10 + stacktrace := make([]byte, size) + stacktrace = stacktrace[:runtime.Stack(stacktrace, false)] if _, ok := r.(string); ok { - klog.Errorf("Observed a panic: %s\n%v", r, callers) + klog.Errorf("Observed a panic: %s\n%s", r, stacktrace) } else { - klog.Errorf("Observed a panic: %#v (%v)\n%v", r, r, callers) + klog.Errorf("Observed a panic: %#v (%v)\n%s", r, r, stacktrace) } } -func getCallers(r interface{}) string { - callers := "" - for i := 0; true; i++ { - _, file, line, ok := runtime.Caller(i) - if !ok { - break - } - callers = callers + fmt.Sprintf("%v:%v\n", file, line) - } - - return callers -} - // ErrorHandlers is a list of functions which will be invoked when an unreturnable // error occurs. // TODO(lavalamp): for testability, this and the below HandleError function @@ -155,13 +146,17 @@ func GetCaller() string { // handlers to handle errors and panics the same way. func RecoverFromPanic(err *error) { if r := recover(); r != nil { - callers := getCallers(r) + // Same as stdlib http server code. Manually allocate stack trace buffer size + // to prevent excessively large logs + const size = 64 << 10 + stacktrace := make([]byte, size) + stacktrace = stacktrace[:runtime.Stack(stacktrace, false)] *err = fmt.Errorf( - "recovered from panic %q. (err=%v) Call stack:\n%v", + "recovered from panic %q. (err=%v) Call stack:\n%s", r, *err, - callers) + stacktrace) } } diff --git a/vendor/k8s.io/apimachinery/pkg/util/sets/int32.go b/vendor/k8s.io/apimachinery/pkg/util/sets/int32.go new file mode 100644 index 0000000000..584eabc8b7 --- /dev/null +++ b/vendor/k8s.io/apimachinery/pkg/util/sets/int32.go @@ -0,0 +1,203 @@ +/* +Copyright The Kubernetes Authors. + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +// Code generated by set-gen. DO NOT EDIT. + +package sets + +import ( + "reflect" + "sort" +) + +// sets.Int32 is a set of int32s, implemented via map[int32]struct{} for minimal memory consumption. +type Int32 map[int32]Empty + +// NewInt32 creates a Int32 from a list of values. +func NewInt32(items ...int32) Int32 { + ss := Int32{} + ss.Insert(items...) + return ss +} + +// Int32KeySet creates a Int32 from a keys of a map[int32](? extends interface{}). +// If the value passed in is not actually a map, this will panic. +func Int32KeySet(theMap interface{}) Int32 { + v := reflect.ValueOf(theMap) + ret := Int32{} + + for _, keyValue := range v.MapKeys() { + ret.Insert(keyValue.Interface().(int32)) + } + return ret +} + +// Insert adds items to the set. +func (s Int32) Insert(items ...int32) { + for _, item := range items { + s[item] = Empty{} + } +} + +// Delete removes all items from the set. +func (s Int32) Delete(items ...int32) { + for _, item := range items { + delete(s, item) + } +} + +// Has returns true if and only if item is contained in the set. +func (s Int32) Has(item int32) bool { + _, contained := s[item] + return contained +} + +// HasAll returns true if and only if all items are contained in the set. +func (s Int32) HasAll(items ...int32) bool { + for _, item := range items { + if !s.Has(item) { + return false + } + } + return true +} + +// HasAny returns true if any items are contained in the set. +func (s Int32) HasAny(items ...int32) bool { + for _, item := range items { + if s.Has(item) { + return true + } + } + return false +} + +// Difference returns a set of objects that are not in s2 +// For example: +// s1 = {a1, a2, a3} +// s2 = {a1, a2, a4, a5} +// s1.Difference(s2) = {a3} +// s2.Difference(s1) = {a4, a5} +func (s Int32) Difference(s2 Int32) Int32 { + result := NewInt32() + for key := range s { + if !s2.Has(key) { + result.Insert(key) + } + } + return result +} + +// Union returns a new set which includes items in either s1 or s2. +// For example: +// s1 = {a1, a2} +// s2 = {a3, a4} +// s1.Union(s2) = {a1, a2, a3, a4} +// s2.Union(s1) = {a1, a2, a3, a4} +func (s1 Int32) Union(s2 Int32) Int32 { + result := NewInt32() + for key := range s1 { + result.Insert(key) + } + for key := range s2 { + result.Insert(key) + } + return result +} + +// Intersection returns a new set which includes the item in BOTH s1 and s2 +// For example: +// s1 = {a1, a2} +// s2 = {a2, a3} +// s1.Intersection(s2) = {a2} +func (s1 Int32) Intersection(s2 Int32) Int32 { + var walk, other Int32 + result := NewInt32() + if s1.Len() < s2.Len() { + walk = s1 + other = s2 + } else { + walk = s2 + other = s1 + } + for key := range walk { + if other.Has(key) { + result.Insert(key) + } + } + return result +} + +// IsSuperset returns true if and only if s1 is a superset of s2. +func (s1 Int32) IsSuperset(s2 Int32) bool { + for item := range s2 { + if !s1.Has(item) { + return false + } + } + return true +} + +// Equal returns true if and only if s1 is equal (as a set) to s2. +// Two sets are equal if their membership is identical. +// (In practice, this means same elements, order doesn't matter) +func (s1 Int32) Equal(s2 Int32) bool { + return len(s1) == len(s2) && s1.IsSuperset(s2) +} + +type sortableSliceOfInt32 []int32 + +func (s sortableSliceOfInt32) Len() int { return len(s) } +func (s sortableSliceOfInt32) Less(i, j int) bool { return lessInt32(s[i], s[j]) } +func (s sortableSliceOfInt32) Swap(i, j int) { s[i], s[j] = s[j], s[i] } + +// List returns the contents as a sorted int32 slice. +func (s Int32) List() []int32 { + res := make(sortableSliceOfInt32, 0, len(s)) + for key := range s { + res = append(res, key) + } + sort.Sort(res) + return []int32(res) +} + +// UnsortedList returns the slice with contents in random order. +func (s Int32) UnsortedList() []int32 { + res := make([]int32, 0, len(s)) + for key := range s { + res = append(res, key) + } + return res +} + +// Returns a single element from the set. +func (s Int32) PopAny() (int32, bool) { + for key := range s { + s.Delete(key) + return key, true + } + var zeroValue int32 + return zeroValue, false +} + +// Len returns the size of the set. +func (s Int32) Len() int { + return len(s) +} + +func lessInt32(lhs, rhs int32) bool { + return lhs < rhs +} diff --git a/vendor/k8s.io/apimachinery/pkg/util/validation/validation.go b/vendor/k8s.io/apimachinery/pkg/util/validation/validation.go index e0d1715420..2dd99992dc 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/validation/validation.go +++ b/vendor/k8s.io/apimachinery/pkg/util/validation/validation.go @@ -87,6 +87,8 @@ func IsFullyQualifiedName(fldPath *field.Path, name string) field.ErrorList { const labelValueFmt string = "(" + qualifiedNameFmt + ")?" const labelValueErrMsg string = "a valid label must be an empty string or consist of alphanumeric characters, '-', '_' or '.', and must start and end with an alphanumeric character" + +// LabelValueMaxLength is a label's max length const LabelValueMaxLength int = 63 var labelValueRegexp = regexp.MustCompile("^" + labelValueFmt + "$") @@ -107,6 +109,8 @@ func IsValidLabelValue(value string) []string { const dns1123LabelFmt string = "[a-z0-9]([-a-z0-9]*[a-z0-9])?" const dns1123LabelErrMsg string = "a DNS-1123 label must consist of lower case alphanumeric characters or '-', and must start and end with an alphanumeric character" + +// DNS1123LabelMaxLength is a label's max length in DNS (RFC 1123) const DNS1123LabelMaxLength int = 63 var dns1123LabelRegexp = regexp.MustCompile("^" + dns1123LabelFmt + "$") @@ -126,6 +130,8 @@ func IsDNS1123Label(value string) []string { const dns1123SubdomainFmt string = dns1123LabelFmt + "(\\." + dns1123LabelFmt + ")*" const dns1123SubdomainErrorMsg string = "a DNS-1123 subdomain must consist of lower case alphanumeric characters, '-' or '.', and must start and end with an alphanumeric character" + +// DNS1123SubdomainMaxLength is a subdomain's max length in DNS (RFC 1123) const DNS1123SubdomainMaxLength int = 253 var dns1123SubdomainRegexp = regexp.MustCompile("^" + dns1123SubdomainFmt + "$") @@ -145,6 +151,8 @@ func IsDNS1123Subdomain(value string) []string { const dns1035LabelFmt string = "[a-z]([-a-z0-9]*[a-z0-9])?" const dns1035LabelErrMsg string = "a DNS-1035 label must consist of lower case alphanumeric characters or '-', start with an alphabetic character, and end with an alphanumeric character" + +// DNS1035LabelMaxLength is a label's max length in DNS (RFC 1035) const DNS1035LabelMaxLength int = 63 var dns1035LabelRegexp = regexp.MustCompile("^" + dns1035LabelFmt + "$") @@ -282,6 +290,7 @@ const percentErrMsg string = "a valid percent string must be a numeric string fo var percentRegexp = regexp.MustCompile("^" + percentFmt + "$") +// IsValidPercent checks that string is in the form of a percentage func IsValidPercent(percent string) []string { if !percentRegexp.MatchString(percent) { return []string{RegexError(percentErrMsg, percentFmt, "1%", "93%")} @@ -391,13 +400,13 @@ func hasChDirPrefix(value string) []string { return errs } -// IsSocketAddr checks that a string conforms is a valid socket address +// IsValidSocketAddr checks that string represents a valid socket address // as defined in RFC 789. (e.g 0.0.0.0:10254 or [::]:10254)) func IsValidSocketAddr(value string) []string { var errs []string ip, port, err := net.SplitHostPort(value) if err != nil { - return append(errs, "must be a valid socket address format, (e.g. 0.0.0.0:10254 or [::]:10254)") + errs = append(errs, "must be a valid socket address format, (e.g. 0.0.0.0:10254 or [::]:10254)") return errs } portInt, _ := strconv.Atoi(port) diff --git a/vendor/k8s.io/apimachinery/pkg/util/wait/wait.go b/vendor/k8s.io/apimachinery/pkg/util/wait/wait.go index ca61168cd4..bc6b18d2b4 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/wait/wait.go +++ b/vendor/k8s.io/apimachinery/pkg/util/wait/wait.go @@ -88,6 +88,15 @@ func Until(f func(), period time.Duration, stopCh <-chan struct{}) { JitterUntil(f, period, 0.0, true, stopCh) } +// UntilWithContext loops until context is done, running f every period. +// +// UntilWithContext is syntactic sugar on top of JitterUntilWithContext +// with zero jitter factor and with sliding = true (which means the timer +// for period starts after the f completes). +func UntilWithContext(ctx context.Context, f func(context.Context), period time.Duration) { + JitterUntilWithContext(ctx, f, period, 0.0, true) +} + // NonSlidingUntil loops until stop channel is closed, running f every // period. // @@ -98,6 +107,16 @@ func NonSlidingUntil(f func(), period time.Duration, stopCh <-chan struct{}) { JitterUntil(f, period, 0.0, false, stopCh) } +// NonSlidingUntilWithContext loops until context is done, running f every +// period. +// +// NonSlidingUntilWithContext is syntactic sugar on top of JitterUntilWithContext +// with zero jitter factor, with sliding = false (meaning the timer for period +// starts at the same time as the function starts). +func NonSlidingUntilWithContext(ctx context.Context, f func(context.Context), period time.Duration) { + JitterUntilWithContext(ctx, f, period, 0.0, false) +} + // JitterUntil loops until stop channel is closed, running f every period. // // If jitterFactor is positive, the period is jittered before every run of f. @@ -151,6 +170,19 @@ func JitterUntil(f func(), period time.Duration, jitterFactor float64, sliding b } } +// JitterUntilWithContext loops until context is done, running f every period. +// +// If jitterFactor is positive, the period is jittered before every run of f. +// If jitterFactor is not positive, the period is unchanged and not jittered. +// +// If sliding is true, the period is computed after f runs. If it is false then +// period includes the runtime for f. +// +// Cancel context to stop. f may not be invoked if context is already expired. +func JitterUntilWithContext(ctx context.Context, f func(context.Context), period time.Duration, jitterFactor float64, sliding bool) { + JitterUntil(func() { f(ctx) }, period, jitterFactor, sliding, ctx.Done()) +} + // Jitter returns a time.Duration between duration and duration + maxFactor * // duration. // @@ -173,10 +205,68 @@ type ConditionFunc func() (done bool, err error) // Backoff holds parameters applied to a Backoff function. type Backoff struct { - Duration time.Duration // the base duration - Factor float64 // Duration is multiplied by factor each iteration - Jitter float64 // The amount of jitter applied each iteration - Steps int // Exit with error after this many steps + // The initial duration. + Duration time.Duration + // Duration is multiplied by factor each iteration. Must be greater + // than or equal to zero. + Factor float64 + // The amount of jitter applied each iteration. Jitter is applied after + // cap. + Jitter float64 + // The number of steps before duration stops changing. If zero, initial + // duration is always used. Used for exponential backoff in combination + // with Factor. + Steps int + // The returned duration will never be greater than cap *before* jitter + // is applied. The actual maximum cap is `cap * (1.0 + jitter)`. + Cap time.Duration +} + +// Step returns the next interval in the exponential backoff. This method +// will mutate the provided backoff. +func (b *Backoff) Step() time.Duration { + if b.Steps < 1 { + if b.Jitter > 0 { + return Jitter(b.Duration, b.Jitter) + } + return b.Duration + } + b.Steps-- + + duration := b.Duration + + // calculate the next step + if b.Factor != 0 { + b.Duration = time.Duration(float64(b.Duration) * b.Factor) + if b.Cap > 0 && b.Duration > b.Cap { + b.Duration = b.Cap + b.Steps = 0 + } + } + + if b.Jitter > 0 { + duration = Jitter(duration, b.Jitter) + } + return duration +} + +// contextForChannel derives a child context from a parent channel. +// +// The derived context's Done channel is closed when the returned cancel function +// is called or when the parent channel is closed, whichever happens first. +// +// Note the caller must *always* call the CancelFunc, otherwise resources may be leaked. +func contextForChannel(parentCh <-chan struct{}) (context.Context, context.CancelFunc) { + ctx, cancel := context.WithCancel(context.Background()) + + go func() { + select { + case <-parentCh: + cancel() + case <-ctx.Done(): + } + }() + return ctx, cancel } // ExponentialBackoff repeats a condition check with exponential backoff. @@ -190,19 +280,14 @@ type Backoff struct { // If the condition never returns true, ErrWaitTimeout is returned. All other // errors terminate immediately. func ExponentialBackoff(backoff Backoff, condition ConditionFunc) error { - duration := backoff.Duration - for i := 0; i < backoff.Steps; i++ { - if i != 0 { - adjusted := duration - if backoff.Jitter > 0.0 { - adjusted = Jitter(duration, backoff.Jitter) - } - time.Sleep(adjusted) - duration = time.Duration(float64(duration) * backoff.Factor) - } + for backoff.Steps > 0 { if ok, err := condition(); err != nil || ok { return err } + if backoff.Steps == 1 { + break + } + time.Sleep(backoff.Step()) } return ErrWaitTimeout } @@ -287,7 +372,9 @@ func PollImmediateInfinite(interval time.Duration, condition ConditionFunc) erro // PollUntil always waits interval before the first run of 'condition'. // 'condition' will always be invoked at least once. func PollUntil(interval time.Duration, condition ConditionFunc, stopCh <-chan struct{}) error { - return WaitFor(poller(interval, 0), condition, stopCh) + ctx, cancel := contextForChannel(stopCh) + defer cancel() + return WaitFor(poller(interval, 0), condition, ctx.Done()) } // PollImmediateUntil tries a condition func until it returns true, an error or stopCh is closed. @@ -317,36 +404,48 @@ type WaitFunc func(done <-chan struct{}) <-chan struct{} // WaitFor continually checks 'fn' as driven by 'wait'. // // WaitFor gets a channel from 'wait()'', and then invokes 'fn' once for every value -// placed on the channel and once more when the channel is closed. +// placed on the channel and once more when the channel is closed. If the channel is closed +// and 'fn' returns false without error, WaitFor returns ErrWaitTimeout. // -// If 'fn' returns an error the loop ends and that error is returned, and if +// If 'fn' returns an error the loop ends and that error is returned. If // 'fn' returns true the loop ends and nil is returned. // -// ErrWaitTimeout will be returned if the channel is closed without fn ever +// ErrWaitTimeout will be returned if the 'done' channel is closed without fn ever // returning true. +// +// When the done channel is closed, because the golang `select` statement is +// "uniform pseudo-random", the `fn` might still run one or multiple time, +// though eventually `WaitFor` will return. func WaitFor(wait WaitFunc, fn ConditionFunc, done <-chan struct{}) error { - c := wait(done) + stopCh := make(chan struct{}) + defer close(stopCh) + c := wait(stopCh) for { - _, open := <-c - ok, err := fn() - if err != nil { - return err - } - if ok { - return nil - } - if !open { - break + select { + case _, open := <-c: + ok, err := fn() + if err != nil { + return err + } + if ok { + return nil + } + if !open { + return ErrWaitTimeout + } + case <-done: + return ErrWaitTimeout } } - return ErrWaitTimeout } // poller returns a WaitFunc that will send to the channel every interval until // timeout has elapsed and then closes the channel. // // Over very short intervals you may receive no ticks before the channel is -// closed. A timeout of 0 is interpreted as an infinity. +// closed. A timeout of 0 is interpreted as an infinity, and in such a case +// it would be the caller's responsibility to close the done channel. +// Failure to do so would result in a leaked goroutine. // // Output ticks are not buffered. If the channel is not ready to receive an // item, the tick is skipped. diff --git a/vendor/k8s.io/apimachinery/pkg/util/yaml/decoder.go b/vendor/k8s.io/apimachinery/pkg/util/yaml/decoder.go index 63d735a804..a9a3853ac3 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/yaml/decoder.go +++ b/vendor/k8s.io/apimachinery/pkg/util/yaml/decoder.go @@ -217,11 +217,9 @@ func (d *YAMLOrJSONDecoder) Decode(into interface{}) error { if d.decoder == nil { buffer, origData, isJSON := GuessJSONStream(d.r, d.bufferSize) if isJSON { - klog.V(4).Infof("decoding stream as JSON") d.decoder = json.NewDecoder(buffer) d.rawData = origData } else { - klog.V(4).Infof("decoding stream as YAML") d.decoder = NewYAMLToJSONDecoder(buffer) } } diff --git a/vendor/k8s.io/apimachinery/pkg/watch/streamwatcher.go b/vendor/k8s.io/apimachinery/pkg/watch/streamwatcher.go index d61cf5a2e5..8af256eb12 100644 --- a/vendor/k8s.io/apimachinery/pkg/watch/streamwatcher.go +++ b/vendor/k8s.io/apimachinery/pkg/watch/streamwatcher.go @@ -17,13 +17,15 @@ limitations under the License. package watch import ( + "fmt" "io" "sync" + "k8s.io/klog" + "k8s.io/apimachinery/pkg/runtime" "k8s.io/apimachinery/pkg/util/net" utilruntime "k8s.io/apimachinery/pkg/util/runtime" - "k8s.io/klog" ) // Decoder allows StreamWatcher to watch any stream for which a Decoder can be written. @@ -39,19 +41,28 @@ type Decoder interface { Close() } +// Reporter hides the details of how an error is turned into a runtime.Object for +// reporting on a watch stream since this package may not import a higher level report. +type Reporter interface { + // AsObject must convert err into a valid runtime.Object for the watch stream. + AsObject(err error) runtime.Object +} + // StreamWatcher turns any stream for which you can write a Decoder interface // into a watch.Interface. type StreamWatcher struct { sync.Mutex - source Decoder - result chan Event - stopped bool + source Decoder + reporter Reporter + result chan Event + stopped bool } // NewStreamWatcher creates a StreamWatcher from the given decoder. -func NewStreamWatcher(d Decoder) *StreamWatcher { +func NewStreamWatcher(d Decoder, r Reporter) *StreamWatcher { sw := &StreamWatcher{ - source: d, + source: d, + reporter: r, // It's easy for a consumer to add buffering via an extra // goroutine/channel, but impossible for them to remove it, // so nonbuffered is better. @@ -102,11 +113,13 @@ func (sw *StreamWatcher) receive() { case io.ErrUnexpectedEOF: klog.V(1).Infof("Unexpected EOF during watch stream event decoding: %v", err) default: - msg := "Unable to decode an event from the watch stream: %v" if net.IsProbableEOF(err) { - klog.V(5).Infof(msg, err) + klog.V(5).Infof("Unable to decode an event from the watch stream: %v", err) } else { - klog.Errorf(msg, err) + sw.result <- Event{ + Type: Error, + Object: sw.reporter.AsObject(fmt.Errorf("unable to decode an event from the watch stream: %v", err)), + } } } return diff --git a/vendor/k8s.io/apimachinery/pkg/watch/watch.go b/vendor/k8s.io/apimachinery/pkg/watch/watch.go index be9c90c03d..3945be3ae6 100644 --- a/vendor/k8s.io/apimachinery/pkg/watch/watch.go +++ b/vendor/k8s.io/apimachinery/pkg/watch/watch.go @@ -44,6 +44,7 @@ const ( Added EventType = "ADDED" Modified EventType = "MODIFIED" Deleted EventType = "DELETED" + Bookmark EventType = "BOOKMARK" Error EventType = "ERROR" DefaultChanSize int32 = 100 @@ -57,6 +58,10 @@ type Event struct { // Object is: // * If Type is Added or Modified: the new state of the object. // * If Type is Deleted: the state of the object immediately before deletion. + // * If Type is Bookmark: the object (instance of a type being watched) where + // only ResourceVersion field is set. On successful restart of watch from a + // bookmark resourceVersion, client is guaranteed to not get repeat event + // nor miss any events. // * If Type is Error: *api.Status is recommended; other types may make sense // depending on context. Object runtime.Object diff --git a/vendor/modules.txt b/vendor/modules.txt index 260110b4c8..823e34f9f2 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -66,9 +66,10 @@ github.com/golang/protobuf/ptypes/duration github.com/golang/protobuf/ptypes/timestamp # github.com/google/btree v1.0.0 github.com/google/btree -# github.com/google/go-cmp v0.2.0 +# github.com/google/go-cmp v0.3.0 github.com/google/go-cmp/cmp github.com/google/go-cmp/cmp/internal/diff +github.com/google/go-cmp/cmp/internal/flags github.com/google/go-cmp/cmp/internal/function github.com/google/go-cmp/cmp/internal/value # github.com/google/gofuzz v1.0.0 @@ -111,7 +112,7 @@ github.com/mattn/go-isatty github.com/mgutz/ansi # github.com/mitchellh/go-homedir v1.1.0 github.com/mitchellh/go-homedir -# github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421 +# github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd github.com/modern-go/concurrent # github.com/modern-go/reflect2 v1.0.1 github.com/modern-go/reflect2 @@ -171,7 +172,7 @@ golang.org/x/crypto/internal/subtle golang.org/x/crypto/poly1305 golang.org/x/crypto/ssh golang.org/x/crypto/ssh/terminal -# golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3 +# golang.org/x/net v0.0.0-20190812203447-cdfb69ac37fc golang.org/x/net/context golang.org/x/net/context/ctxhttp golang.org/x/net/html @@ -190,7 +191,7 @@ golang.org/x/sync/errgroup golang.org/x/sys/cpu golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/text v0.3.0 +# golang.org/x/text v0.3.1-0.20181227161524-e6919f6577db golang.org/x/text/encoding golang.org/x/text/encoding/charmap golang.org/x/text/encoding/htmlindex @@ -201,6 +202,8 @@ golang.org/x/text/encoding/korean golang.org/x/text/encoding/simplifiedchinese golang.org/x/text/encoding/traditionalchinese golang.org/x/text/encoding/unicode +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact golang.org/x/text/internal/tag golang.org/x/text/internal/utf8internal golang.org/x/text/language @@ -229,7 +232,7 @@ gopkg.in/inf.v0 gopkg.in/ini.v1 # gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 gopkg.in/tomb.v1 -# gopkg.in/yaml.v2 v2.2.2 +# gopkg.in/yaml.v2 v2.2.4 gopkg.in/yaml.v2 # k8s.io/api v0.0.0-20190222213804-5cb15d344471 k8s.io/api/admissionregistration/v1alpha1 @@ -264,14 +267,13 @@ k8s.io/api/settings/v1alpha1 k8s.io/api/storage/v1 k8s.io/api/storage/v1alpha1 k8s.io/api/storage/v1beta1 -# k8s.io/apimachinery v0.0.0-20190221213512-86fb29eff628 +# k8s.io/apimachinery v0.15.7 k8s.io/apimachinery/pkg/api/equality k8s.io/apimachinery/pkg/api/errors k8s.io/apimachinery/pkg/api/meta k8s.io/apimachinery/pkg/api/resource k8s.io/apimachinery/pkg/apis/meta/v1 k8s.io/apimachinery/pkg/apis/meta/v1/unstructured -k8s.io/apimachinery/pkg/apis/meta/v1beta1 k8s.io/apimachinery/pkg/conversion k8s.io/apimachinery/pkg/conversion/queryparams k8s.io/apimachinery/pkg/fields