CombineFragandDBGraph

[KunathBJ]

Hello,

I'm trying to ru Graph2Pro but I'm kinda stuck at the step 7.

I get 2 errors, that are believed are link to the way the files look like. I used fastg from Metaspades and performed everything as explained in the protocol. So I'm not sure what to change in my file to make them fit.

Here are the errors:
“The argv should be
LYLVEGDITTMAVDAVVNAANNTLLGGGGVDGAIHR NODE_29_length_114022_cov_846.434_15835_16368_+
Traceback (most recent call last):
File "/mnt/users/benoitk/Graph2prot/Graph2Pro-master/utils/combineFragandDBGraph.py", line 89, in
edge1 = int(proteins[0])
ValueError: invalid literal for int() with base 10: 'NODE'”

“The argv should be
LYDDGTFAIPSDLEWSGQPDTWTGTYTGNPNLHVR BPBCJIND_05758
Traceback (most recent call last):
File "/mnt/users/benoitk/Graph2prot/Graph2Pro-master/utils/combineFragandDBGraph.py", line 86, in
geneSequence = FGSNAFasta[protein][0:100]
KeyError: 'BPBCJIND_05758'”

Thanks a lot for your help,

Benoit